2.20 Rating by ClearWebStats
zonemaster.org is 7 years 1 month 1 week old. This website is a sub-domain of org. This website has a #5,560,935 rank in global traffic. The DNS for Zonemaster is hosted at 173.237.137.16. While no active threats were reported recently by users, zonemaster.org is SAFE to browse.
Get Custom Widget

Traffic Report of Zonemaster

Daily Unique Visitors: 87
Daily Pageviews: 174

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for zonemaster.org Good
WOT Privacy: WOT privacy rank for zonemaster.org Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 5,560,935
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 74on 100
Siteadvisor Rating
View zonemaster.org site advisor rating Not Applicable

Where is zonemaster.org server located?

Hosted IP Address:

173.237.137.16 View other site hosted with zonemaster.org

Hosted Country:

zonemaster.org hosted country US zonemaster.org hosted country

Location Latitude:

30.3423

Location Longitude:

-97.6673

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View zonemaster.org HTML resources

Homepage Links Analysis

Zone Master – Custom Luxury Home – Get a new property with zone master and build your dream home.

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • zonemaster.or
  • zonemaster.com
  • zonemaster.net
  • zzonemaster.org
  • zoonemaster.org
  • zonnemaster.org
  • zoneemaster.org
  • zonemmaster.org
  • zonemaaster.org
  • zonemasster.org
  • zonemastter.org
  • zonemasteer.org
  • zonemasterr.org
  • onemaster.org
  • znemaster.org

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 51
H3 Headings: 9 H4 Headings: Not Applicable
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 173.237.137.16)

Add website, add your company, free listing

zonemaster.org favicon - alplist.com

View zonemaster.org Pagerank   zonemaster.org alexa rank 16,662   zonemaster.org website value $ 498,960.00


No Nonsense Fat Melting System Review - Does It Work? PDF Download!

zonemaster.org favicon - nononsensefatmeltingsystemreviews.com

Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.

View zonemaster.org Pagerank   zonemaster.org alexa rank Not Applicable   zonemaster.org website value $ 8.95

Finetest Functional ATE and Power Supply Testers

zonemaster.org favicon - finetest2.com

Power Supply Testers, Functional ATE, Military and Aerospace Systems, Functional ATE Systems, Power Supply Test Systems, Hi-Pot Test Systems, ESS Monitoring Systems, Burnin Monitoring Systems, Vibration Monitoring Systems, Manual Test Systems, Test Fixtures and ITAs, Box Builds and Sub-Assemblies, Switching Cards, IO Cards, Custom Cabinets, Custom Cabinet Accessories, Fixtures, Test Programs, UPS Testers, Burn-In, Hipot, Military Power...

View zonemaster.org Pagerank   zonemaster.org alexa rank Not Applicable   zonemaster.org website value $ 8.95

Websites Directory Network

zonemaster.org favicon - websitedirectorynetwork.com

View zonemaster.org Pagerank   zonemaster.org alexa rank 769,618   zonemaster.org website value $ 960.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.16.0
Date: Mon, 03 Jun 2019 19:55:40 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://zonemaster.org/wp-json/>; rel="https://api.w.org/", <http://zonemaster.org/>; rel=shortlink
Content-Encoding: gzip

Domain Information for zonemaster.org

Domain Registrar: ONLINE SAS zonemaster.org registrar info
Registration Date: 2019-01-12 7 years 1 month 1 week ago
Last Modified: 2019-01-12 7 years 1 month 1 week ago
Domain Status: clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
zonemaster.org A 5993 IP:173.237.137.16
zonemaster.org NS 21599 Target:ns2.speedydns.net
zonemaster.org NS 21599 Target:ns1.speedydns.net
zonemaster.org SOA 21599 MNAME:ns1.speedydns.net
RNAME:none.none.com
Serial:2018061900
Refresh:3600
Retry:7200
Expire:1209600
Minimum TTL:86400
zonemaster.org MX 14399 Target:zonemaster.org
zonemaster.org TXT 14399 TXT:v=spf1 +a +mx +ip4:65.99.237.24
+include:websitewelcome.com ~all

Similarly Ranked Websites to Zonemaster

Col·legi Sant Pau de Reus |

zonemaster.org favicon - stpau.cat

View zonemaster.org Pagerank   Alexa rank for zonemaster.org 5,560,938   website value of zonemaster.org $ 240.00

holiday cottages uk

zonemaster.org favicon - holidaycottages-uk.com

holiday cottages uk

View zonemaster.org Pagerank   Alexa rank for zonemaster.org 5,560,956   website value of zonemaster.org $ 240.00

DİLERART MANTOLAMA DEKORASYON

zonemaster.org favicon - dilerart.com

Isı Yalıtım, Mantolama,

View zonemaster.org Pagerank   Alexa rank for zonemaster.org 5,560,973   website value of zonemaster.org $ 240.00

softsolution.online - This website is for sale! - softsolution Resources and Information.

zonemaster.org favicon - softsolution.online

This website is for sale! softsolution.online is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, softsolution.online has it all. We hope you find what you are searching for!

View zonemaster.org Pagerank   Alexa rank for zonemaster.org 5,560,999   website value of zonemaster.org $ 240.00

Butter By Nadia

zonemaster.org favicon - shopbutterbynadia.com

Butter By Nadia : - SIGNATURE SUPER SALE . . shop, online shopping

View zonemaster.org Pagerank   Alexa rank for zonemaster.org 5,561,001   website value of zonemaster.org $ 240.00