0% found this document useful (0 votes)
35 views338 pages

CADD Slides

Uploaded by

Aniket Panchal
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
35 views338 pages

CADD Slides

Uploaded by

Aniket Panchal
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

COMPUTER AIDED DRUG DESIGN

BIO563
Arjun Ray (Instructor) : [email protected]
Department of Computational Biology

TA:
Riddhi Sharma ([email protected]) Introduction
Bhumika Choudhary ([email protected])
MY BACKGROUND
Visva-Bharati University Stockholm University CSIR-IGIB

B.Sc. and M.Sc. M.Phil. Ph.D.


Chemistry (Organic) Biophysics Biology

Large-scale
European computing
Cambridge
Bioinformatics
University
Institute (EBI)

Protein, nucleotides

Protein Structures 1000 genome project


Fundamental Bioinformatics tool Applied
Research development Research
• Ray, A., et al. (2018). Specific • Ray, A., et al. (2018). • Ghosh, A., et al. (2018).
cholesterol binding drives Probing molecular forces in Targeting miRNA by tunable
drastic structural alterations in multi-component small molecule binders: peptidic
Apolipoprotein A1. The journal physiological membranes. aminosugar mediated
of physical chemistry letters Physical Chemistry interference in miR-21
• Paul, D. (2017). A-to-I editing in Chemical Physics biogenesis reverts epithelial to
human miRNAs is enriched in • Ray, A., et al. (2012). mesenchymal
seed sequence, influenced by Improved model quality transition. MedChemComm.
sequence contexts and assessment using ProQ2. • Bansal, T. et al. (2017).
significantly hypoedited in BMC bioinformatics Arjunolic acid, a peroxisome
glioblastoma multiforme. • Ray, A., et al. (2010). Model proliferator-activated receptor α
Scientific Reports. quality assessment for agonist, regresses cardiac
membrane proteins. fibrosis by inhibiting non-
Bioinformatics canonical TGF-β signaling.
Journal of Biological
Chemistry
Applied Research
Ghosh, A., et al.(2018). MedChemComm,9(7), 1147-1154.
Bioinformatics
tool
development

Fundamental Applied
Research Research

∆G
Bose, D., et al. (2015). binding
= ∆G vdW
Nucleic acids research, 43(8),
+ ∆Gelec + ∆Ghbond + ∆Gdesolv + ∆Gtors
4342-4352.

Bansal, T. et al. (2017). Journal of Biological Chemistry, 292(40), 16440-16462.


AREA OF EXPERTISE
• Structure prediction
• Ligand/Drug – Protein interaction
• Molecular dynamics simulation
• Other biological structural problems (DNA, RNA, miRNA,
lncRNA etc.)

Biology Chemistry Physics Computer Science


COURSE DETAILS
COURSE ASSESSMENT
Share %

Mid-Semester Exam 20

End-Semester Exam 30

Assignment 20

Quizzes (2/3) 20

Attendance/Interaction 10

Minimum marks to pass the course: 35


ATTENDANCE
• 100-80 % = 10
• 79-60 = 9
• 59-40 = 8
• 39-20 = 7
• < 20 = 1
GRADING SCHEME (RELATIVE MARKING)

Grade Marks %
F <35

Minimum marks NEEDED to be scored to be


graded in relative scale!
RESOURCES
• Molecular Modeling: Principles and Applications
Andrew R. Leach
• DRUG DISCOVERY AND DEVELOPMENT – PRESENT AND FUTURE
Edited by Izet M. Kapetanovic

• Textbook of Drug Design and Discovery


Povl Krogsgaard-Larsen, Tommy Liljefors and Ulf Madsen
WHAT IS TO BE GAINED FROM THIS COURSE?

• Getting a grasp with basics of structure-ligand relationship


• Thinking on multi-scale approach
• Macro to micro
• Analyzing biological process in spatio-temporal manner
• Realizing the potential of drug discovery!

Preparing for the jobs ahead!


COURSE EXPECTATIONS

• Self-study of topics and concepts covered in the class


(Queries/questions are always welcome)
• Group interaction
• Interaction in class is a must!
POLICY ON PLAGIARISM

“The policy is applicable to all the components of course


assessment including assignments, projects, quiz,
examinations, and the like. Since the policy is applied
across courses, it is essential to report any instance of
plagiarism, use of unfair means, academic dishonesty
by students, or facilitation of any such cases by TAs or
TFs, whenever and wherever they may occur, to the
Academic Section.”
Misconduct/use of unfair means in assignments/projects Penalty

1. First misconduct/use of unfair means during the entire stay in IIIT-Delhi Zero in the assignment (awarded by
faculty) + one letter grade less in the
course.
2. Second misconduct/use of unfair means during entire stay in IIIT-Delhi Student is assigned an F grade in the
course.

3. Third or further misconduct/use of unfair means during the entire stay Student is assigned an F grade in the
in IIIT-Delhi course and the case is reported to DAC,
who may suspend the student for 1
semester to a year.

Misconduct/use of unfair means in quiz/midsem/endsem Penalty

1. First misconduct/use of unfair means during the entire stay in IIIT-Delhi Student is assigned an F grade in the
course.

2. Second misconduct/use of unfair means during the entire stay in IIIT- Student is assigned an F grade in the
Delhi course and student may be suspended
from the program for 1-2 semesters by
DAC.

3. Third misconduct/use of unfair means during the entire stay in IIIT- Student is assigned an F grade in the
Delhi course and student's program may be
terminated by DAC.
DIVISION OF GROUPS
• Group will have the responsibility of
• Project
• Group assignments
• The group members are going to be assessed on cumulative
grading. In case of a non-functional member, it is the
responsibility of the group to bring it to the notice of the
TA/Instructor.
• It shall be the group’s responsibility to ensure the submitted
assignment/project is in tune with the policy of plagiarism.
COURSE LAYOUT

6-
Weeks 1 2 3 4 5
7

Introduction of
Introducti Biomolecular Introduction
Structure-Function simulations, application
on to of various
relation and properties in present research field,
drug simulation
of protein concept of molecular
discovery Force Fields and methods
Thermostats.

MID-Semester Exam

External experts
TECHNIQUES THAT WILL BE TAUGHT
• Structure Prediction: 1D to 3D
• Molecular dynamics
• Virtual Screening
• Pharmacophore modeling
TECHNIQUES THAT WILL BE TAUGHT
• Structure Prediction: 1D to 3D
• Molecular dynamics
• Molecular docking
• Virtual screening of drug molecules
Drug Discovery/Development Pipeline
• Multifaceted, complicated, lengthy process

Today's Focus

HO OH
OH HO N
OH OH O
O O O
O N O-
O O
N
O H

Products
O F
OH O
NH2
OH
N N N NHCH3
N N O HN
N CO2H
N H2N O
N N S
F O
O2S
N
N N
N CF3
F
Cl
Cl

Cl

CH3O
O

N
H
O

O
O

Discovery Exploratory Development Full Development


NH2

Phase I Phase II Phase III

0 5 10 15
Idea 12 -15 Years Drug
Lead Optimization
• Iterative process impacted by technology

Combinatorial
Structure-based
Chemistry Idea Generation design

Chemical Synthesis Data Analysis

Computational
Biological Evaluation evaluation

Biochemical assays
Antiviral assays Typical
Met./abs./sol. assays project
Pharmacokinetics progression
Development
in vitro / in vivo
Safety assessments Candidate
Drug Discovery: an Industrial Process

How are drugs discovered and developed?

Lecture 2
Format of this class
• I’m going to walk you through the process of modern
drug discovery
• This is just a framework, so I’d like today to be an
interactive process.
• I’ll ask questions and hope that you will do so too.
• Don’t worry about asking “stupid” questions. I’ve
based a career around this.

2
All projects start with an idea
• The value of a project depends upon the
quality of the idea

• Realistically, you will only have great ideas


if you are very experienced and steeped in
the field.

• In general the ideas can be categorised as


therapeutic area led or
3
mechanistically led.
Advancing your idea

• You have to convince a number of people that


your idea is worth spending a great deal of
money on.

• So the better the idea and plan, the more the


chance of succeeding

4
Generating an hypothesis

• An hypothesis is generated from either in-


house experimentation, or from external
published material, or just the eureka
moment in the bath
• The hypothesis should link a process to a
fundamental pathological pathway
• Modifying the pathway should be expected to
be curative or antisymptomatic.

5
What is the process that underpins drug discovery?

• This is the workflow for the production of a novel monoclonal


antibody therapy, but the process is broadly similar for all NCE
development
What is a target?
• A target is any system that can potentially be
modulated by a molecule to produce a beneficial
effect.
• Generally, a target is a protein molecule although it
could be any biological, be it nucleic acid,
carbohydrate or lipid etc.
• In the past, an animal model of disease could
represent a target
7
Target identification
In essence, pharmacology is the science of the
interaction of xenobiotics* with components of the living
body
Such compounds interact with the human body through
binding to a biological molecule, generally proteins, but
also nucleic acids, fatty acids, carbohydrates amongst
others
As a result of the interaction, the function of the target is
modified, such that a change in a pathway is induced
It is intended that the modification of the pathway will
produce a beneficial effect on a disease process
*A compound foreign to an organism
8
Target validation
• Effectively, target validation is a form of risk
assessment. The better the validation, the lower
the risk in advancing a project.
• Hunch<anecdotal findings<literature
precedent<cell model<animal
model<pharmacology in animal
model<pharmacology in human disease
9
This approach is not so common
now

10
Some reading around this topic

• The following articles deal with the topic of


target identification and validation and are
available as free downloads at
www.drugdiscoverytoday.com
– Identifying and validating novel targets with in vivo disease models: Guidelines for
study design
– Target discovery from data mining approaches
– Disease-specific target selection: a critical first step down the right road

11
Don’t underestimate the importance of proper planning

12
Starting a project

• To explore the potential of your newly-


validated target, you need to populate a
team. The team needs to have individuals
with different expertise in order to advance
the project.

13
Development of a project team
• Assay development
– Molecular biologist, in vitro pharmacologist, automation specialist
• Computational chemist and biologist
• Medicinal Chemistry
– Medicinal chemist(s); process chemists
• ADME* specialists
• In vivo pharmacologist
• Pathologist
• IT and IP support

*(absorption, distribution, metabolism, and excretion)


How long do you spend on a
project?
• It is human nature to champion your own idea
and, in the past, people would continue to carry
on with a project long after it should have been
abandoned
• Nowadays, with the advent of high throughput
technologies, it is common that a project would
last about 18 months
15
Phases of a project
• High throughput screening
• Hit identification
– A ‘hit’ is a compound that has activity at a predetermined
level against a target
• Hit validation
– ‘Hits’ are screened against an alternative assay (this could
be a functional assay or a different assay format) to rule
out false positives

16
Hit identification
• Those molecules that are identified at this stage have an
affinity for the target, but little else is known about
them.
• For example, in the case of receptors, it would be
difficult (or impossible) from a traditional binding assay
to determine whether they were antagonists, agonists,
partial agonists, inverse agonists or even allosteric
modulators, without performing further investigations

17
Hit identification

• Once you have validated a target, the next step in the


process is hit identification
• To do this, you need to develop a test system that will allow
you to determine compounds that interact with your target
– In the past, this was often achieved by using whole animal systems
– With the advent of molecular biology, however, it is common to
test for interactions using recombinant proteins expressed in cell
lines
– Such approaches have resulted in a very significant reduction in
animal usage by the pharmaceutical industry.

18
Lead identification
• Validated hits are virtually never the complete
article with respect to being a drug

• The next phase is to identify those hits that have


properties (other than just activity against the
target) that would indicate that they have
potential for being developed as drugs.
19
Some reading around this topic
• The following articles deal with the topic of
lead optimisation and are available as free
downloads at www.drugdiscoverytoday.com
– Thermodynamics guided lead discovery and optimization

– Modelling iterative compound optimisation using a self-avoiding walk

– Outsourcing lead optimization: constant change is here to stay

20
Lead identification
• At this stage, validated hits would be tested to determine factors
such as:

– Selectivity versus a panel of other receptors (targets)

– Physicochemical characteristics

– Drug-like properties

– Metabolic properties (half life etc.)

• Those molecules with acceptable potency, physical and ADME


properties can be advanced through lead optimisation

21
Lead optimisation

• Those molecules fulfilling the lead identification


criteria can go to molecular finishing school
– At this stage, medicinal chemists conduct extensive
experimentation to improve potency and selectivity.

– Also, this is the opportunity to improve


physicochemical and drug-like properties

22
Lead optimisation

• When the field has been narrowed down, the


best molecules are advanced to animal
models and preliminary toxicology

23
Lead optimisation
• Individuals involved in this process include:
– Molecular and computational bioscientist

– Medicinal Chemist

– Pharmacokinetics group

– Formulation group

– Clinical researchers
24
Candidate selection
• At this stage, those optimised leads are scrutinised
for their properties:
– Potency
– Selectivity
– Bioavailability
– IP position
– Safety
– Scale up potential (can you make enough of it cheaply
enough?)
– The data on the successful candidate will then be
submitted to the appropriate health authorities to get
permission to conduct clinical investigations

25
Can we reduce animal usage?
• In short the answer is yes
• In fact there has been a significant reduction in animal usage in the
Pharma industry over the last few years as a result of the
introduction of new technology and approaches
• More than 82% of the animals used for experimentation are
rodents. Only 4% of experiments are performed in mammals other
than rodents.
• There has been a fall of 16% in animal usage since 1987
• The UK is probably the most regulated country in the world with
respect to animal experimentation
• There are good reasons why companies want to reduce animal
usage, not least financial
• For more information see http://www.nc3rs.org.uk/page.asp?id=8

26
This process doesn’t take long –
right?
• The process that was just outlined takes in the order
of 3-5 years to get to candidate selection
• From candidate selection to launch it can take
around 9 years
• Overall time from beginning to end of the process
averages out at about 9-16 years*

*John La Mattina (2008) Drug Truths. Dispelling the myths about Pharma R&D. Wiley
Myth 1: Drugs are overpriced

28
Just how much does it cost?
• This is quite a hard question to answer,
but a study by Joe DiMasi* estimated
that it cost on average $800,000,000 to
develop a new drug
• Although not confirmed, estimates for
development of a new drug are now in
the order of $0.5 - 2 billion**

*DiMasi JA, Hansen RW, Grabowski HG. J Health Econ. 2003 22(2):151-85
**Adams C, Brantner V (2006). Health Aff (Millwood) 25 (2): 420–8
29
Myth 3: We can do all of this by computer (revisited)

• Predicting just how a molecule will behave in a mammal is a


particularly difficult task
• No matter how powerful the computer is, it is limited by the
knowledge of those performing the test – it would require that
we know pretty much everything about every biological
system, which, obviously, we don’t
• Even if we did understand all the biological systems, we would
have to predict how such a molecule would interact with the
various components of the system, which we can’t
• The point here would be – would you be more confident of the
prediction of safety of a molecule based purely on computer
simulations, or one that had been tested in animals?
• Moreover, this approach is just as likely to miss rare events,
based on individual genetic traits

30
31
Just how much does it cost?

• Broken down, the cost broadly works out


at
– Around $335 million in the preclinical phases

– Around $467 million in the clinical trial phases

– Around $100 million in Post approval costs

32
Drug Discovery: an Industrial Process

How are drugs discovered and


developed?

Lecture 3
2
Just how much does it cost?
• Broken down, the cost broadly works
out at
– Around $335 million in the preclinical
phases
– Around $467 million in the clinical trial
phases
– Around $100 million in Post approval costs

3
Don’t forget, it also costs to develop the ones that fail

• Although these figures are a little out of date* (they


are probably worse now with the introduction of
HTS), it gives an idea of how wasteful the process is
• For every 30,000 compounds synthesized
– 2000 (6.7%) enter preclinical development
– 200 (0.67%) enter phase 1 trials
– 40 (0.13%) enter phase 2 clinical trials
– 12 (0.04%) enter phase 3 clinical trials
– 8 (0.027%) are approved
– 1 (0.003%) makes a satisfactory ROI
*Christine A. Shillingford and Colin W. Vose Effective decision-making: progressing
compounds through clinical development DDT Vol. 6, No. 18 September 2001
4
Drug Discovery is a very wasteful game

5
Don’t forget, it also costs to develop the ones that fail!

• Attrition at late clinical trial phase is very expensive


and can be disastrous for smaller companies
• It is important to point out that in the last few years,
some compounds have been pulled out late because
it was thought that they would not make a ROI.
• Clearly just getting a drug on the market is not a case
of the goose laying the golden egg

6
It’s an expensive business

R&D investment in the USA between 1970 and 2004. Source is the PhRMA annual
survey (www.phrma.org/publications/publications/17.03.2005.1142.cfm).
Example: the development of antidepressant drugs

• Initially it was observed that modulation of biogenic amine


levels were implicated in the development of depression
• The hypothesis was that pharmacological modulation of
biogenic amines could be a process useful in the treatment of
depression
• How could this be achieved?

– By increasing the synthesis of transmitter


– By preventing its breakdown
– By producing agonists capable of stimulating post synaptic receptors
– By preventing the reuptake of neurotransmitter from the synaptic cleft

8
Which hypothesis was adopted?

• Actually, all of those hypotheses have been used in


the past, some to greater effect than others
• For the sake of example let us consider the final
hypothesis
– Preventing the reuptake of neurotransmitter from the
synaptic cleft will have an effect on their synaptic
concentration
– Increasing the levels of biogenic amine will produce an
antidepressant effect
– Such increases could be achieved by inhibiting the
appropriate neurotransmitter transporter

10
How would we go about developing a drug based upon
this hypothesis?

• We have now identified our target – the serotonin reuptake


transporter
• The next part of the process involved validating the target
• Target validation involved a number of approaches:
– Collecting all available information in the public domain that support
the hypothesis
– Developing in vitro and in vivo systems that can be used to support the
hypothesis
– Entering into agreements with external experts who can help with
verifying the hypothesis
– Assuming the hypothesis is sufficiently well validated, the team can
move to the next phase which is hit identification.

11
Myth 2: We can do all of this by
computer
• At present, this is not possible
• This is not a problem of computer power as such, but
the intrinsic problem of how to predict conformation
from scratch
• If you have a starting point, i.e. a molecule that you
know interacts with your target, it will help you
design the next molecule
• The value of computer simulation is in getting you to
the optimal compound as quickly as possible, not in
designing ligands de novo

12
Myth 4: Animal models are useless in determining the action of
drugs

• This is an interesting point and one that requires some


discussion
• No one would make the case that animal models are identical to
the human condition, however, one must consider the
following:
– Every modern drug will have had to have passed efficacy
and safety studies in animals. So pretty much every drug in
the pharmacopoeia is an example of where animal models
have been a success
– Of course we can’t really know how effective the screens are
in weeding out unsafe drugs, as clearly it would be unethical
to test compounds in humans if there were concerns over
safety
– Those who point to the inadequacies of animal testing point
to a very small number of anomalies and I quote in the next
slide from the website of Animal Aid

13
Myth 4: Animal models are useless in determining the action of
drugs
This is a direct quote from the website of Animal Aid
“A good example of how different species react to a chemical or medicine is penicillin, which is
one of the most commonly used antibiotics today. Penicillin is toxic to guinea pigs, yet it cures
humans. Products such as aspirin and paracetamol, commonly used to treat people, are
highly poisonous to cats. Aspirin causes birth defects in most laboratory animals, but not in
humans, and chocolate is poisonous to dogs!”

• With respect to the comments above, should toxicity testing be performed in a single
species, the comments on penicillin might have some validity. If, however, penicillin
went through standard efficacy and toxicity screens (in multiple species) today, it
would likely pass.
•As for paracetamol, the implication is that this compound is not toxic in humans and
that somehow cats are anomalous in their response to this agent. I leave you to come
to your own conclusions on this one.
•When a massive population is exposed to any external agent, you might expect a
small proportion to respond unfavourably (and unpredictably). This is no different for
drug molecules than any other.
• What else would you use? Would you be prepared to accept molecules that had
been tested by some other means? Or should we accept that we should not continue
with the development of drugs to treat unmet medical need?

14
https://www.peta.org/issues/animals-used-for-experimentation/animal-testing-
bad-science/
Clinical Trials
• Once a candidate has been selected and the
various safety hurdles addressed it can be
entered into clinical trial.

18
Phase 1 clinical trials
• Phase 1 trials generally focus on safety,
tolerability and bioavailability properties
rather than efficacy
• The drug is administered to a small number of
healthy volunteer trial participants

19
Phase 2 clinical trials
• Phase 2 trials are focused on determining the
efficacy of the drug in a larger number of patients
(perhaps several hundred) suffering from the
condition that the drug is intended to treat
• These trials may be performed globally and give
information on efficacy and allow for a further
estimation of safety in a larger population

20
Phase 3 clinical trials
• Assuming satisfactory results from phase 2 studies, the drug
will enter phase 3 clinical trials
• Phase 3 clinical trials are in essence larger versions of the
previous trials intended to answer specific questions with
respect to efficacy
• The trials would routinely involve several thousand patients
and compare the i.n.d. with drugs that are currently in use for
the treatment of the disease (“comparators”)
• The results from these trials essentially form the basis of the
risk/benefit analysis that will be submitted to the regulatory
authorities

21
Phase 4 clinical trials
• These trials are often referred to as post-marketing
studies and they are performed after the medicine
has been approved
• These give a greater idea of long term risk and
benefit and may give indications as to how use can
be modified
• The trials may involve many thousands of patients
and go on for many years
• Such trials may assist in indicating other uses for the
medicine

22
Observations
• Over the past 20 years there has been a number of
changes in the Pharmaceutical industry
• There has been a shift from a “black box” discovery
process to a “mechanistic” approach to drug
discovery
• Although there are benefits to this approach, there
are some issues:
– The approach is predicated on the “one-disease one-gene”
hypothesis, which clearly has limitations, not least for
disorders such as schizophrenia amongst others, where
effective drugs seem to target multiple receptors

23
Observations
• As our knowledge of disease increases, so does our
knowledge of potential off-target effects. This increases the
regulatory burden and limits available chemical space, which
may account for the reduction in NCEs coming into trial
• As the procedure for developing drugs becomes more
industrialized, the place for the “maverick” drug hunter
becomes threatened.
• As a result, some of the more “off the wall” ideas may not be
followed up, which is regrettable as this type of thinking is
often what causes quantum leaps in development

25
Remember why you do it
• “That is a hell of a rewarding feeling when you
have made something that has become a
medicine and people turn round and thank
you for doing it. When you talk about
professional reward, the people aspect is
really something.”
– Robin Ganellin, inventor of Tagamet

26
Thank you for your attention, I hope this mesmerises you enough to prevent
you from asking difficult questions!

27
Recap

• Workflow of drug discovery


• Target, Hit, Lead, Candidate
• Clinical trials
CADD - 2024

Target: Protein

Lecture 3
Outline

• Basic concepts of protein 3D structure


• Concepts dictating protein-ligand interactions
• Introduction to the static and dynamic model
of a protein
Protein

NQQSTYYT RHHRKKR

KEEEEDD

STYYSST
DEEEDKD

KRRR
KHKKRRR

Polar Positively charged Negatively charged


Protein – one dimension
Amino acids
Protein – one dimension to three dimension
Hierarchical Architecture in Proteins
Protein Structure
Primary Secondary Tertiary Quaternary
Structure Structure Structure Structure

Residues Helix Chain Subunits

31
The Surface Conformation of a Protein Determines Its Chemistry
Protein structure availability

• Experimentally resolved structures: Crystal, Cryo-EM, NMR


(https://www.rcsb.org/)

• In case of unavailability…

Sangar, V., Blankenberg, D.J., Altman, N. and Lesk, A.M., 2007.


Quantitative sequence-function relationships in proteins based on gene
ontology. BMC bioinformatics, 8(1), p.294.
Homology modeling: usual approach

More to be taught
in subsequent weeks..
Model Accuracy
Complementarity in protein-ligand interaction

Ligand: protein/substrate/molecule
Complementarity in protein-ligand interaction (Shape)
Complementarity in substrate-enzyme interaction
Docking

Rigid Docking Flexible Docking

• This approximation treats both the • A more common approach is to


ligand and the receptor as rigid model the ligand flexibility while
and explores only six degrees of assuming having a rigid protein
translational and rotational receptor, considering thereby only
freedom. the conformational space of the
• Most of the docking suites employ ligand.
In biology, interactions are dynamic
rigid body docking procedure as a
first step.
• Ideally, however, protein flexibility
should also be taken into account,
• Relatively rigid binding sites (which and some approaches in this
are not significantly altered upon regard have been developed.
ligand binding), are dealt with by • Induced fit docking is used with
rigid protein docking. flexible binding sites
• Computationally inexpensive • Computationally expensive
Atoms never stop jiggling
• In real life, atoms are in constant motion.
– They will not go to an energy minimum and stay there.
• Given enough time, the simulation samples the Boltzmann
distribution
– That is, the probability of observing a particular
arrangement of atoms is a function of the potential energy
– In reality, one often does not simulate long enough to
reach all energetically favorable arrangements
Target: Protein (basics)
Complementarity in substrate-enzyme interaction
Docking

Rigid Docking Flexible Docking

• This approximation treats both the • A more common approach is to


ligand and the receptor as rigid model the ligand flexibility while
and explores only six degrees of assuming having a rigid protein
translational and rotational receptor, considering thereby only
freedom. the conformational space of the
• Most of the docking suites employ ligand.
In biology, interactions are dynamic
rigid body docking procedure as a
first step.
• Ideally, however, protein flexibility
should also be taken into account,
• Relatively rigid binding sites (which and some approaches in this
are not significantly altered upon regard have been developed.
ligand binding), are dealt with by • Induced fit docking is used with
rigid protein docking. flexible binding sites
• Computationally inexpensive • Computationally expensive
Atoms never stop jiggling
• In real life, atoms are in constant motion.
– They will not go to an energy minimum and stay there.
• Given enough time, the simulation samples the Boltzmann
distribution
– That is, the probability of observing a particular
arrangement of atoms is a function of the potential energy
– In reality, one often does not simulate long enough to
reach all energetically favorable arrangements
Capturing the dynamics (MD simulation)

• Simulation of explicit particles (atoms, ions, . . . )


• Particles interact via relatively simple analytical potential functions
• Newton’s equations of motion are integrated for all particles
simultaneously
• 100-1,000,000’s of particles depending on model

Tools:
GROMACS,
AMBER, NAMD
etc.

To be taught in
subsequent weeks!
Solving the equations of motion

MD Simulation: To capture
fluctuations and conformational
changes of proteins and stability
of protein-ligand interaction
Ubond = oscillations about the equilibrium bond length
Uangle = oscillations of 3 atoms about an equilibrium bond angle
Udihedral = torsional rotation of 4 atoms about a central bond
Unonbond = non-bonded energy terms (electrostatics and Lenard-Jones)
ROLE OF ENVIRONMENT
Solving the equations of motion

PDBID: 5XJY

*Unpublished
data
Environment matters!

Starting crystal structure End structure (1000ns)

*Unpublished
data
SEARCHING FOR THE BINDING SITE
The “Door Paradigm”
The “Door Paradigm”

Ray, A., Ghosh, A., Chakraborty, R., Upadhyay, S.K., Maiti, S., Sengupta, S. and Thukral, L., 2018.
Specific cholesterol binding drives drastic structural alterations in Apolipoprotein A1. The journal of
physical chemistry letters, 9(20), pp.6060-6065.
The “Door Paradigm”
The “Door Paradigm”

Accessibility of a site is
critical

Ray, A., Ghosh, A., Chakraborty, R., Upadhyay, S.K., Maiti, S., Sengupta, S. and Thukral, L., 2018.
Specific cholesterol binding drives drastic structural alterations in Apolipoprotein A1. The journal of
physical chemistry letters, 9(20), pp.6060-6065.
AN EXTREME CASE OF PROTEIN-
LIGAND INTERACTION
Hydrophobic interaction

Tool: Quilt

Ray, A., Ghosh, A., Chakraborty, R., Upadhyay, S.K., Maiti, S., Sengupta, S. and Thukral, L., 2018.
Specific cholesterol binding drives drastic structural alterations in Apolipoprotein A1. The journal of
physical chemistry letters, 9(20), pp.6060-6065.
Electrostatics

PDBID: 4UTP Crystal structure of pneumococcal surface antigen PsaA


Electrostatics

Tool: pdb2pqr, apbs


Electrostatics

Negative electrostatic
pockets

Positive electrostatic
pockets
Workflow to consider

Crystal/modeled
MD refinement
structure
(Environment)
(Static)

Stability of the
Protein-Ligand Protein-Ligand
complex (Docking/MD)
(MD refinement)
Recap

• Introduction to three-
dimensional structure
of protein
• Homology modeling
• Molecular dynamics
• Environment effect
• Accessibility of sites
Target: Protein (Continued)
Outline today
• Basic concepts - possibly repetition for some
• Amino acids, proteins
• Basic physical properties of aa & proteins
• Structure of proteins, protein folding
• Elementary interactions in proteins
• Introduction to entropy, phase transitions
8
Protein structure

Sequence->Structure->Function
9
Amino acids

zwitterionic

di erent properties

19 out of 20 are chiral: natural state is L!


10
Amino acids

Di erent
atomic vs molecular representations of
levels arginine amino acid
11
Polymerization

12
Polypeptides

13
Peptide bonds

Peptide bond
rigid & planar
(sp2-hybridization,
electron
delocalized)

Peptide bond
polarity
14
Example Proteins
weight ~110 per amino acid

15
An assembled protein

16
X-ray crystallography

Protein
structure

17
Protein structure
X-ray structure
Took 22 years...

Max Perutz & Hemoglobin


18
Protein structure
RNA Polymerase

Roger Kornberg 2006

21
Why this diversity?

24
Ramachandran diagrams

Natural degrees of freedom for amino acids


(due to steric clashes)
27
Ramachandran species
Glycine more exible
Proline less exible;
even messes up
previous residue!

β
αL

αR

28
Cis/trans isomers

In Proline, both Cis & Trans occur,


and it is important for function!
26
An nsen & Levinthal
• An nsen: Proteins adopt the structure
corresponding to the global minimum in
free energy
• Levinthal: But how can a protein nd
that? Even with just 2 states per amino
acid and 100 residues there are 2^ 100
states! (Levinthal’sParadox)

29
Anfinsen’s Experiment

Addition of Removal of
mercaptoethanol and urea mercaptoethanol and urea

Native, Unfolded; Native,


catalytically catalytically catalytically
active inactive. active state.
ribonuclease A Reduced disulfide Refolded
bonds. correctly!
1/105 random
chance
Folding is encoded in the amino acid sequence.
Native state is the minimum energy state.
Anfinsen, 1973.
Conformational space
• How many conformations are there?
• Sample Φ,Ψ torsion in 10 degree units
• 36 ‘states’ for each torsion
• 36 states per residue
2

• For a 100-residue chain we get:


• (36 ) =36 ≈10 states for the chain
2 100 200 308

• Only one is the native structure


25
Collagen Actin Elastin

Disorder Order
Viral Capsid
All Proteins Bind to Other
Molecules
The ability of a protein to bind selectively and with high affinity to a ligand
depends on

• formation of a set of weak non-covalent bonds—hydrogen bonds, electrostatic


attractions, and van der Waals attractions
• favorable hydrophobic interactions
Ligand: protein/substrate/molecule
The Surface Conformation of a
Protein Determines Its Chemistry
Atg17
R152,K160,R169,
K228,K295,H296
High curvature (170ns)
The surface of each protein molecule therefore has a
unique chemical reactivity that depends not only on
which amino acid side chains are exposed, but also on
their exact orientation relative to one another.
(clustering of neighboring amino acid side chains)
Structure Prediction: Protein

27th January 2020


X-ray crystallography

Protein
structure

17
Protein structure
X-ray structure
Took 22 years...

Max Perutz & Hemoglobin


18
Protein structure
RNA Polymerase

Roger Kornberg 2006

21
https://www.rcsb.org/
Homology: Paralogs and orthologs

duplication

a b Paralogs =
gene families
in same species
speciation

a b a b orthologs

species 1 species 2
Myoglobin Hemoglobin
Protein Structure Classification
Class(C) secondary structure content – mainly alpha, mainly beta,
alpha/beta, few secondary structures (type)

Architecture(A) gross arrangement of sec. structure elements (type and


number of SS elements)

Topology(T) shape and connectivity of SS (type, number and order of


SS elements)

Homologous superfamily (H)

http://www.cathdb.info/latest/index.html
Homologous
domains,
Fold families share
common
ancestor

Class Architecture Topology H-level


Topology
In CATH, the assignments of
structures to fold groups and
homologous superfamilies are
made by sequence and structure
comparisons.

Homologous
domains,
Fold families share
common
ancestor

Class Architecture Topology H-level


Homologous
domain family ?

Architecture: ‘Barrel’

9 Topologies : type of SS, number and order


CELLULAR BIOLOGY AND BIOCHEMISTRY

Protein: The workhorse of biological process


Elastin
• It is a connective tissue protein

• Rubber like properties

• Elastin & glycoprotein microfibrils are present in lungs,


walls of large arteries, elastic ligaments.
• Very long-lived protein, with a half-life of over 78 years in
humans!!!
Disorder

Lysine
Disorder in proteins

target molecule
binding
loops of polypeptide chain Specific folded conformation
Disorder Order
Disorder in proteins
target molecule
binding
loops of polypeptide chain Specific folded conformation
• Low hydrophobicity and relatively high net charge
• 25% of all eukaryotic proteins can adopt structures that are mostly disordered,
fluctuating rapidly between many different conformations
Protein Molecules Often Serve as Subunits
for the Assembly of Large Structures
Viral Capsid
Another example
of viral
capsid
All Proteins Bind to Other
Molecules
The ability of a protein to bind selectively and with high affinity to a ligand
depends on

• formation of a set of weak non-covalent bonds—hydrogen bonds, electrostatic


attractions, and van der Waals attractions
• favorable hydrophobic interactions
Ligand: protein/substrate/molecule
The Surface Conformation of a
Protein Determines Its Chemistry
Atg17
R152,K160,R169,
K228,K295,H296
High curvature (170ns)
The surface of each protein molecule therefore has a
unique chemical reactivity that depends not only on
which amino acid side chains are exposed, but also on
their exact orientation relative to one another.
(clustering of neighboring amino acid side chains)
Protein structure and dynamics
Atoms never stop jiggling
• In real life, and in an MD simulation, atoms are in constant motion.
– They will not go to an energy minimum and stay there.
• Given enough time, the simulation samples the Boltzmann
distribution
– That is, the probability of observing a particular arrangement
of atoms is a function of the potential energy
– In reality, one often does not simulate long enough to reach
all energetically favorable arrangements
Molecular
Dynamics
Simulation
(a brief introduction)
Modeling and Experiment
How nature does it?
How nature does it?
How nature does it?
How nature does it?
How nature does it?
Summary
• Shapes of protein can dictate its function
• Proteins Contain a Surprisingly Large Amount of
Intrinsically Disordered Polypeptide Chain
• Protein Molecules Often Serve as Subunits for the
Assembly of Large Structures
• Many Structures in Cells Are Capable of Self-Assembly
CADD - BIO561
Quiz-1
(15.02.24)
Name :
Roll no. :
Total Marks : 30
Duration : 1h
Part1- Multiple Choice Questions
Total marks - 15*1=15 marks
Each Question is for one mark. No negative marking. Attempt all questions.

1. The science which deals with the drug and their action on human body is called-
a. Pharmacokinetics
b. Pathology
c. Pharmacology
d. Toxicology

2. Which phase of clinical trials focuses on safety, tolerability and bioavailability


properties rather than the efficacy of the drug?
a. Phase 1
b. Phase 2
c. Phase 3
d. Phase 4

3. Which phase of clinical trials involves several thousand patients and compares
the results of the drugs with comparators?
a. Phase 1
b. Phase 2
c. Phase 3
d. Phase 4

4. Homology modeling relies on the assumption that proteins with similar


sequences share?
a. Identical functions
b. Identical secondary structures
c. Identical tertiary structures
d. Homologous domains

5. The "door paradigm" talks about


a. Accessibility of a binding site
b. Chemical Nature of the binding site
c. Identification of a proper binding site, when multiple sites are present
d. All the above
6. What comes after Target Identification?
a. Hit Generation
b. Lead generation
c. Lead Optimization
d. None of the above

7. Aspartate and Glutamate are ______


a. Positively charged basic amino acids
b. Negatively charged acidic amino acids
c. Uncharged amino acids
d. None of the above

8. Which of the following descriptions best describes an induced fit?


a. The process by which an active site alters shape such that it is ready to
accept a substrate.
b. The process by which a substrate adopts the correct binding conformation
before entering an active site.
c. The process by which a substrate binds to an active site and alters
the shape of the active site.
d. The process by which an active site alters the shape of the substrate such
that it can adopt the necessary active conformation for binding.

9. High RMSD means _______ model accuracy


a. High
b. Medium
c. Low
d. Unrelated to Accuracy

10. Of the total number of compounds synthesized, what percentage of compounds


eventually qualify to be called a drug (approved)
a. > 20 %
b. > 10 %
c. > 1 %
d. < 1 %

11. Which of the following doesn’t evaluate the quality of predicted structure:
a. Dope Score
b. GA314 Score
c. RMSD
d. E value
12. Template structure is
a. A model
b. An experimentally deduced structure
c. A hypothetical structure
d. A ML driven hypothesis

13. Quaternary structure involves the arrangement of:


a. Amino acids within a polypeptide chain
b. Multiple polypeptide chains in a protein
c. Secondary structure elements
d. Hydrogen bonds in a protein

14. In which phase of clinical trials are potential drug side effects closely monitored
in a larger patient population?
a. Phase I
b. Phase II
c. Phase III
d. Phase IV

15. Which of the following properties are used for the candidate selection?
a. Potency
b. Selectivity
c. Bioavailability
d. All of these

Part 2- One word type Questions (1 mark each)

1. Give one word answer for the following:


a. The technique used to capture fluctuations and conformational changes
of protein and stability of protein ligand interaction : MD simulation
b. The distance between two non bonded atoms in adjacent molecules is
known as:Van der waals
c. Hydrophobic core regions contain non polar side chains.
d. Primary protein structure is held together by non-covalent interactions
such as peptide bonds, made during transcription, write true or False:
False
e. Give one example of amino acid with disulfide bond : Cysteine

Part 3- Short Answer type Questions (2 marks each) (Answer any 5)


1. Give a basic workflow of homology modeling.

2. What is the difference between rigid and flexible docking, along with the
pros and cons of the two?
Rigid docking: Structures of both the protein and the ligand are kept fixed. It is
computationally
inexpensive . E.g. ZDOCK
Flexible docking: In this method, both the receptor and the ligand are allowed to
undergo
significant conformational changes upon binding, which can increase the
accuracy of the docking predictions. E.g. FlexX , AutoDock

3. Give the relevance of any 2 phases of clinical trials.

Phase 1 :trials generally focus on safety, tolerability and bioavailability properties


rather than efficacy
• The drug is administered to a small number of healthy volunteer trial
participants

Phase 2 clinical trials

• Phase 2 trials are focused on determining the efficacy of the drug in a larger
number of patients (perhaps several hundred) suffering from the condition that
the drug is intended to treat.
• These trials may be performed globally and give information on efficacy and
allow for a further estimation of safety in a larger population.

Phase 3 clinical trials

• Assuming satisfactory results from phase 2 studies, the drug will enter phase 3
clinical trials
• Phase 3 clinical trials are in essence larger versions of the previous trials
intended to answer specific questions with respect to efficacy
• The trials would routinely involve several thousand patients and compare the
i.n.d. with drugs that are currently in use for the treatment of the disease
(“comparators”)
• The results from these trials essentially form the basis of the risk/benefit
analysis that will be submitted to the regulatory authorities

Phase 4 clinical trials

• These trials are often referred to as post-marketing studies and they are
performed after the medicine has been approved
• These give a greater idea of long term risk and benefit and may give indications
as to how use can be modified
• The trials may involve many thousands of patients and go on for many years
• Such trials may assist in indicating other uses for the medicine

4. What is the difference between hit compounds and lead compounds?


In drug discovery, hit compounds and lead compounds are two important stages
in the
process of developing a new drug.
A hit compound is a chemical compound that shows promising biological activity
against a
target of interest, typically identified through high-throughput screening (HTS) of
large libraries
of compounds. They serve as starting points for further optimization and
development into more
potent and selective compounds.
A lead compound, on the other hand, is a hit compound that has been further
optimized through
medicinal chemistry efforts to improve its potency, selectivity, pharmacokinetics,
and other
drug-like properties. Lead compounds are typically more complex and structurally
diverse than
hit compounds, and may undergo multiple rounds of optimization to improve their
properties.

5. Give a diagrammatic representation of Induced fit and lock and key


methods of enzyme interactions.

6. Why is water such a critical solvent? What is so special about it?


a. Higher freezing and boiling point
b. Universal solvent: Water is a universal solvent because of its tendency to
dissolve various polar and ionic compounds.
c. Hydrogen bonding: It has capacity to form hydrogen with one another making
them critical for protein folding and maintaining DNA structure.
d. Temperature Regulation: It can absorb significant amount of heat without much
change in temperature due to its high boiling point.
e. High specific heat

7. What are the ethical issues in the drug discovery process? What are your
views on them?
CADD-2024 (Mid-Semester Exam)
Duration - 1 hour
Total marks - 40

Part 1- Multiple Choice Questions


Total - 15*1=15 marks

Each Question is for one mark. No negative marking. Attempt all questions.

1. Which of the following phenomena results in the partial double-bond character of the peptide
bond?
a. Electronegativity
b. Steric hindrance
c. Resonance
d. Both Electronegativity and Steric Hindrance

2. Which of the following is not an aromatic amino acid?


a. Tryptophan
b. Isoleucine
c. Phenylalanine
d. Tyrosine

3. Which of the following descriptions most accurately describes binding sites and binding regions?
a. a binding site is part of a binding region
b. a binding region is part of a binding site
c. binding region is the same as a binding site
d. a binding region is on a drug whereas a binding site is on a macromolecular target

4. . Which of the following techniques is used to determine the protein structures?


a. X-ray crystallography
b. Kryptonics X-ray vision
c. Magnetic resonance imaging (MRI)
d. None of the above

5. The covalent radius is always ____________than the Vanderwaals radius.


a. More
b. Less
c. Equal
d. Depends on the environment.

6. Peptide bonds observe which of the following characters?


a. single bond
b. triple bond
c. Complete double bond
d. Partial double bond

7. Left handed alpha helix allowed region is present in which of the following quadrants of the
Ramachandran plot?
a. First quadrant
b. Second quadrant
c. Third quadrant
d. Fourth quadrant

8. Which of the following amino acids is least likely to be located in the hydrophilic interior of a
protein?
a. Phenylalanine
b. Serine
c. Histidine
d. Aspartate

9. The ability of a protein to bind selectively and with high affinity to a ligand depends on
a. Formation of Non covalent bonds
b. Formation of covalent bond
c. Formation of favorable hydrophobic interactions
d. More than one

10. Phi and psi angles directly determine


a. Primary structure
b. Secondary structure
c. Tertiary structure
d. quaternary structure

11. A _______________ can enter into clinical trial.


a. Lead
b. Hit
c. Candidate
d. None of the above
12. Compound with good activity and selectivity in screening during drug discovery is known as
a. Hit
b. Lead
c. none
d. Candidate

13. In which amino acid trans form is also found:


a. Lysine
b. Histidine
c. Proline
d. Glutamate

14. Which of the following statements is true?


a. Energy minimisation is carried out using quantum mechanics.
b. Energy minimisation is used to find a stable conformation for a molecule.
c. Energy minimisation is carried out by varying only bond angles and bond lengths.
d. Energy minimisation stops when a structure is formed with much greater stability than the
previous one in the process.

15. A protein sequence grows from


a. N terminal to C terminal
b. C terminal to N terminal
c. Both ends
d. Random in nature

16. Give one word answer for the following:(one mark each)
a. ___Urea________ and _____Beta mercaptoethanol______ are used for unfolding of
proteins in Anfinsen’s experiment.
b. For a protein with 100 amino acids, how many possible sequences are there? (20)^100
c. Name any one type of protein disorder. Loops and folds
d. In the Ramachandran plot, the psi angle measures the torsion angle between______
-CA-C-_____and phi angle measures the torsion angle
between______-N-CA-_____amino acid residues.
e. The mechanism in which binding of a drug to a binding site alters the shape of the
binding site is called ___induced fit________________

Part 2 - Short Answer-type questions


Each Question is for 3 marks. Attempt any five.
Total - 3*5=15 marks

1. What is Anfinsen's dogma, and how does it relate to Levinthal's paradox?\

According to Levinthal's paradox, if a protein were to explore all possible conformations sequentially, it would take an
impossibly long time to fold, even for small proteins.

Anfinsen's dogma helps to solve this paradox by suggesting that the folding process is not random, but rather is
guided by the protein's primary sequence. It says that a protein sequence has the tendency to form a structure that
has the least free energy. This means that the protein will fold into its native conformation in a relatively short amount
of time, bypassing the need to explore all possible conformations. Anfinsen's dogma provides a framework for
understanding how proteins fold into their functional conformations, and it has been supported by numerous
experimental studies

2. Explain the difference between Orthologs and Paralogs with example.


A homologous gene (or homolog) is a gene inherited in two species by a common ancestor. Homology
between protein or DNA sequences is defined in terms of shared ancestry.

Orthologs, or orthologous genes, are genes in different species that originated by vertical descent from a
single gene of the last common ancestor. For instance, the plant Flu regulatory protein is present both in
Arabidopsis (multicellular higher plant) and Chlamydomonas (single cell green algae)

Homologous sequences are paralogous if they were separated by a gene duplication event: if a gene in an
organism is duplicated to occupy two different positions in the same genome, then the two copies are
paralogous. Paralogous genes often belong to the same species, but this is not necessary. For example, the
hemoglobin gene of humans and the myoglobin gene of chimpanzees are paralogs.
3. What factors should be considered when selecting a template for homology modeling using
Modeller?
In the pairwise sequence alignments aided bydatabase search techniques such as FASTA and BLAST one with high
Sequence identity (> 80%), lower E-value ( more significant the sequence),less or no missing residues and
better resolution should be considered.

4. What are the levels of structure organization in proteins?


a. Primary structure denotes the sequence of amino-acids.
b. The secondary structure exhibits local interactions between stretches of a polypeptide chain and
includes α-helix and β-pleated sheet structures.
c. Tertiary -local interactions between stretches of a polypeptide chain and includes α-helix and
β-pleated sheet structures,H-bonds, electrostatic forces, disulphide linkages, and Van Der Waals
forces stabilize this structure.
d. Quaternary - Some of the proteins are composed of two or more polypeptide chains referred to as
sub-units. The spatial arrangement of these subunits with respect to each other is known as
quaternary structure.

5. How does the hydrophobic effect contribute to the stability of folded proteins, and what
role does conformational entropy play in this stability.

6. What do you understand about the Door paradigm?


a. Accessibility of a binding site
b. Chemical Nature of the binding site
c. Identification of a proper binding site, when multiple sites are present

7. How are proteins classified according to CATH classification?


a. Class: The first level of classification is based on the secondary structure composition of proteins.
Proteins are divided into four main classes: alpha, beta, alpha-beta, and few secondary structures.
b. Architecture: The second level of classification is based on the overall shape and arrangement of
secondary structure elements in the protein. E.g. alpha-helical or beta-sheet structure, or a
combination of both.
c. Topology: The third level of classification is based on the connectivity of secondary structure
elements within the protein.
d. Homology: The fourth level of classification is based on sequence similarity and evolutionary
relationships between proteins. Proteins with similar sequences and structures are grouped
together into families and superfamilies based on their evolutionary relationships, even if they have
different functions.

Part 3 - Long Answer-type questions


Each Question is for 5 marks. Attempt any one.
Total - 1*5=5 marks

1. Describe the stages of drug discovery and discuss why drug discovery is such a long and costly
business by giving examples.

Early Stage of Drug discovery


Target Identification: Target (generally proteins, but also nucleic acids, FA, carbohydrates) are
the compounds that interact with the human body through binding to a biological
molecule. This interaction modifies the target such that a change in a pathway is
induced.
Target Validation: In this process, various techniques are applied to see whether the binding of
the drug molecules induces any therapeutic benefit with an acceptable safety
window or not.
Hit identification: Identification of molecules that have an affinity towards the target.
Lead Identification: This phase is to identify those hits that have properties (other than just
activity against the target) that would indicate that they have the potential for being
developed as drugs. Factors that are tested on identified hits are Selectivity versus a panel of
other receptors (targets), Physicochemical characteristics, Drug-like properties, Metabolic
properties (half-life, etc.). The ones that have acceptable potency, physical, and ADME
properties are considered for the lead optimization stage.
Lead optimization stage: The potency and selectivity of selected lead molecules, their
physicochemical properties, and drug-like properties are improved.
Candidate Selection: Optimized lead molecules are scrutinized for their selectivity, safety,
potency, bioavailability, and druggable properties, and successful candidates are then
submitted to the appropriate health authorities to get permission to conduct clinical
investigations.
Preclinical Development: Research begins before clinical trials (testing in humans) and during
which important feasibility, iterative testing, and drug safety data are collected, typically in
laboratory animals.
Clinical Development Phase : It takes place in four phase, initial two phases focus on safety
and efficacy of the drug. In Phase3, clinical trials are carried out on several thousand patients
and compared with drugs that are currently in use for the treatment of the disease
(“comparators”). In phase 4, post-marketing studies are performed after the medicine has been
approved to get an idea about long-term risk and benefit.
Drug discovery is a long and costly business for several reasons:
1.It can take many years and a significant amount of research and development to identify a
viable drug target and to discover and optimize a lead compound. For example, the
development of the cancer drug Imatinib took over a decade and cost billions of dollars.
2.The preclinical and clinical testing required to bring a drug to market is a complex and
expensive process. The cost of clinical trials alone can run into the hundreds of millions of
dollars. For example, the development of the cholesterol-lowering drug Lipitor cost over $800
million in clinical trial expenses alone.
3. The failure rate of drug development is high, with many promising drugs failing to make it past
preclinical testing or clinical trials. This can result in significant financial losses for
pharmaceutical companies. For example, the development of the Alzheimer's drug
Solanezumab cost over $3 billion, but ultimately failed in clinical trials.
Drug discovery is a complex and expensive process that involves many stages of research and
development, including target identification, lead discovery and optimization, preclinical testing,
clinical trials, and regulatory approval. The high costs and long timelines associated with drug
discovery are due to the complexity of the process, the high failure rate of drug development,
and the regulatory requirements for approval.

2. Explain the Ramachandran Plot and describe the significance of a Ramachandran plot in the
context of protein structure analysis. Provide an example of a typical region in a Ramachandran
plot and explain what it represents with a diagram. What amino acids are exceptions to the
Ramachandran plot.

The plot displays the distribution of the backbone dihedral angles phi (ϕ) and psi (ψ) of amino acid residues in a
protein. The phi angle is the angle of right-handed rotation around N-CA bond. The psi angle is the angle of
right-handed rotation around CA-C bond (show in figure below).

These angles describe the orientation of the peptide bond between two adjacent amino acids in the protein
backbone.

The purpose of the Ramachandran plot is to identify the regions of the plot where the backbone dihedral angles of a
protein are located. Regions that correspond to allowed combinations of phi and psi angles are considered favorable
for protein structure, while regions with disallowed combinations are considered unfavorable.

By examining the distribution of the backbone dihedral angles in a protein structure, scientists can evaluate the
overall quality of the structure and identify potential errors in the model.

The phi angle is the angle of right-handed rotation around N-CA bond. The psi angle is the angle of right-handed
rotation around CA-C bond

Ramachandran plot
Plot between Ramchnadran angles phi (horizontal axis) and psi (vertical axis)
White region- Sterically disallowed regions except Glycine ( no side chains)
Red regions- Allowed regions, namely- Alpha Helix and Beta Sheet.
Yellow Areas- Outer limits ( Generously allowed) \

Glycine and Proline are the exceptions.


Small Molecules in
Bioinformatics
Topics
• Introduction

• Small molecule resources


• ChEMBL
• ChEBI

• Searching and browsing

• Hands-on Exercises

11.04.2022 Small molecule resources at the EBI 2


Small molecules participate
in all processes of life
What are Small Molecules?

• A small molecule is defined as a low molecular weight organic


compound.

• Most drugs are small molecules to allow passage over cell


membranes and oral bioavailability.

• They are also able to bind to proteins and enzymes, thereby


altering function, which can lead to a therapeutic effect.
Some
common
small
molecules

Amino acids
Adenosine 5'-triphosphate

Metabolism

Adenosine 5’-triphosphate (ATP): the


"molecular unit of currency" of intracellular
energy transfer.

• generated in the cell by energy-consuming processes, broken down by


energy-releasing processes

• proteins that bind ATP do so in a characteristic protein fold known as the


Rossmann fold, which is a general nucleotide-binding structural domain
that can also bind the cofactor NAD

11.04.2022 Small molecule resources at the EBI 7


Enzymes
• Enzyme inhibitors are molecules that bind to enzymes and
decrease their activity.

• Many drugs are enzyme inhibitors.


They are also used as herbicides clavulanic acid
and pesticides. acts as a suicide
inhibitor of
bacterial β-lactamase
enzymes

• Enzyme activators bind to enzymes and increase their enzymatic


activity.

• Enzyme activators are often involved in the allosteric regulation of


enzymes in the control of metabolism.

11.04.2022 Small molecule resources at the EBI 8


Pathways

http://www.genome.jp/kegg-bin/highlight_pathway?scale=1.0&map=map00231&keyword=tryptophan

11.04.2022 Small molecule resources at the EBI 9


Drug types 2003 - 2009

'Small molecules' in various shades of blue (http://chembl.blogspot.com/)


11.04.2022 Small molecule resources at the EBI 10
Small Molecule Databases

• Small Molecule Databases can be used to:

• Investigate historical compounds and associated bioactivity data.


• To give fresh insight into previously rejected drugs.

• Create Structure-Activity Relationships (SARs)

• Look at how changing a functional group can change the biological activity of a
compound – before you start your own synthesis.

11.04.2022 Small molecule resources at the EBI 11


• Direct synthesis
• Could reduce number of compounds made – if any similar compounds
have significant toxicity or unfavourable binding data, you can save time
by not making analogues.

• Direct end product testing


• Suggest what testing could be carried out – the database can give you an
idea of what testing has given ‘good’ (i.e. clear) results.
• Reduce number of compounds put through High Throughput Screening
(HTS).

11.04.2022 Small molecule resources at the EBI 12


ChEBI and ChEMBL

Small molecule resources at the EBI


What is ChEBI?
• Chemical Entities of Biological Interest
• Freely available
• Focused on ‘small’ chemical entities (no proteins or nucleic
acids)
• Illustrated dictionary of chemical nomenclature
• High quality, manually annotated
• Provides chemical ontology

Access ChEBI at http://www.ebi.ac.uk/chebi/

11.04.2022 Small molecule resources at the EBI 14


ChEBI home page

11.04.2022 Small molecule resources at the EBI 15


ChEBI data overview
Nomenclature Ontology
caffeine metabolite
1,3,7-trimethylxanthine CNS stimulant
methyltheobromine trimethylxanthines

Chemical data Database Xrefs


Formula: C8H10N4O2 MSDchem: CFF
Charge: 0 KEGG DRUG: D00528
Mass: 194.19

Chemical Informatics Visualisation


InChI=1/C8H10N4O2/c1-10-4-9-6-
5(10)7(13)12(3)8(14)11(6)2/h4H,1-3H3
SMILES: CN1C(=O)N(C)c2ncn(C)c2C1=O
ChEBI entry view

11.04.2022 ChEBI – Chemical Entities of Biological Interest 17


Chemical Structures
• Chemical structure may be interactively
explored
using MarvinView applet

• Available in formats
• Image
• Molfile
• InChI and InChIKey
• SMILES

11.04.2022 Small molecule resources at the EBI 18


Automatic Cross-references

11.04.2022 ChEBI – Chemical Entities of Biological Interest 19


What is ChEMBL?
• Database of bioactive, drug-like small molecules.
• Contains 2D structures, calculated properties (logP, mol weight,
Lipinski etc)
• Contains abstracted bioactivity data, e.g. binding data and
IC50, from multiple primary scientific journals
• Covers about 30 years of compound synthesis and testing
• Annotated FDA-approved drugs

Access ChEMBL at https://www.ebi.ac.uk/chembldb/

11.04.2022 Small molecule resources at the EBI 20


ChEMBL Main Search Page

Small molecule resources at the EBI


Clickable structure
Drug
Information

Calc.
properties

11.04.2022 Master headline 22


Small molecule resources at the EBI
Structural
Representations

11.04.2022 Small molecule resources at the EBI 23


11.04.2022 Small molecule resources at the EBI 24
Parent and Salt
Forms

Database links

11.04.2022 Small molecule resources at the EBI 25


ChEBI Link:

11.04.2022 Small molecule resources at the EBI 26


This will take you back to ChEMBL
ChemSpider Links:

The link works


both ways. They
link TO
ChemSpider and
FROM
ChemSpider.

They link on
Standard_Inchi

11.04.2022 Small molecule resources at the EBI 28


Wikipedia Links:
We also have links with
Wikipedia. These also use
the Standard_Inchi as the
common identifier. These
links will link to the
Compound Report Card in
ChEMBL.

The links are added by a


ChemoBot and can be
updated with each
release, if required.

11.04.2022 Small molecule resources at the EBI 29


STRUCTURAL
REPRESENTATION

11.04.2022 Small molecule resources at the EBI 30


Stereoisomers

• Compounds that have same molecular formula and


configuration, but differ in the 3-dimensional orientations.

• The central tetrahedral carbon has 4 different molecular


groups/atoms attached. This is known as the chiral centre.

11.04.2022 Small molecule resources at the EBI 31


Stereoisomerism Example -
Thalidomide
• Caused thousands of deformities in babies across 46 countries
between 1957 and 1961.
• The R isomer is to control morning sickness but the S isomer
was teratogenic.
• Sparked more tightly controlled laboratory practices across the
world.

11.04.2022 Small molecule resources at the EBI 32


Stereoisomers

• Where known, the stereochemistry of the compound is noted in


the structure and in the name.

• If a stereoisomer of an existing compound is submitted, it is


given a separate id number.

• If a mixture of two stereoisomers had data submitted, we will


also give this a separate id number if the activity of the
compounds can not be isolated.

• If you draw a planar compound into the structure search, you


will receive data on all stereoisomers.

11.04.2022 Small molecule resources at the EBI 33


Ofloxacin, Levofloxacin and
Dextrofloxacin
• Fluoroquinolone antibiotics
• Ofloxacin is a racemic (equal) mixture of Levo and Dextro isomers.
• Levofloxacin is the more active stereoisomer
• Dextrofloxacin is the less active stereoisomer

• ChEMBL has data on each with separate bioactivities.

11.04.2022 Small molecule resources at the EBI 34


Tautomers (keto-enol form)

• Two forms readily interconvert via the migration of a hydrogen to


the adjacent oxygen and the swapping of a single to a double
bond, and vice versa.

• ChEMBL does not differentiate between different tautomers.


• The preferred tautomeric structure is retained.
• ChEBI does differentiate and will store the separate tautomers.

11.04.2022 Small molecule resources at the EBI 35


Salts
• About 50% of marketed drugs are combined with salts to aid in
their activity.
• Some salts prevent the drug from being absorbed in the mouth.
• Some salts help the drug be activated in the intestines, rather than the
stomach.

• There are approx 53,450 ChEMBL compounds with salts.

• Bioactivity data is recorded against the parent drug and against


the salt.

• Therefore, it’s important to give these compounds different


ChEMBL ids.

11.04.2022 Small molecule resources at the EBI 36


Salt Example: Morphine
• Morphine can be administered with many different salts:
• Hydrochloride (HCl)
• Sulphate (SO4)
• Tartrate
• Acetate
• Citrate
• Methobromide (MeBr)
• Hydrobromide (HBr)
• Hydroiodide (HI)
• Lactate
• Chloride (Cl)
• Bitartrate

11.04.2022 Small molecule resources at the EBI 37


Dealing with Salts in ChEMBL

• Each compound, if in a salt form, is analysed and matched to a


‘parent’ – i.e. the base form of the compound. (Not inorganic
compounds)
• For example, morphine hydrochloride (CHEMBL556578),
morphine sulfate (CHEMBL422878) and morphine sulfate
hydrate (CHEMBL1200603) are matched to their parent
morphine (CHEMBL70)
• This relationship is shown on the interface of the compound
page.
• Additionally, when you run a search for a compound, you will
only be brought back the parent form in the results grid.

11.04.2022 Small molecule resources at the EBI 38


Parents and Salts on the Compound
Page

PARENT SALTS
(compound report (with hyperlinks beneath)
page)

11.04.2022 Small molecule resources at the EBI 39


• Clicking on the Bioactivity Summary pie chart will give you the
bioactivity data for ALL forms of the compound
• To get salt specific bioactivity data, click on the hyperlink beneath
the salt form of interest to be taken to its compound page.

Morphine - All Data Morphine HCl specific data

11.04.2022 Small molecule resources at the EBI 40


Naming and Classification

Small molecule resources at the EBI


Chemical names
Common or trivial names are those that are highly used.

Advantages of common names include


simplicity,
pronounceability and
universally recognised

The main disadvantage is ambiguity – the same common name may refer to more than
one type of chemical.

Small molecule resources at the EBI


Systematic names
A systematic name is one which corresponds to the chemical structure such that the
structure can be determined from the name, e.g. 1,2-dimethyl-naphthalene

Software packages exist which can generate structures from the systematic names (e.g.
ACD/Name, ChemOffice, MarvinSketch).

More than one correct systematic name can be assigned to the same molecular structure,
depending on the manner in which naming rules are applied.

Small molecule resources at the EBI


Examples of common and systematic
names
Common names Systematic names

1,3,7-trimethyl-3,7-dihydro-1H-
purine-2,6-dione
caffeine
7-methyltheophylline
guaranine
1,3,7-trimethyl-2,6-dioxopurine
theine

Small molecule resources at the EBI


SEARCHING IN CHEBI
Why?

• Ontological data
• Structure classification
• Chemical entity, e.g. hydrocarbon
• Role, e.g. ligand
• Subatomic particle, e.g. electron

• Links to other databases


• Kegg
• DrugBank
• PDBEChem

• Citations
How?
Text-based

Drawing
Molecular structure ontology

11.04.2022 Small molecule resources at the EBI 48


Role ontology

11.04.2022 Small molecule resources at the EBI 49


ChEBI ontology relationships
• Generic ontology relationships

• Chemistry-specific relationships

11.04.2022 ChEBI – Chemical Entities of Biological Interest 50


Viewing ChEBI ontology

11.04.2022 ChEBI – Chemical Entities of Biological Interest 51


Simple and advanced text search

Narrow by
AND, OR category
and BUT
NOT

11.04.2022 Small molecule resources at the EBI 52


Structure search Search options
Structure drawing
tools

11.04.2022 Small molecule resources at the EBI 53


Search Results
Hover-over for
search menu

Click to go to
compound page

11.04.2022 Small molecule resources at the EBI 54


Types of structure search
• Identity – based on InChI
InChI=1/H2O/h1H2

• Substructure – uses fingerprints to narrow search range, then


performs full substructure search algorithm

0010110010 1010110111

• Similarity – based on Tanimoto coefficient calculated between the


fingerprints

Tanimoto(a,b) a 0010110010 = 4 / (4+7-4)


= c / (a+b-c) b 1010110111 = 0.57

11.04.2022 Small molecule resources at the EBI 55


Browse via Periodic Table
Molecular
entities /
Elements

11.04.2022 Small molecule resources at the EBI 56


Navigate via links in ontology

Click to follow links

11.04.2022 Small molecule resources at the EBI 57


CHEMBL WORKED
EXAMPLE
STRUCTURE ACTIVITY
RELATIONSHIPS

Small molecule resources at the EBI


Drug design

• Ligand-based: relies on knowledge of other molecules that bind to the


biological target of interest.

• Structure-based: relies on knowledge of the 3D structure of the biological


target.

• A lead has
• evidence that modulation of the target will have therapeutic value: e.g. disease
linkage studies showing associations between mutations in the biological target
and certain disease states.
• evidence that the target is druggable, i.e. capable of binding to a small molecule
and that its activity can be modulated by the small molecule.

• Target is cloned and expressed, then libraries of potential drug


compounds are screened using screening assays

01.04.2024 Small molecule resources at the EBI 3


Drug Discovery Process Clinical Trials
Target Lead Lead Preclinical Phase 1 Phase 2 Phase 3 Launch
Discovery Discovery Optimisation Development
•Target •Medicinal
identification Chemistry
•High-throughput
•Microarray •Structure-based
Screening (HTS)
profiling drug design
•Fragment-based •Toxicology
•Target •Selectivity
screening Safety
validation screens •In vivo safety Indication
•Focused PK
•Assay •ADMET screens pharmacology Efficacy & Discovery &
libraries tolerabilit
development •Cellular/Animal •Formulation Efficacy expansion
•Screening y
•Biochemistry disease models •Dose prediction
collection
•Clinical/Animal •Pharmacokineti
disease models cs

Discovery Development Use

Med. Chem. SAR Clinical Candidates Drugs

ChEMBL database
> 2,900,000 bioactivities ~12,000 candidates ~2000
> 600,000 compounds drugs
~30,000 distinct lead series

Small molecule resources at the EBI


Compound

N H
N H

Target
O
N N
H N
N
H

Bioactivity
N O
H
O

>Thrombin
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSY
EEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRS
RYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEG
Compound
SSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGD
EEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEAD
CGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVL
TAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLK
KPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVC
KDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY
Ki=4.5
THVFRLKKWIQKVIDQFGE
nM

SAR Data
APTT 11
Assay

min

Small molecule resources at the EBI


Current Data Content (ChEMBL_10)
• Abstracted from 40,623 papers from 27 journals
• Ongoing curation and clean-up of all data

• 785,746 compound records


• 639,570 distinct compound structures

• 8,371 targets
• 5,190 protein molecular targets

• Over 3,200,000 experimental bioactivities


• binding measurements, functional assays and ADMET

Small molecule resources at the EBI


ChEMBL Assay Data

• ChEMBL contains >3 million data points relating compounds


to targets or effects.

• These activities come from ~500K assays reported in


medicinal chemistry literature.
16

• Assays can be classified as:


• functional assay endpoints
e.g., Vasodilation
• binding measurements 55
29
e.g., IC50
• ADME/toxicity data
e.g., LD50

Small molecule resources at the EBI


Functional Binding ADMET
Compound Properties and Selectivity

• Stores a wide range of calculated compound properties (e.g.,


mol wt, logP, RO5 violations)
• Can be used to identify compounds most likely to have good in vivo
properties (Absorption, Distribution, Metabolism, Excretion)

• Contains activity information against liability targets (e.g.,


cytochrome P450s, HERG K+ channel)
• If compounds have been tested in these assays, can avoid those with
potential toxicity issues

• Contains data on a wide range of targets


• If compounds have been tested against multiple targets, can get an
idea of their selectivity (important for validation studies)

01.04.2024 Small molecule resources at the EBI 8


Why Use SARs?
• A chemical structure determines its physical and biological
characteristics.

• Small changes to the structure can have a large impact on activities.

• Understanding what changes have the greatest/least effect can aid in


drug design.

• Using the many available databases that contain this information


reduce time and money spent on synthesis of potential drug
compounds.
Example:
1. You are interested in creating a compound to target IRAK4 and
the compound must have an aniline core structure.

2. Run a search for IRAK4 and download all of the compounds as


an SDFile and all of the IC50 data as a text file.

3. Combine the compounds and data into one SDFile.

4. Analyse the SAR data with an external program.


• There are over 3,000,000 data points in ChEMBL

• Difficult to manually look through them all

• Pipeline Pilot is used in the ChEMBL team to visualise mass amounts


of data.

• SAR grids can be created using downloaded structures and associated


bioactivity data.
Sort the data into ascending IC50
values
Simple SAR
• A compound with an IC50 < 100nM for a target, is considered to be
‘good’.
• Search for IRAK4 and filter for IC50 < 100nM.
• Download the filtered bioactivities as an XLS spreadsheet (26
bioactivities).
• Extract the list of ChEMBL_IDs from the spreadsheet and paste them
into the search box (24 ids).
• Run same search and filter on the bioactivities of IC50 > 100nM (96
bioactivities).
• Download the bioactivity data and extract the list of ChEMBL_IDs (7
ids).
• These 7 compounds are ‘potentially’ selective for IRAK4 and unselective
for any other targets.
Specific to IRAK4
Specific to IRAK4 and Others
Downloads and programmatic access
Downloading ChEBI flavours
• All downloads come in two flavours
• 3 star only entries (manually annotated ChEBI
entries)
• 2 and 3 star entries (manually annotated ChEBI,
ChEMBL and user submissions)

01.04.2024 Small molecule resources at the EBI 20


Downloading ChEBI
• OBO file
• Use on OBO-edit
• SDF File
• Chemistry software compliant such as Bioclipse
• Flat file, tab delimited
• Import all the data into Excel
• Parse it into your own database structure
• Oracle binary dumps
• Import into an oracle database
• Generic SQL insert statements
• Import into MySQL or postgresql database

01.04.2024 Small molecule resources at the EBI 21


The ChEBI web service
• Programmatic access to a ChEBI entry
• SOAP based Java implementation
• Clients currently available in Java and perl
• Methods
• getLiteEntity
• getCompleteEntity and getCompleteEntityByList
• getOntologyParents
• getOntologyChildren and getAllOntologyChildrenInPath
• getStructureSearch

• Documented at http://www.ebi.ac.uk/chebi/webServices.do.

01.04.2024 Small molecule resources at the EBI 22


Downloading ChEMBL

• Frequent releases (approx monthly)


• SDFile
• Text
• MySQL
• Oracle

Small molecule resources at the EBI


Downloading ChEMBL

Small molecule resources at the EBI


Distribution of interatomic distances is converted
into energy functions by inverting Boltzmann’s law.

F P(N,O)
CADD - BIO561
Quiz-2
(04.04.24)
Name :
Roll no. :
Total Marks : 30
Duration : 1h
Part1- Multiple Choice Questions
Total marks - 15*1=15 marks
Each Question is for one mark. No negative marking. Attempt all questions.

1. GOLD uses which of the following docking approach:


a. Matching of descriptors
b. Incremental construction
c. Molecular dynamics
d. Genetic algorithm

2. Which of the following algorithmic approaches did you use for docking using autodock vina?
a. Quantitative
b. Qualitative
c. Hybrid
d. None of the above
3. Which of the following uses stochastic search algorithms:
a. FlexX
b. PRO_LEADS
c. DOCK
d. Hammerhead
4. Which of the following is not available in the CHEBI database for chemical structures:
a. Molfile
b. SMILES
c. PDB
d. InCHL
5. Does ChEMBL differentiate between tautomers?
a. True
b. False
6. Which of the following is more active stereoisomers of Fluoroquinolone antibiotics:
a. Ofloxacin
b. Levofloxacin
c. Dextrofloxacin
d. Both B and C
7. Which of the following is a disadvantage of using autodock vina?
a. It cannot perform flexible docking
b. It cannot dock ligand with covalent bonds
c. It can only dock ligands with upto 20 rotatable bonds
d. It does not account for solvent effects
8. Which of the following does not use force field based scoring functions?
a. Autodock
b. G-score
c. D-score
d. F-score
9. Which of the following can lead to drug receptor interaction
a. Electrostatic interactions
b. Covalent bonds
c. Electrostatic interactions & Van der waals
d. Both a & b
10. Which of the following is NOT a common application of molecular docking?
a. Drug discovery
b. Protein-protein interaction prediction
c. Virtual screening of compound libraries
d. Determining protein secondary structure

11. Knowledge based scoring is associated with:


a. DrugScore
b. LigScore
c. ChemScore
d. X-Score
12. Which of the following step is not involved in receptor file preparation while molecular docking?
a. Removing H2O
b. Adding charges
c. Removing charges
d. Adding hydrogen

Part 2- One word type Questions (1 mark each)

1. Give one word answer for the following:


a. Enzyme activators are often involved in the allosteric regulation of enzymes in the
control of metabolism.
b. Thalidomide is a stereoisomeric drug that becomes teratogenic in its S conformation.
c. Distribution of interatomic distances is converted into energy functions by inverting
Boltzmann’s law.
d. CastP is a web server to locate interior voids and surface pockets of the protein.
e. Name one docking software that uses incremental approach DOCK/FlexX/glide/hammerhead

Part 3- Short Answer type Questions (2 marks each) (Answer any 2)

1. What is the difference between Uniprot and the PDB database?


The Protein Databank (PDB) is essentially for protein 3D structures generated (usually) using X-ray
crystallography and/or NMR spectroscopy. UniProt is a protein sequence and annotation database.

2. Difference between ligand-based and structure-based drug design and why do we use
SARs?
Ligand-based: relies on knowledge of other molecules that bind to the
biological target of interest.
Structure-based: relies on knowledge of the 3D structure of the biological
Target.
Why SARs
A chemical structure determines its physical and biological
Characteristics.
Small changes to the structure can have a large impact on activities.
Understanding what changes have the greatest/least effect can aid in
drug design.
Using the many available databases that contain this information
reduce time and money spent on synthesis of potential drug
Compounds.
3. What are the issues involved in docking? What are the considerations and when are they
applicable?
Protein structure and active site
-Assumed knowledge(PDBs, comparative modeling etc.)
-PROCAT database (3d enzyme active site templates)
Ligand structure
-Pharmacophore(base fragments) in potential drug compounds.
-Well known groups
Rigid vs Flexible
-In solution or in vacuum
-structure fixed, partly fixed, modeling of flexibility.

Part 4- Short Answer type Questions (3 marks each)


1. What are the different kinds of searches in molecular docking, describe each with examples of
programs/softwares using them.

2. How does docking use the “search and score” algorithm? Explain.

3. What are the possible docking scenarios? What would strategy would you take if the binding pocket
is unknown?
CADD - BIO561
Quiz-3
(25.04.24)
Name :
Roll no. :
Total Marks : 30
Duration : 1h
Part1- Multiple Choice Questions
Total marks - 12*1=12 marks
Each Question is for one mark. No negative marking. Attempt all questions.

1. Which is the most effective way for neurological drugs to achieve the desired action?
a. It increases the neurotransmitter synthesis
b. It prevents the neurotransmitter breakdown
c. It produces agonists capable of stimulating post synaptic receptors
d. It can prevent the reuptake of neurotransmitter from the synaptic cleft

2. Computer simulation cannot be used to


a. Stabilize the protein
b. Study protein_ligand interaction
c. Design de novo ligands
d. Get optimal compound faster

3. In which phase of clinical trials an analysis report is shared with the regulatory committee?
a. Phase 1
b. Phase 2
c. Phase 3
d. Phase 4

4. Chemical activity of a protein depends on the:


a. Surface conformation of the protein
b. Exposed Amino acids
c. Orientation of the amino acids with each other
d. More than one

5. Proline is considered as an exception in Ramachandran plot due to following reason:


a. It has rigid structure
b. It is highly flexible
c. It has positive charge
d. It has aromatic ring

6. Which of the following amino acids are involved in electrostatic interactions


i ) Isoleucine ii) Arginine iii) Glutamic acid iv) Tryptophan
a. i and ii
b. ii and iii
c. ii and iv
d. iii and iv
7. You have been given RMSD values of 4 models as 1.13 A, 1.8 A, 0.41 A and 0.89 A. Which of the
mentioned models will you use for your analysis?
a. I
b. II
c. III
d. IV

8. Native state of the protein in terms of energy function is


a. Global minima
b. Transient state
c. Local minima
d. None of the above

9. Which approach would you use to check protein-ligand stability?


a. Docking
b. Modeling
c. MD Refinement
d. Visualization in chimera

10. At which stage of drug discovery extensive experimentation to improve potency and selectivity of
the drug are performed:
a. Hit validation
b. Lead optimisation
c. Candidate selection
d. Clinical trials

11. Which is the most expensive with respect to drug designing


a. Preclinical trials phase
b. Clinical trials phase
c. Post approval phase
d. Hypothesis designing phase

12. In which of the following techniques the atoms are always in motion:
a. Docking
b. MD simulation
c. Modeling
d. Virtual Screening
Part 2- One word type Questions (1 mark each*5 =5)

Give one word answer for the following:


1. Human brain cells have been used to model __microbrain____________ which can be used to
study tumors, instead of drug testing on animal models.
2. Name any two drugs which are effective in humans but toxic for animals. Penicillin ,
paracetamol, aspirin
3. All stereoisomers have Chiral carbon.(True/False)
4. Removal of Mercaptoethanol and Urea from the protein Environment would result in catalytically
__active___________ protein.
5. __Raw score of the alignment/Score______________________ is based on the number and
quality of matching residues during BLAST.

Part 3- Short Answer type Questions (2 marks each) (Answer any 2*2)

1. What are the requirements for an effective Protein-ligand binding?(only 2 major points).0
The ability of a protein to bind selectively and with high affinity to a ligand
depends on

• formation of a set of weak non-covalent bonds—hydrogen bonds, electrostatic


attractions, and van der Waals attractions
• favorable hydrophobic interactions

DOOR paradigm

2. What is DOPE score and how does it evaluate the quality of predicted structure?
DOPE Score (Discrete Optimized Protein Energy)

Evaluates the quality of predicted structure

Calculates the difference in energy of predicted and template structure based on


physical and chemical principles (vdW, Hbonds, side-chain packing, etc.)

Lower DOPE score 🡪 More Similar model and template 🡪 Good quality of model

3. Give one Pro and one con of the “one-disease one-gene” concept in drug
development.
Pros:
Targeted Drug Development
Streamlined Research Process
Personalized Medicine
Accelerated Clinical Trials
Cons:
Limited Scope
Resistance and Relapse
Off-Target Effects
Ethical Considerations

Part 4- Short Answer type Questions (3 marks each*3)


1. Give important characteristics of intrinsically disordered proteins.

2. What are the steps involved in MD simulation of proteins?

You might also like