1
AN ANALYSIS OF WRITING ABILITIES IN DESCRIPTIVE TEXTS
OF THE TENTH GRADE STUDENTS OF MAN 2 BOYOLALI IN THE
ACADEMIC YEAR OF 2016/2017
THESIS
Submitted as A Partial Requirements for degree of Sarjana in
State Islamic Institute of Surakarta
Muhammad Abduh Sunyoto
SRN: 12.32.2.1.193
ENGLISH EDUCATION DEPARTMENT
ISLAMIC EDUCATION AND TEACHER TRAINING FACULTY
THE STATE ISLAMIC INSTITUTE OF SURAKARTA
2017
2
3
4
DEDICATION
This thesis is dedicated for:
1. My beloved Father and Mother (HarjoDimejo and Tukiyem). Who always pray
for me and gives all of their life
2. My beloved brothers and Sister (Sumadi, Sumari, Suratmin, Sumarti)
3. My beloved Big Family
4. My beloved TigaSerangkai, LPM PANDAWA, KSR PMI unit IAIN
SURAKARTA and all of my organization.
5. My beloved Fantastic Class
6. All of my friends
5
MOTTO
Pray because Allah always listen
~Anonymous~
Hope is a Waking Dream
~Aristoteles~
6
7
ACKNOWLEDGMENT
Alhamdulillah, all praises be to Allah, the single power, the Lord of the
universe, master of the Day of Judgment, God all mighty, for all blessings and
mercies so the researcher was able to finish this thesis entitled“An Analysis of
Writing Abilities in Descriptive Text of the Tenth Grade Students of MAN 2
Boyolali in the Academic Year 2016/2017”. Peace be upon Prophet Muhammad
SAW, the great leader and good inspiration of world revolution. The researcher is
sure that this thesis would not be completed without the helps, supports, and
suggestions from several sides. Thus the researcher would like to express her
deepest thanks to all of those who had helped, supported, and suggested her
during the process of writing this thesis. This goes to:
1. Dr. Mudofir, S.Ag. M.Pdas the Head of the State Islamic Institute of Surakarta.
2. Dr. H. Giyoto, M.Hum as the Dean of Islamic Education and Teacher
Training Faculty.
3. Dr. ImroatusSolikhah, M.Pd as the Head of English Education Study Program
4. M. ZainalMuttaqien the advisor.Thanks for guidance, precious advices and
correction for the researcher.
5. Drs.H. MahsunAlwa‟id, M.Ag.as the headmaster of MAN 2 Boyolali. Thanks
for giving permission to do this research.
6. RinningS.Pd.I as the English teacher of MAN 2 Boyolali. Thanks for helping
the researcher to do this research.
7. All of the students of XIPS2MAN 2 Boyolali as the subject of the research.
8. The researcher‟s beloved mother, father, and family who always pray for the
best support and give motivation.
8
9. The researcher‟s brothers, sister and big family who always support.
10. Fantastic Class of English Education Study Program 2012, especially for
ali, dafit, wahyudi, fadrul, tri, mul, ifur, sam, masud, ikhsan, faris, mutma,
naimah, andri, nur, novita, putri, nopita,nita, mila, nina, nanik, meida, duo
mifta, for the togetherness and cheerfulness.
11. Tiga Serangkai especially for Samsul Arifin and Elyta Novi Viandani.
12. Muhajirin gank especially for Muhammad Wildan A, S.Pd, Ikhsan Amirudin,
S.Pd, Saiful Bakri, S.Pd, Fauzan Karim, S.Pd, Muhamat Ali, S.Pd,
Muhammad Wahyudi, S.Pd, Faris Isnawan, S.Pd, Syeh Adam, S.Pd, Hendro
Sayekti, S.Pd, Muhammad Nur Ikhsan, Syaiful, esc.
The researcher realizes that this thesis is still far from being perfect. She hopes
that this thesis is useful for the researcher in particular and readers in general.
Surakarta,14th February 2017
The researcher,
Muhammad Abduh Sunyoto
NIM. 123221193
9
TABLE OF CONTENTS
TITLE ........................................................................................................... i
ADVISOR SHEET ....................................................................................... ii
RATIFICATION .......................................................................................... iii
DEDICATION .............................................................................................. iv
MOTTO ........................................................................................................ v
PRONOUNCMENT ..................................................................................... vi
ACKNOWLEDGEMENT ........................................................................... vii
TABLE OF CONTENT ............................................................................... ix
ABSTRACT .................................................................................................. xii
CHAPTER I INTRODUCTION
A. Background of Study ................................................................................. 1
B. The Problem Statement ............................................................................. 4
C. The Objective of the Study ........................................................................ 4
D. Limited of the Study .................................................................................. 4
E. The Benefit of the Study ........................................................................... 4
F. Previous Study........................................................................................... 5
G. Definition of Key Terms ........................................................................... 6
CHAPTER II THEORETICAL REVIEW
A. The Nature of Writing
1. The Definition of Writing ..................................................................... 7
2. Micro- And Macro skills of Writing..................................................... 8
3. Aspect of Writing ................................................................................. 10
4. The Purpose of Writing ........................................................................ 17
10
5. The Reason of Teaching Writing .......................................................... 23
6. Teaching Writing .................................................................................. 24
7. The Writing Process ............................................................................. 26
8. Problem in Writing ............................................................................... 28
9. Criteria for Good Writing ..................................................................... 29
10. The Scoring Writing ............................................................................. 30
B. Review on Descriptive text
1. The Meaning of Descriptive Text ......................................................... 33
2. The Parts of Descriptive ....................................................................... 33
3. The Social Function of Description Text ............................................. 34
4. The Parts of Descriptive Text ............................................................... 34
5. The Example of Descriptive Text ......................................................... 35
CHAPTER III RESEARCH METHODOLOGY
A. Research Design ........................................................................................ 37
B. Setting of the Research .............................................................................. 38
C. Subject and Information of the Research .................................................. 38
D. Instrument .................................................................................................. 39
E. Technique of Collecting Data.................................................................... 39
F. The Technique of Analyzing Data ............................................................ 41
G. The Trustworthiness of Data ..................................................................... 43
CHAPTER IV FINDING AND DISCUSSION
A. Research Finding ....................................................................................... 45
B. Discussion ................................................................................................. 70
CHAPTER V CONCLUSIONS AND SUGESTION
11
A. Conclusions ............................................................................................... 75
B. Suggestions ................................................................................................ 76
BIBLIOGRAPHY ........................................................................................ 78
APPENDICES .............................................................................................. 81
12
ABSTRACT
Muhammad AbduhSunyoto. 2017. An Analysis of Writing Abilities in
Descriptive Text of the Tenth Grade Students of MAN 2 Boyolali in the
Academic Year 2016/2017. Thesis, The English Department Islamic Education
and Teacher Training Faculty The State Islamic Institute of Surakarta.
Advisor : M. ZainalMuttaqien, S.S, M. Hum
The Key Word : Students‟, Writing Ability, Descriptive Text, Analysis
The Objectives of this research are (1) To the students‟ writing abilities
in Descriptive Text, (2) To difficulties student‟s in composing Descriptive
text in MAN 2 Boyolali. Therefore the researcher formulated the problem
statement: How are the students‟abilities of writing descriptive texts at tenth
grade of MAN 2 Boyolaliand What are difficulties the students find in writing
descriptive texts at Tenth grade of MAN 2 Boyolali.
This research was conducted in the First Grade students‟ worksheet of
MAN 2 Boyolali. It was descriptive qualitative research. The subjects of this
research were the students worksheet of the Intensive class (XIPS2 Class) of
the first Grade students in MAN 2Boyolali. XIPS2 Class consist 27 students.
The data was collected from the documentation (Students‟ worksheet),
interview, and observation. The data were analyzed by reducing the data,
presenting the data, analyzing the data by using Hughes‟s theory and taking
the conclusion and verification. This research used methodological
triangulation which compared from the result of documentation (Students‟
worksheet), interview, and observation in order to get the valid data.
The findings of the study showed that, first the students writing ability
in Descriptive text was categorized 15 students or (65%) was categorized as
excellent, 8 students (35%) were categorized as good, there was no students
were categorized as fair, poor and failed. The second, there were some
difficulties faced by the students in writing Descriptive text, are: 1) The
students difficult in arranging the sentences 2) The students lack of vocabulary
3) The students do not master grammar well.
13
CHAPTER 1
INTRODUCTION
A. Background of Study
Language is very important as a tool of communication with other
people to share the human moods. Fauziati (2009) says that language is
very critical to human lives and its main function is for communication.
We know that without language, people cannot interact with the other.
People can share their experiences, their feelings, and their needs to each
other by speaking and writing using language. There are many languages
in this world. Almost every country and every city have a different
language. One of the languages in the world is English.
English as one of languages is very important in the world, because
it has become an international language. Harmer (1998:24) states most
adults can learn a language without studying it, providing they are in the
right kind of contact with it. They may have more trouble with
pronunciation and grammar than younger learner. However, they may still
be able to communicate fluently. It means that English is an international
language which is not only students or younger peoplewant to learn it, but
also the adults. Today, English is very important and every kind of jobs
needs someone who masters it. English is certainly important for all people
to learn. All of people in this world and also Indonesian people have to
learn it because we know that almost all of the book, of science,
knowledge, and international business are in English. Therefore,
14
Indonesian people must master English to improve the quality of education
and the quality of progression of Indonesian itself.
Globalization era has made English be taught at school. The
Indonesian Government curriculum has informed that all schools in
Indonesian have to teach English. Indonesia is a developing country which
uses English as foreign language, but not all of citizen can speak English,
although English has already beenstudied by Indonesian people from
kindergartens until university. According to Cohen (1998:4) “foreign
language is the language being learned, not spoken in the local
community”. In addition, English has to be mastered by students and it
causes government of Indonesia to make English not only as lesson which
must be learnt by students of Indonesia, but also as one of subjects in
National Examination in Indonesia.
In practicing English there are four skills which must be mastered
by the students. Brown (in Al-Khasawneh: 2008) states that languages
consist of main four skills: reading, listening, writing, and speaking.
Learners should be exposed to the all the mentioned skills to successfully
master English. Writing is placed in the last among the four skills. The
stage of the skill shows that students have to be familiar with the first three
skills. Writing is the production of the written word in the form of text and
it must be read and comprehended in order to communicate (Murcia,2001:
142). Writing is an important skill for the learners to enter science and
technology. So, students will get so many difficulties when they do not
master English well. The main problem of Indonesian students in learning
15
writing is that they have little chance to practice writing English.
Therefore, they still think that writing is not more important than the other
skills. Some years ago, it might be true. But now, when the international
language is being the key to enter science and technology, writing is very
important to be learned by the English learners.
As Harmer (2001: 79) states that “By far, the most important
reason for teaching writing, it is a basic language skill, as important as
speaking, listening, and reading students need to know how to write letters,
how to put written repost together, how to replay to advertisements and
increasingly, how to write using electronic media. They need to know
some of special writing conventions (punctuation, paragraph construction,
etc). Just ask they need to know how to pronounce, spoken English
appropriately. Part of our job is to given that skill.”
Writing is considered by language learners as the most difficult
skill science it that requires a lot of lexical a syntactic knowledge as well
as principles of organization. The difficulty is not only due to the need to
generate and organize ideas using an appropriate choice of vocabulary,
sentence, and paragraph organization but also the necessity to turn such
ideas into a readable text (Barli, 1995: 76). There are some reasons why
writing skill is considered difficult for most students. One of them lies in
Indonesian culture, which traditionally uses a lot of spoken language so
that writing is not a way of expressing oneself. Furthermore, the task of
writing will become more difficult when they have to write in foreign
language, like English.
16
The methods are used by teacher to manage the class also play an
important role to the product of teaching and learning activities. Based on
the observation, the English teacher still used teacher-centered approach
instead of student-centered approach. The teaching and learning activities
are still dominated by the teacher. So, the students usually just copy their
friend‟s answer. The students do not have any intention to do the writing
task, because the students think that writing English is very difficult. It
means that the students‟ motivation in learning English especially in
writing skill is low.
The purpose of teaching English for SMA/MA in IPA/IPS class
students is to develop communicative competence or spoken and written
form to achieve the literacy level which can be realized through four
language skills listening, speaking, reading, and writing (Depdikbud,
2006:367). In writing skill for students the tenth grade High School for the
first semester are given genre text such as only descriptive text. Based on
the research in the tenth grade students of MAN 2 Boyolali, one kind of
writing texts which is still difficult to be mastered by students is
descriptive text. The students thought that to write a descriptive text is still
difficult. The problems experienced by most students in creating
appropriate writing text have encouraged the researcher to conduct this
research.
The research was interested to analyze the worksheets of the
students in composing Descriptive Text at MAN 2 Boyolali. Therefore, the
researcher intends to conduct research entitled “An Analysis of Writing
17
Ability in Descriptive Texts of the Tenth Grade Students of MAN 2
Boyolali in the Academic Year of 2016/2017. The researcher would check
the students‟ worksheets in writing descriptive text of the tenth grade of
MAN 2 Boyolali.
B. The Problem Statement
In this study, the researcher only focuses on certain problems. The
problem can be formulated as follows:
1. How are the students‟abilities of writing descriptive texts at tenth grade
of MAN 2 Boyolali in the academic year of 2016/2017?
2. What are difficulties the students find in writing descriptive texts at
Tenth grade of MAN 2 Boyolaliin the academic year of 2016/2017?
C. The Objective of the Study
After deciding the research problem, the research states the
objective of the research as mentioned bellow:
1. To know the student‟s abilities in writing descriptive texts at Tenth
grade of MAN 2 Boyolali in the academic year of 2016/2017.
2. To know difficulties did student‟s find in writingdescriptive texts at
Tenth class of MAN 2 Boyolali in the academic year of 2016/2017.
D. Limited of the study
It is nearly impossible for the researcher to study all the problems,
in the limited time and limited chance. Therefore the is study or research
18
will be limited, as follows: (1) students the object of the study is limited to
only students writing ability skills and difficulties in descriptive texts; (2)
the subject of the study is limited to the first year students of MAN 2
Boyolali.
E. The Benefit of the Study
The results of this research are expected to give significant
contribution to the following people:
1. For Students
By this research the studentsare expected to beable to make
good paragraphs especially on descriptive.
2. For English Teacher
The result of this research hopefully can provide the
information to the teacher, on students‟ abilities in writing
descriptive texts.
3. In Language Research
The procedures and outcomes of the research hopefully can
inspire other researcher to do research concerned with similar
themes.
F. Previous study
There are some previous studies thatis related to this research. The
first research was done byEdyWijanarkoentitled“Descriptive Analysis of
Error on Writing Descriptive Text Based on Surface Strategy Taxonomy
19
made by the tenth grade studies of MAN 1 Boyolali in academic year
2016”. Inthis research, based on the background, commonly the tenth
grade students of MAN 1 Boyolali had low scores in writing ability. The
students had difficulties in writing such as in creating ideas, translating
from Indonesian to English, using grammar, memorizing vocabulary and
making coherence paragraphs.
The study above has differences and similaritywith the writer‟s.
The differences are on the place, population, and sample, technique of
collecting data, technique (method) of study, and research design. The
similarity with the writer‟s study is on the use of descriptive textsas
material.
G. Definition of Key Terms
In this case, there are some key terms related to the research.
1. Writing Skill
Writing is basically a matter of arrangement, of fitting sentences
and paragraph into prescribed patterns (Kroll, 1993: 14)
Meanwhile, according to Hornby (1995: 1109) skill is the ability to
do something well. To conclude, writing skill is the ability to arrange and
fit sentences and paragraph into prescribed pattern.
2. Analysis
According to Hornby (1995:38) analysis is the study of something
by examining its parts and their relationship, a statement of the result.
3. Descriptive Text
20
Oshima and Hogue (1977:50) state that descriptive text tells how
something looks, fells, smells, testes and/ or sounds. A good description is
like a “word picture” the reader can imagine the object, place or person in
his or her mind.
21
CHAPTER II
THEORETICAL REVIEW
This chapter presents the theoretical review which is related to
writing. Therefore, this chapter consists of definition of writing, micro-and
macros skills of writing, the purpose of writing, the reason of teaching
writing teaching writing, the writing process, problem in writing, criteria
for good writing, the scoring of writing, the meaning of descriptive text,
the parts of descriptive text, the social function of descriptive text,
example of descriptive text.
A. The Nature of Writing
1. The Definiton of Writing
Writing is one of important skills that language leaners need to
learn as an essential component not only for their academic practice but
also in their professional life. Writing is an activity to produce
something in written form so that people can read, perform or use it
(Oxford Advanced learner’s Pocket Dictionary, 2008: 516).
Writing can be defined in various ways. There are some definitions
of writing proposed by experts. According to Brookes and Grundy
(2000:1) “writing language was though by some to be spoken language
put into written form. Futhermore, the assumption that writing is
putting the spoken language into writing form is only the true for
activies like taking down dictation or transcribing a tape.
Ghaith in Nur Rahma (2008:12), states that writing is an
intellectual activity in appropriate formats for the rhetorical presentation
22
of ideas as well as mastery in all areas of language. While Sari
(2007:63) says that writing is a complex process in which the authors
can reveal all in their mind to be something real. In addition, Oshima
and Hogue (1997:2) state writing as a progressive activity. This means
that when the author first writes something down, he have already been
thinking about what you are going to say and how you are going to say
it.
The next definiton is given by Harris (1993:10). He says that
writing is a process that occurs over a period of time, particularly if we
take into account the sometimes extended periods of thinking that
precede creating and an initial draft. While Clay in Browne (2001: 89)
states that writing is a way of communicating which employs regular
features and forms including letter shapes, print direction, consistent
spelling and punctuation marks.
From these statements, the conclusion is that writing is a process of
transferring idea, meaning, feeling, expression and imagination in
written language by using correct features includes grammatical,
punctuation, and meaning. Talking about writing skill will be much
related to developing of the ideas and writing down carefully.
2. Micro- And Macro skills of Writing
According to Brown, H.. Douglas (2004:220) the turn once again to
a taxonomy of micro- and macroskills that assist in defining the
ultimate criterion of an assessment procedure. The earlier microskills
apply more appropriately to imitative and intensive types of writing
23
tasks, while the macroskills are essential for the successful mastery of
responsive and extensive writing.
The Micro skills if writing are:
a. Produce graphemes and orthographic patterns of english.
b. Produce writing at an efficient rate of speed to suit the purpose.
c. Produce an acceptable core of words and use appropriate word order
patterns.
d. Use acceptable grammatical system (e.g. tense, agreement,
pluralization), patterns, and rules.
e. Express a particular meaning in different grammatical forms.
f. Use cohesive devices in written discourse.
The Macro skills if writing are:
a. Use the rhetorical form and conventions of written discourse.
b. Appropriately accomplish the communicative functions of written
texts according to form and purpose.
c. Convey links and connections between events, and communicate
such relations as main idea, supporting idea, new information, given
information, generalization, and exemplification.
d. Distinguish between literal and implied meanings when writing.
e. Correctly convey culturally specific references in the context on the
written text.
f. Develop and use a battery of writing strategies, such as accurately
assessing the audience‟s interpretation, using prewriting devices,
writing with fluency in the first drafts, using paraphrases and
24
synonyms, soliciting peer and instructor feedback, and using
feedback for revising and editing.
3. Aspect of Writing
In order to produce a good writing the writer needs to consider
some aspects of writing. Those aspects of writing are content,
organization, grammar, vocabulary, and mechanic:
a. Content
Content is one of the important aspects in writing that should
be noticed by students when they are writing. content in writing
deals with the ability to give clear information related to the topic of
writing. Furthermore, it belongs to the important aspect in writing
because it also refers to the clarity of the paragraph. Brannan (2003:
46) states that clarity is a crucial component in writing as it includes
an explanation about examples, reasons and word choice. To have a
good content in writing, writer need to write clearly by completing
their explanation with the additional information to make the readers
more understand to the idea of writers. For example, if the writers
want to write about herbivores, they need to give the example of the
animal that include to herbivores, explain the reason why the animal
mentioned belong to herbivores‟ category and pay attention to word
choice. To conclude, the content of this reserch refered to the
students‟ writing ability in composing descriptive text which was
relevant to assigned topic. The students were required to write a
descriptive text with a good content in which all sentences of a text
25
relate to the topic, decribe the topic, and tell about their experiences.
Moreover, they had to write a good content of descriptive text by
giving clear information and explanation of their experiences
relating to the topic that chose by students.
b. Organization
Organization skill refers to the ability to organize the ideas
in logical sequence paragraph (Hartfield et al, 1983: 74). The
sentences in the paragraph should be organized in logical sequence
to make united contribution to whole paragraph. According to Kanar
(1998: 74), a well-organized paragraph should have unity and
coherence. In addition, Oshima and Hongue (1991: 17) state that a
good paragraph also has the elements of unity and coherence.
1) Unity
Unity is an important element of a good paragraph has unity,
which means that in each paragraph, only one main idea is
discusssed. If you start to discuss a new idea, begin a new
paragraph, (Oshima et al, 1981: 18). The unity is synonymous
with oneness. It means oneness to express the ideas in one
paragraph. All sentences in a paragraph should state on the one
thing in the topic sentence. All of the sentences stick together.
2) Coherence
Another requirement of well-organized paragraph is coherence.
Oshima et al, (1981: 77) says that “the sentences must hold
together; that is the movement from one sentence to the next must
26
be logical and smooth. There must be no sudden jumps. Each
sentence should flow smoothly into the the next.” While Harmer
(2004: 24) states “coherence is elements of text that the phrases
and sentences relate to each other”. In developing a coherence
paragraph, a writer should know some writing skills. According
to Wong (1999: 369), “coherence means that ideas and sentences
flow together smoothly in a logical, organized manner”. In
addition, Wong also says developing coherence in the body of
paragraph requires the following writing skills:
a. Knowing how to organized information chronologically,
spatially, and in order of importance frequency.
b. Knowing how to use sentence variety and how to combine
sentences.
c. Knowing how to connect ideas and sentences by transition
words.
To conclude, the organization of writing descriptive text in
this research meant that the students need to write a descriptive text
in good organization. Their writing had to consist of complete
generic structure of descriptive text.
c. Grammar
Grammar refers to the patterns or rules which are used to
construct the sentences in English correctly and aceptably.
Thornbury (1991: 1) states that grammar is the study of the forms or
structure which are used in language. In addition, he adds that
27
grammar is the rules which is used as a guidance to form the
language sentences. Harmers (2004: 31) says that when the students
write, they need to focus on the accurate language use. This means
that students cannot ignore using the correct grammar in their
writing. After all, students have to be able to write grammatically
correct in order to produce meaningful sentences. In this research,
the students need to correct the sentences by using Simple Past
Tense. Generally Simple Past Tense indicates an actions that
happens in the past. It is also events or actions in different situations.
Pardiyono (2001: 59-60) explains that the functions of Simple Past
Tense are follows:
1) Describing an activity happened at a specific time in the past.
Example: Rina went to Baron Beach with her family last week.
2) Expresing the past incident or the past even.
Example: David won the competition and he got a special prize.
3) Describing a situation or a condition happened in the past.
Example: it rained very hard last night, so I did not come to my
friend‟s birthday party.
Afterwards, students also need to know the patterns of
Simple Past Tense. The purpose is to guide them in arranging the
words into a good sentence. The following explanations are patterns
used to construct sentences in the form of Simple Past Tense.
28
1) Pattern of Simple Past Tense with the main verb.
Example:
a. Steffy bought a pair of shoes yesterday.
b. Steffy did not buy a pair of shoes yesterday.
c. Did Steffy buy a pair of shoes yesterday?
2) Patterns of Simple Past Tense with the verb “be”.
Example:
a. Hiro was a singer 3 years ago.
b. Hiro was not a singer 3 years ago.
c. Was Hiro a singer 3 years ago.
d. Vocabulary
In writing, vocabulary deals with the choice of words.
Langan (2008: 439) states that the writer should choose the word
carefully in writing. This statement describes that students need to
pay attention on the words they use when they are writing because
each word may represent a different meaning. For example, the use
of words listen and hear in a sentence is different although both of
them are the same verbs that involve sense of hearing. It can be
illustrated in the following senetence, but the “present verb” it
change into “past verb”. It helps the learner understand the different
meaning of those words in the form of sentence.
1. Diana listened to the music on her iPod last night.
2. Diana suddenly heard a loud sound of music.
29
The first sentence show that the word listened indicates an activity
done intentionally. The use of word listened in the one hand means that
people consciously pay attention and try to understand the music. On the
other hand, the word heard indicates an activity done unintentionally. The
second sentences shows that Diana does not intend to hear that sound.
Further, it will be inappropriate if writers use the word heard in the first
sentence, because it causes an incorrect meaning. For that reason, students
need to use the appropriate vocabulary in order that meaning of words in
any sentences can be understood.
Considering that vocabulary refers to a set of words, Kennedy
(2003: 59) clarifies words into eight different words that are familiar for
most people. Those words are as follows:
1. Nouns : table, chair, pencil, bag
2. Verbs : work, sleep, swim, study
3. Determiners : this, that, the, any
4. Preppositions : in, on, at, between
5. Adjectives : beautiful, sweet, bad, warm
6. Pronouns : it, they, you, us
7. Conjuctions : and, but, because, or
8. Adverbs : carefully, happily, yesterday, soon
To summarize, this research only focused on the use of nouns,
verbs, adverbs, and, adjectives, pronouns and conjuctions appropriately in
the sentences written by students since the language features of descriptive
text covers those words.
30
e. Mechanic
Mechanic in this research refers to the correct use of
punctuation, spelling and capitalization enable the reader to
recognize what the writer intends (Bramer and Sedley, 1981: 539).
There are many punctuation commonly used by the writers. Swick
(2010: 127) identifies the punctuation marks in writing including:
period (.), question mark (?), exlamation point (!), comma (,), colon
(:), semi colon (;), parentheses (()), brackets ([]), apostrophe („),
hyphen (-), dash (_), double quotation marks (“ ”), and single
quotation marks („ „). This research only focused on the use of some
of the punctuations such as period or full stop (.), comma (,),
quotation mark (“..”), apostrophe („) and exlamation point (!).
because they are the most common punctuation used in the
descriptive text.
Spelling refers to the ability to write words into correct
letter. Every writer must write the words in the correct spelling to
avoid having miss understanding of the message that is conveyed in
writing. In summary the students have to write the words in correct
spelling and put correct punctuation to avoid misunderstanding of
the message which is conveyed in their writing.
Another mechanic element in writing is capitalization. It
deals with an act to write with a capital letter. Bailey (2003: 117)
notes that writing by using capital letters include the first word of a
sentence, titles, names of organization, days, months, nationality
31
words and names of people or places. Besides according to Smith
(2009: 15), another word should be preceded with a capital letter are
pronoun I, names of holidays, names of cities, buildings, institutions,
trains, ships, and others modes of transportation. Therefore, when
students need to write those words, they must begin with a capital
letter.
4. The Purpose of Writing
Writing takes an important part in language learning process.
According to Richards (1997: 100), writing is used both as a means of
learning and as an evidence of successful learning. Meanwhile, Tribble
(1996: 4) said that writing is used to help learners focus on accuracy, to
consolidate the new language being learned into learners‟ selves, and to
develop literacy skill.
Another opinion about the purposes of teaching writing comes
from Harmer (1998: 79) he said that writing is taught for these
following purposes;
a. reinforcement: writing is used as an aid to committing the new
language to memory.
b. language development: writing is a part of on going to learning
experience.
c. learning style: writing helps learners to produce language in slow
way.
32
d. writing, as a skill, writing is a basic language skill that should be
tought in order that leaners know how to put written reports together,
how to replay to advertisement, etc.
From these notions of the purposes of teaching writing, it can be
concluded that writing is taught as a means of reinforcement and
literacy skill development, as an aid to develop language, and as a
language skill it self.
The teacher need to make sure that students have some writing to
aim.. Efective writers usually have a purpose in mind and construct
their writing with a view to achieving that purpose.
The use of written language is aimed to convey information
accurately, effectively and appropriately (Richards, 1997: 101). A more
specific explanation about the purposes of written language is proposed
by McMahan et al (1996: 8). According to him writen language is used
for these following purposes:
a. to express the writer‟s feelings.
b. to entertain the readers through aesthetical materials.
c. to inform or explain or explain something to the readers
d. to persuade the readers about the writer‟s opinions, concepts, ideas.
The most effective learning of writing skills is likely to take place
when students are writing to real audiences, or at least when they are
performing tasks which they are likely to have to do in their out-of-class
life. The choice of writing tasks will depend, therefore, on why students
33
are studying English. There are three main categories of learning which
it is worth considering:
d. English as a Second Language (ESL)
This term is normally used to describe students who are
living in the target language community and who need English to
function in that community on a day-to-day basis. Recent
immigrants and refugees, for example, will have specific writing
needs such as the ability to fill in a range of forms, or write
particular kinds of letters (depending upon their exact needs and
circumstances), alongside the need for general English
development
e. English for Specific Purpose (ESP)
Many students study English for a prticular (or specific)
purpose. People who are going to works as nurses in Britain or the
USA, for example, will study medical English. Those who are
going to study at an English-medium university need to
concentrate on the language of management and commerce, and so
on.
The choice of topics and tasks for such students should not
only develop their general language competence but also be
relevants to their reason for study. For example, writing tasks for
business students can have high face validaty if the students can
see that they will be writing in their professional life. Likewise
nurses in training, when asked to write up a simulated patient
34
record in their English class, will clearly see the value of such a
task.
f. English as a Foreign Language (EFL)
This is generally taken to the students who are studying
general English at schools and institutes in their own country or as
transitory visitors in a target-language country. Their needs are
often not nearly so easy to pin down as the two categories we have
mentioned above.
While it is perfectly possible to ask school students what
their needs are or will be, it is unlikely that it will be easy to make
a list of any but the most general aims. In the case of adult
students, it is often hard to find writing task that are directly
relevant to the varying needs of a class full of students from
differnt backgrounds and occupations. Nevertheless, it may well be
possible to arrive at a set of task that is a useful compromise
between the competing claims of the individuals in a class.
Brookes & Grundy (1991: 3) state that the purposes of writing for
each person are different. The answer may be to get information to
someone. A second answer might be to solve the problem of volume, of
having to store more than the human brain can remember. The third
reason for writing might be to filter and shape our experience. So, based
on this statement, someone in writing activities has a purpose to get
their experience in the real world, from their imagination, to give
information, to solve the problem etc.
35
The purpose of writing has some thing to do with the goals or aims
of writing. Thinking about the purpose of writing, a writer should think
to motivate people to write. There are four purpose of writing namely:
a. to express ideas
A witer expresses his feeling, espressions, personality,
likes, and disllikes in his writing in order to make readers
understand something within the materials.
b. to provide information
It means to give information and explain it. This purpose is
to focus an the materials being discussed.
c. to persuade readers
It means to convice readers about a matter of an opinion.
This also focuses on the readers‟ point of view.
d. to create literary work
It means that a work which is based on one‟s point of view
(opinion, attitude, and observation) of other matters occurring in
one‟s environment.
When the receiver of the communication does not physically
presents, writing is used. Except professional people like writers,
journalists, lawyer, teachers, etc. Others have very few occasions to
resort to this mode communication. Writing also fulfills a pedagogic
purpose in second language teaching. It is used to fix the structures and
vocabulary already learnt. Varghese (1990: 78) writes that the students
who learn to write English has not only to cope with the mechanical
36
problems connected with the script of the language but also with the
problems of ease and fluency of expression, of grammatical and lexical
accuracy, and of the appropriateness of the style of writing as demended
by the occasion or situation.
According to Hampton (1989), some writes goals are as follow:
a. writers are independent when they are able to write without much
assistance.
b. writers gain comprehensibility when they can write so that it can be
read and understood by themselves and others.
c. writers are fluen when they are able to write smoothly and easily as
well as understandably.
d. writers gain creativity when they write their own ideas, not copying
what has already been written, so that they can be read and
understood.
In academic purpose, Byrne (1997: 10) states that there are five
pedagogical purpose of writing:
a. the introduction and practice of some form of writing enables us to
provide for different learning styles and needs.
b. written work serves to provide the learners with some tangible
evidence that they are making progress in the language.
c. exposure to the foreign language though more than one medium,
especially if skill are properly integrated, appears to be more
effective than on a single medium alone.
37
d. writing providesvariety in classroom activities, serving as a break
from oral work.
e. writing is often needed for formal and informal testing.
5. The Reason of Teaching Writing
The most important reason for teaching writing is because writing
is the basic language skill. Byrne (1997: 6-7) gave the reasons of
teaching writing in the early stages. Writing serves a variety of
pedagogical purpose as follows:
a. The introduction and practice of some forms of writing enables the
learners to provide for different learning style and needs. Some
learners, especially those who do not learn easily through oral
practice alone, fell more secure if they are allowed to read and
write in the language. For such students, writing is likely to be an
aid to retention, if omly because they feel more at ease and relaxed.
b. Written work serves to provide the learners with some tangible
evidence that they are making progress in the language. It is not
likely to be a true index of their attainment, but it satisfied a
psychological need.
c. Exposure to the foregn language through more than on medium
appears to more effective than relying on a single medium alone.
d. Writing provides variety in classroom activities. It is increase the
amount of language contact through work that can be set out class.
e. Writing is often needed for formal and informal testing.
38
6. Teaching Writing
Teaching is “work” of a teacher (Oxford Learner’s Pocket
Dictionary, 2003; 443). writing is “activity of writing” (Oxford
Learner’s Pocket Dictionary, 2003: 502). Based on the expert, Harris
(1993:45) states “writing is full of starts and stops, punctuate, by long
pause for reflection or by the need to regenerate concentration.” It can
be concluded that teaching writing is essentially important for students.
Raimes (1993: 3) gives the reason for teaching writing “we frequently
have to communicate with each other in writing and writing reinforce
grammatical structure, idioms and vocabulary. Teaching writing is a
unique way to reinforce learning”.
From the statement above, it can be concluded that written
exercises will generally be used simply to reinforce the learning of
specific grammatical points and lexical items. The later on, writing will
be treated as an end of a complex skill in involving the simultaneous
practice.
Four categories of written performance that capture the range of
written production are considered here. Each category resembles the
categories defined for the other three skills, but these categories, as
always, reflect the uniquenness of the skill area.
a. Imitative, to produce (based on) written language, the learner must
attain skills in the fundamental, basic tasks of writing letters,
words, punctuation, and very brief sentences. This category
includes the ability to spell correctly and perceive phoneme-
39
grapheme correspondences in the English spelling system. It is a
level at which learners are typing to master the mechanics of
writing. At this stage, form is the primary if not exclusive focus,
while context and meaning are of secondary concern.
b. Intensive (controlled), beyond the fundamentals of imitative
writing are skills in producing appropriate vocabulary within a
context, collocations and idioms, and correct grammatical features
up to the length of a sentence. Meaning and context are of some
importance in determining correctness and appropriateness, but
most assessment tasks are more concerned with a focus on form,
and are rather strictly controlled by the test design.
c. Responsive, here, assessment tasks require learners to perform at a
limited discourse level, connecting sentences into paragraph and
crating a logically connected secuence of two or three paragraph.
Tasks respond to pendagogical directives, list of criteria, outlines,
and other guidelines. Genres of writing include brief narrative and
description, short reports, lab reports, summaries, brief responses to
reading, and is more focused on the discourse conventions that will
achieve the objectives of the written text. Form-focused attention is
mostly at the discourse level, with a strong emphasis on context
and meaning.
d. Extensive, extensive writing implies successful management of all
the processes and strategies of writing for all purposes, up to the
length of an essay, a term paper, a major research project report, or
40
even a thesis. Writers focus of achieving a purpose, organizing and
developing ideas logically, using details to support or illustrate
ideas, demonstrating syntactic and lexical variety, and in many
cases, engaging in the process of multiple draft to achieve a final
product. Focus on grammatical form is limited to occasional editing
or proofreading.
7. The Writing Process
According to Harris (1993: 96), three are 4 essential steps of the
writing process namely pre-writing, drafting, revising, and editing.
a. Pre-write
Pre-write is also called planning. In this important first step
learners are given an opportunity to collect their thoughts and ideas
before committing pen to paper. They need time to develop ideas.
They may need time to read or undertake other form of research. In
pre-writing step, the learner begin digging for the basic raw they
need. They are expected to be able to formulate the purpose and
then organize the ideas. If the planning is done properly, it can case
the students to write without hesitation or worry.
b. Drafting
Drafting has aim to translate plans and ideas into a
provisional text. Drafting allows writers the flexibility to explore,
to make discoveries and to change their ideas (Harris 1993: 56).
Drafting allows writer to start producing their writing by
developing their ideas. It is often the cases that as writers proceed
41
with creating a text, they come to redefine ideas, think of new
ideas, and perceive different and more significant way of
sequencing their ideas. The actual creation of a text is a process
that demands a great deal of concentration and application.
c. Revising
Revising is the process of seeing again, or discovering a
new division for the writing that the students produce during pre-
writing or drafting. Learners should employ various reading
strategies to help them rethink, reorder, and rewrite substantial
portions of what they have been written. Additional, bits of text can
be deleted, added or removed to a different place. Revising occurs
when a writer looks for feedback from a teacher or another student
(Vaca, and Grove, 1995: 107). At this stage, the learners get
revision from other people who have more knowledge on the topic
by adding, removing, rearranging, and replacing the sentences or
words. In this case, a teacher is the appropriate person who `knows
well about the topic has been written in order` that the students‟
work can be more logical and coherent.
d. Editing
When the decision is made and the draft is finished, there
remains the task of editing and publishing. Editing needs to be done
after revision. In this stage the learner know where the in-correct
words or sentences, and then they begin to edit their work. Editing
involves the careful checking of the text to ensure that there are no
42
errors spelling, punctuation, word choice, and order. Sharing of the
work with other peers will help to keep motivation and
concentration. It encourages the self-help and independence that
attributes of mature and confidence
8. Problem in Writing
For most people, writing is considered as a difficult activity, both
in the mother tongue and in a foreign language. There are three heading
problems which are caused by writing according to Bryrne (1994: 4-5)
a. Psychological problem
Writing is essentially a solitary activity` and the fact that
people are required to write on their own draft, without the
possibility of interaction or the benefit of feedback, in itself makes
the act of writing difficult. Writers have no immediate feedback to
let them know how they are doing and whether they should change
their approach. There is no immediate between thr producer and
the receiver.
b. Linguistics problems
Different from oral communication the language used in
written language is either simplified (list, telegram, note, etc.) or
more elaborate, more formal. In a foreign language this process is
all the more difficult as there may be interference on a cultural
level, not just the linguistics, between mother tongue and the
foreign language.
c. Cognitive problems
43
Writing is learned through process of instruction. The
written form of the language and certain structures, which are less
used in speech, should be mastered and learned the way to organize
the ideas is also important for effective communication which has
to be learned in writing.
9. Criteria for Good Writing
Fachruddin Ambo (1988:8) in his book Dasar-Dasar Keterampilan
Menulis states about the good writing: “the good writing is that can be
communicated effectively with the reader”.
Enre (1988:9-11) also states the criteria for good writing as follows:
a. Meaningful
Good writing must be able to convey something in which it is
meaningful to someone and can give the evidences about what it‟s
said.
b. Clear
It can be said as a clear writing if the intended reader can
read in constant speed and catch the meaning. Clear writing
shouldn‟t have been simple, but mustn‟t be more difficult than the
situation as it ought to be.
c. Coherent
Other characteristic of good writing is coherent it means
that the information is clearly connected and arranged. It has been
original systematically so the reader can follow the composition
easily.
44
d. Economic
If the main purpose of the writer is giving information, she
should avoid pleonasm. In a good writing, the words used are
appropriate, and the sentences are clear, concise, emphatic, and
correct. So, it doesn‟t waste time by veering away from focus
without reason.
e. Cohesive
It means that the writing does not contain tons grammatical
patterns, substitution, elliptical construction, preposition,
conjunctions to relate among the clauses within paragraphs.
10. The Scoring Writing
There are many categories to score the students‟ composition text.
They are content, organization, vocabulary, language use, and
mechanics. Then, each of the categories has a rate score. According to
Hughes, A (2003: 101-102), the scoring of each component is as
follows:
Table 2.1 The Scoring of Writing
No Criteria Score
1 Content
- Few (if any) lack of substantive knowledge and 5
relevant to assigned topic.
- Some lack of knowledge and relevant to assigned 4
topic but do not impair communication.
- Frequent or lack of knowledge and assigned topic 3
45
very frequent.
- Lack of knowledge and assigned topic very frequent, 2
readers own interpretation is needed.
- Lack of knowledge and assigned topic so severe as to 1
make communication impaired.
2 Organization
- Few (if any) organization and link to ideas. 5
- Some lack of ideas but do not impair communication. 4
- Lack of organization and link of ideas frequent; 3
reading is required for clarification ideas.
- Lack of organization and link of ideas frequent; 2
readers own interpretation is needed.
- Lack of organization and link of ideas so severe as to 1
make communication impaired.
3 Vocabulary
- Few (if any) inappropriate words. 5
- Use some inappropriate words but not interfere 4
comprehension.
- Use wrong or inappropriate words frequent, 3
expressing ideas limited.
- Use wrong or inappropriate words very frequent, rears 2
own interpretation is needed.
- Many inappropriate words, so limited as to make 1
comprehension impossible.
46
4 Grammar
- Few (if many) errors of grammar or word order. 5
- Some errors of grammar or word order but do not 4
interface comprehension.
- Errors of grammar or word order fairly frequent; re- 3
reading is necessary for full comprehension.
- Errors of grammar or word order very frequent; 2
readers own interpretation is in needed.
- errors of grammar or word order so severe as to make 1
comprehension virtually impossible or not enough to
evaluate.
5 Mechanic
- Few (if any) wrong spelling, punctuation, and 5
capitalization.
- Some misspelling, capitalization, and punctuations but 4
do not interfere comprehension.
- Frequent misspelling, punctuation, and capitalization; 3
re-reading is necessary for full comprehension.
- Wrong spelling, capitalization, and punctuation very 2
frequent; readers own interpretation is needed.
- Wrong spelling, capitalization, and punctuation so 1
severe as to make comprehension virtually imposible
or not enough to evaluate.
47
Formula Score:
Content + Organization + Vocabulary + Grammar + Mechanic =
Total.
Writing Score = Total x 100
25
From the explanation above those score would be classified by
using score level interpretation adapted from Djiwandono (1996: 156),
it concerned:
Table 2.2 The Classificasion of Students’ Composing Writing
Score in Descriptive Text
No Score Criteria Frequency %
1 80-100 Excellent Total Students Presentation
2 61-80 Good Total Students Presentation
3 41-60 Fair Total Students Presentation
4 21-40 Poor Total Students Presentation
5 <20 Failed Total Students Presentation
48
B. Review on Descriptive text
1. The meaning of Descriptive Text
Oshima and Hogue (1977:50), define that descriptive writing
appeal to the senses, so it tells how something looks, fells, smells, testes
and/ or sounds. A good description is like a “word picture” the reader
can imagine the object, place or person in his or her mind.
According to Kane (2000:352), description is about sensory
experience how something looks, sound, tastes. Mostly, it about visual
experience, but description also deals with other kind of perfection.
From the description above, it can be concluded that descriptive
text that tell something looks like. Because of that, when the reader read
the descriptive text it can be “seen” clearly in the mind of the reader.
2. The Parts of Descriptive Text
Based on Zumakshin and Mufarichah (2004:9), there are some
language features of descriptive text. The language features are as
follows:
a. Communicative purpose: descriptive is a type of written text, which
has the function to give description about a particular person, place
or thing.
b. Generic Structure:
1) Identification : indentifies objects to be described.
2) Description : details description of part, qualities, and
characteristics.
49
c. Language Focus
1) The writer are found in the topic of description. Example: My
classroom, my cat.
2) Adjective:
The writer are used to describe the characteristics of the
topic and the part. The characteristics of the topic and the part.
The characteristics can be the size, color or the quality.
3) Noun Phrases
The writer are combination of adjectives and nouns.
Example: two brown doors, a big and clean classroom.
4) Verb
The verbs usually used in a description are “have” (have,
has) “to be” (am, is are). The tense is the simple present tense.
3. The Social Function of Descriptive Text
Hartono (2005:206) states that function of descriptive text is to
give information. Contextual factor or social context of this text is
describing things. It can be person, animal or place (specific things like
our friend or person who we know them well). The social function of
description text is to describe particular person, place or things.
4. The Generic Structure of Descriptive Text
The generic structure of descriptive text
1. Identification it is a part of paragraph which introduces or identifies
the character.
50
2. Description it is a part of paragraph which describes the character.
(Masruri, M. 2010).
The generic structure of descriptive text consists of identification and
description. Identification: Identifies phenomenon to be described.
Description: Describes parts, qualities, characteristics, etc. (Jenny
Hammond in Mursyid, M. PW, 2011)
5. The Example of Descriptive Text
Prambanan Tample
One of the most popular artifacts in Indonesia Is Prambanan, a
complex of temples which was built in 825 A.D. The central parts of
Prambanan complex consists of three main shries dedicated to the gods
of the trimurti.
The Temple of Siva stands in the center, that of Vishnu on the
north, and that of Brahma on the south. In front of each of these main
temples stands another smaller temple, constructed to contain a statue of
the mouth of each god. This ensemble is completed by two annexes, the
Candi Apit or flanking temples, and nine small shrines to shelter the
stones demarcating the compound whitin which the temple complex
stands.
51
The central shrine rests on a projection from the base of Siva
Temple. This result in the complex‟s layout to be asymmetrical. The
central shrine is set against the south side of the east staircase leading to
the main sanctuary of Siva Temple.
The main terrace of Prambanan is Surrounded by four concentric
square of chapels on the lower.
52
CHAPTER III
RESEARCH METHODOLOGY
This chapter discusses the method of this study. It covers research
design, research setting and participant, data collection techniques, and
data analysis technique.
A. Research Design.
In order to answer the research questions on howstudents‟ ability is
in writing descriptive texts in terms of schematic structure and linguistic
features, this study employed qualitative method. It was chosen since
qualitative method is used to comprehend social phenomenon from
participant point of view (Alwasilah, 2011). In association with qualitative
method, a qualitative case study is usedto discover meaning, investigate
the processes, and to gain in-depth understanding of an individual, group,
or situation (Lodico, Spaulding, andVoegtle, 2006).According to Cohen
and Manion ( in Nunan, 1992), a case study observes the characteristic of
an individual unit to probe deeply and to analyze the intensity of the
multifarious phenomena that constitute the life cycle of the unit with a few
to establishing the unit belongs. It provides a unique exampleof real people
in real situations, enabling readers to understand ideas more clearly than
simply by presenting them with abstract theories or principles (Cohen,
Manion, and Morrison, 2005)
According to Arikunto (1993:92)“the other terms for document
analysis are content analysis or information analysis”. In this research, the
53
researcher analyzed student‟s writing ability in descriptive text of the tenth
grade at MAN 2 Boyolali.
B. Setting of the Research
1. Place
This research was conducted atMAN 2 Boyolali. A description, this
school is located in Jl.Simo-Bangak, Boyolali, Jawa Tengah.
2. Time of the Research
Time observation and research used to take data. This research will be
conduct on November-Januari 2016.
C. Subject of the Research
The subject of this study wasthe students class at tenth grade high
schoolinSimoBoyolali. This setting was chosen since this school is one of
favorite high schools in SimoBoyolali. The participants involved in this
study were a teacher and a class (XIPS2) consisted of 26students. All
students‟ writings were collected but only ten texts from five students
from low, and from high achiever from were analyzed in terms of
schematic structure and languages features. Tentexts sample were chosen
since in qualitative design, the quality of the samples is more important
than the number of samples DePaulo (2000).
D. Instrument
Arikunto (2002:160) argues that research instrument is a facility
used by the researcher to collect the data accurately, completely
systematically and easy to be analyzed. From the definition above, it can
be concluded that the instrument in a research is very important in order to
54
get accurate data. Instruments that were used in this study to measure the
students‟ achievement in writing descriptive text are: observation,
interview and documentation.
E. Technique of Collecting Data
Based on the view Creswell (2009: 178) the techniques of
collecting the data in qualitative research involve four basic types. These
are observation, interview, documentation and audio-visual material
The object of the research is writing ability in descriptive text. In
this research explain how to collect data only one ways:
1. Document Analysis
Document means something either written of film researcher
doesn‟t prepare before or researcher doesn‟t take a role (Moleong,
2004:216-217). In this research the researcher took the main data from
the students‟ worksheets of writing descriptive text fromthe Intensive
class(XIPS2) of MAN 2 Boyolali in Academic Year 2016. The
researcher took 23 students‟ worksheet. The topics of students‟
worksheet above were about person, place, and thing.
2. Interview
Interview needed to get information from informant. Lexy
(2002:135) states that interview is a conservation which is done by two
people as interviewer and interviewee with certain purposes. The
purpose of the interview is to know about the problems that students got
55
when they writing descriptive text and the teacher solutions for
students.
The researcher informant is Miss RinningS.Pd.I as the English teacher
of the second grade students in MAN 2 Boyolali in order to know how
the teacher teaches writing descriptive text in the class. The researcher
also interviewed some of students, about learning and difficulties
writing descriptive text.
3. Observation
Observation is a method to look something as object seriously and
continuously done by the researcher. This technique depends on the
direct observation and also watches the object doing by researcher
his/herself continually, then takes notes the behavior and the real event
which is happened (Moleong, 2004:174). During the process of
teaching and learning in writing descriptive text, the researcher
observed the process of teaching learning in the class from the
beginning until the end of the lesson. This technique used by researcher
to know how students write descriptive text and support the result of the
writing ability on composing descriptive text.
56
F. The Technique of Analyzing Data
After collecting the data, data analysis will be done to analyze the
whole data obtained. In this research “qualitative descriptive research” will
be used. A qualitative method is kind of research without using any
calculation or statistic procedure.
Analyzing data refers to a method of treating the data that have
been collected by the researcher. It can ease the reader to understand the
essential meaning and important parts of the data. According to Miles and
Hubermean(in Sutopo 2002:95) stated that analyze the data, researcher
needs to go through some steps that is data reduction, data display,
conclusion, verification.
1. Data Reduction
Miles and Huberman (1992:16) states that the data reducing can be
interpreted as the process of selection, simplification and transformation of
the data to the field note. The data reduction was done during the research
activities. In this case, the researcher reduced the information during the
research activities of the data of the research. The research took the data of
the students worksheet of the students in writing descriptive text.
2. Data Display
Display of the data is a description of the data. As the second
component in analyzing the data, this technique was used in arranging
information, description or narration in order to draw conclusion.
Miles and Hubermean in Sugiyono (2010: 341) stated that, “the most
57
frequent form of display data for qualitative research data in the past
has been narrative text”.
3. Conclusion and Verification
The researcher draw the data after describing and interpreting the data
continuously and throughout in the course of study as the outcome of
interpretation. The researcher interpreted the data which taken and then
make conclusion. The outcome of the study is the analysis ofthe
students‟ ability of writing descriptive text at tenth grade of MAN 2
Boyolali.
Collecting the Data
Reducing the Data Presenting the data
Conclusion: Drawing/ verifying
Figure 3.1 : Miles and Huberman’s flow mode
58
Data reducing refers to the process of selecting, focusing,
simplifying, abstracting, and transforming the “raw” data that appear in
written-up field notes. As the researcher sees, data reduction
occurscontinously through-out the life of any qualitatively oriented
project.
The researcher defines a “display” as an organized and action taking
looking at displays helps the researcher to understand what is happening
and going to do based on understanding.
The last stages of analysis activity is conclusion drawing and
verification. It means that the researcher draws the conclusion of the data.
G. The Trustworthiness of Data
To avoid the bias data, the researcher uses the triangulation.
Triangulation is qualitative cross-validation. It assesses the sufficiency to
the data according to convergence of multiple data sources or multiple data
collection procedures, (WiliamWiersa in Sugiyono 2010: 372). It means
that in doing triangulation for getting the credibility there are source
triangulation, the technique of collecting data and time.
Triangulation is the most common way that is used in improving
data validity in qualitative research. Related to this, Patton (1984, in
Sutopo, 2006: 92) states that there are four kinds of triangulation
techniques, those are data triangulation, investigator triangulation, method
triangulation, and theory triangulation. In this research the researcher used
method triangulation.
59
Method triangulation is a technique that can be done by the
researcher in collecting the same data by using different methods, and
checking the validity of the source data by using different method. So,
method triangulation in this research was done by comparing different data
which were obtained from different methods, namely observation and
interview. Those were used to answer the second problem statement about
the problem and solution in students‟descriptive text.
First, Investigator triangulation means asking to another people
who have bachelor and ninth semester to recheck the data validation. In
this triangulation the researcher asked to expert in writing to check the
students‟ worksheet. Second, Method triangulation means that in checking
the data validation of a problem, the researcher has to compare some
methods of collecting the data (observation interview, and documentation)
in order that the data collection is in the same place of portion. If there is a
different of data validation the researcher must reconfirm to the subject
and informant research. In this triangulation, the researcher compared
between the result of the observation with the result of interview. After the
researcher observed the teaching and learning process, the researcher
compared the result of observation with the result of the interview. The
researcher also compared between the result of interview and the result of
document.
60
CHAPTER IV
RESEARCH FINDING AND DISCUSSION
In this section, researcher will present two things; research findings
and discussion. In research findings, after collecting the data from XIPS2 students
of MAN 2 Boyolali, researcher analyzed how the students composed descriptive
text. In discussion section, the researcher discusses the findings of the study with
the supporting concepts having been presented previously.
A. Research Findings
1. Analysis of the Student’s Writing Ability in Composing Descriptive
Text
Research findings present and discuss the answer of the research
problemcomposing writing descriptive text in the aspect of writing. Based
on the results of the analysis of 23 students‟ composing writing score in
descriptive text of the XIPS2 MAN 2 Boyolali it was found 15 students or
(65%) were categorized as excellent, 8 students (35%) were categorized
as good, and there was no students were categorized as fair, poor and
failed. The Student‟s writing ability in composing descriptive text was
scored based on the five aspects of writing. The are the contents,
organization, grammar, vocabulary, andmechanics.
Here the analysis of each aspects for each students:
written by A ZM (1)
Borobudur Temple
Borobudu is Hindu Budhist temple was build the nineth century under
sailendre dynasty of anceneamataramkingdome. Borobudur is located in
magelang central Java, Indonesia. Borobudur is well known all over.
The temple is cans tatitedan a hill 4.6mhigh and can sist of eight step like
stane terrace.
61
1. The student‟s writing abililty in the aspect of Content
In the text, the researcher found that the student wrote a text related to the
topic that. He has chosen. It indicates that the student have known well
about the text and he was be able to deliver the messages of the text to the
readers.
2. The student‟s writing ability in the aspect of Organization
In this aspect, the student showed that his ability in generating idea into
well-organized was good. In indicates that the student have known well
about the text and he was able to deliver the messages of text to the
readers.
3. The student‟s ability in the Aspect of Grammar.
4. The student‟s writing ability in the aspect of Vocabulary
From the next worksheet, the researcher found that there were some
inappropriate words in the sentences did not refer to the meaning. There
were the some examples of inappropriate words used and the examples of
incorrect word spelling written by the students in the sentences “the temple
is cans tatitedan a hill 4.6 m high and can sist of eight step like stone
terrace”.
5. The student‟s writing ability in the aspect of Mechanic
In general, the Student‟s writing ability in this aspect was good enough. It
means the student has known well about the use punctuation,
capitalization and spelling. Although, he was able to used the correct
mechanic, he still made mistakes in using punctuation correctly. The
62
following sentences are the examples of the students‟ mistakes in the
aspect of mechanics.
a. Borobudur is Hindu Budhist temple was build the nineth century under
sailendre dynasty of anceneamataramkingdome Borobudur is located in
magelang central Java, Indonesia Borobudur is well known all over.
b. the temple is cans tatitedan a hill 4.6 m high and can sist of eight step
like stone terrace
Written by A F
My friend
I have a girl friend. Her name is may Dhimas. She is a student in SMK BK
Simo.
The girl was born in Boyolali on 6 May 2001.she is tall. She has long hair,
flat nose and nice smile. She is beautiful.
She has Characteristics. Care, humorous, humble, loyal and Friendly. She
resides in pulerejo, kedunglengkang, Simo, Boyolali.
1) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote the text
related to a genre of texts. That is descriptive text. He could make a
sequence event starting from the introduction to the depicted person to
general information about the person. Thus, he could deliver the point of
what he wanted to tell.
2) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that her ability in this aspect was good
enough. The generic structures of descriptive text are identification and
description. In the text above, the student had elaborated the generic
structure into well-organized text. It started to the identification what the
student would describe then it was narrowed down into detailed
description.
63
3) The student‟s writing ability in the aspect of grammar
In this case, the researcher focused on grammar structure aspect and tense
that is required in descriptive texts and the student had some grammar
mistakes in this text. The grammar mistakes are as follows:
a) On 6 May 2001, should be “on 6th May 2001”
b) She has characteristic, should be “She has the characteristics”
4) Student‟s writing ability in the aspect of vocabulary
From the text above, the researcher focused on diction or vocabulary and
the researcher found that the student had written some inappropriate
vocabularies as follows:
a) She has characteristic, care, humorous…, should be “She has
characteristics that she is care, humorous …”
b) She has long hair, flat nose and nice smile, should be “She has a long
hair, a flat nose and a nice smile.
5) The student‟s ability in the aspect of mechanic
These aspects are about capitalization, punctuation and spelling. In
general, the student‟s ability in this aspect was good enough. However,
there were some mistakes as follows:
a) The first sentence should be in capital like “her name is, should be “Her
name is”
b) A letter in words cannot be in capital if the words are in the middle of
sentence like “she is a Student, Loyal and Friendly”, should be “she is a
student, loyal and friendly”
64
Written by AH
Prambanan Temple
Prambanan temple or CandiRoroJonggrang is a ninth-century hindu temple
located in centaral Java, Indonesia. And dedicated to the trimurti, the
expression of god as the creator (brahma) the preserver (Vishnu) and the
destroyer (shive). The temple compound is aproximately 17 kilometers
(11mil) north east of the city of Yogyakarta.
It is characterized by its height and pointed architecture, and the towering 47-
meter high (154ft) central buildira inside a large complex of individual
temples.
1.) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote a text related
to the topic that he had chosen. It indicates that the student had known
well about the text and he was be able to deliver the messages of the text
to the readers.
2.) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that his ability in generating idea into
well-organized was good. It indicates that the student have known well-
organized was good. It indicates that the student had known well about the
text and he was able to deliver the messages of the text to the readers.
3.) The student‟s writing ability in the aspect of grammar
In this aspect, the researcher focused on the Student‟s writing ability in
composing grammatically with the correct simple presenttenses,
adjectives, and complements. The researcher did not find any mistakes in
the sentences.
4.) The student‟s writing ability in the aspect of vocabulary
Fromthe text above, the researcher did not find that inappropriate words in
the sentences.
65
5) The student‟s writing ability in the aspect of mechanic
In general, the Student‟s writing ability in this aspect was good. It means
the student had known well about the use punctuation, capitalization and
spelling.
Written by AEW
Younger brother
I have a younger brother, akbar. He was born in banjarnegara 25 agustus
2007.
He white skin. Hobby hem playing station. He like eat Bakso. He tall and he
cute he easy Angry but he gasy smile.
I not know printed cotton‟s but I‟m always love my younger brother. I‟m and
younger brother always quara but we now day will not agree because I‟m
cange to uncle home in boyolali.
1) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote the text
related to the genre of the text. That is descriptive text. He could make a
sequence of events starting from the introduction to the depicted person to
general information about the person. Thus, he could deliver the point of
what he wanted to tell.
2) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that her ability in this aspect was good
enough. The generic structures of descriptive text are identification and
description. In the text above, the student had elaborated the generic
structure into well-organized text. It started to the identification what the
student would describe. Then it was narrowed down into a detailed
description.
66
3) The student‟s writing ability in the aspect of grammar.
In this case, the researcher focused on grammar structure aspect and tense
that required are in descriptive text and the student had some grammar
mistakes in this text. The grammar mistakes are as follows:
a) 25 agustus 2007. Should be “On 25th August 2007”
b) He white skin. Should be “He has a white skin.
c) hobby hem playing station, should be “His hobby is play station”
d) he like eat Bakso, should be “He likes eating Bakso”
e) He tall and he cute, should be “He is tall and he is cute”
f) he easy angry but he easy smile, should be “ He is easy to be angry, but
he is easy to smile”
g) I not know printed cotton‟s, but i‟m always loveshould be “I don‟t
know printed cotton’s, but I always love…”
h) i‟m and younger brother always quarrel, should be “My younger
brother and I always have quarrel.
i) My uncle home, should be “My uncle‟s home”
4) Student‟s writing ability in the aspect of vocabulary
From the text above, the researcher focused on diction or vocabulary and
the researcher found that the student had written some inappropriate
vocabularies as follows:
a) I‟m came to my uncle home, should be “I went to my uncle‟s home”
b) We nowaday will not agree because, should be “Nowadays, he did not
agree with me because”
67
5) The student‟s ability in the aspect of mechanic.
These aspects are about capitalization, punctuation and spelling.In general,
the student‟s ability in this aspect was good enough. However, there were
some mistakes as follows:
a) Tittle requires capital each word or the rest of the word. The phrase my
younger brother, “ should be written My Younger Brother”
b) Name must be in capital. akbar, should be “Akbar”
c) The first sentence should be in capital. “he was born, he white skin,
hobby hem playing, he like eat, I‟m younger brother”, should be “He
was born, His skin is white, His hobby is playing, He likes eating, My
younger brother and I”
d) The name of regency must be in capital. “boyolali”, should be
“Boyolali”
Written by D SS
YOUNGER SISTER
I have a younger sister. Latifa. She was bron in Surakarta, 26 July 2009
She white skin, pointed nose, and straight hair.
hobby She‟s playing.
She like eat Bakso. She tall and she cute
She easy angry but easy smile.
her Father‟s is = agussriyanto
her mother‟s is = LastriHidayati
Her younger brother = Hammam
Latifa resides in south Terikwarung, Surakarta. She is a student of TK aisyiah
Surakarta.
1. In the text above, the researcher found that the student wrote a text related
to the descriptive text. She told about her young sister named Dina Septika
Sari
2. The student‟s writing ability in the aspect of Organization.
-
68
3. The student‟s writing ability in the aspect of Grammar
a. She white skin should be She has white skin
b. hobby She‟s playing should be Her hobby is playing
c. She like eatBakso should be She likes to eat Bakso
d. She easy angry but easy smil should be She easy to angry but easy to
smile
e. her Father‟s is = agussriyanto should be her Father‟s name is
agussriyanto
f. her mother‟s is =LastriHidayati should beher mother‟s name is
LastriHidayati
g. Her younger brother = Hammam should be Her younger brother is
Hammam
4. The student‟s writing ability in the aspect of Vocabulary
5. The student‟s writing ability in the aspect of Mechanic
a. I have a younger sister. Latifa. Shoul be I have a younger sister, Latifa
b. her Father‟s is = agussriyantoShoul be Her Father‟s is AgusSriyanto
c. her mother‟s is = LastriHidayati. Shoul be Her mother‟s is
LastriHidayati.
d. Her younger brother =HammamShoul be Her younger brother
Hammam
Written by IN
My Sister n‟my eider brother favorite
I have a sister, shofinurchofifah, she was born in 25 december 1995,
semarang, central java, Indonesia. Now she university UIN Walisongo, I‟m
69
pround have a sister as she. I want become as she, to be success. She body
tall, beauty, nose pointed, diligent. Now she become teacher in semarang.
And I‟m have a elder brother too, Ahmad wantoha he ever unevercity in
UGM Yogyakarta. He very smart and diligent. I pround have two sister n
elder brother as she he.
1) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote the text
related to a genre of texts. That is descriptive text. He could make a
sequence of events starting from the introduction to the depicted person to
general information about the person. Thus, he could deliver the point of
what he wanted to tell.
2) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that her ability in this aspect was good
enough. The generic structures of descriptive text are identification and
description. In the text above, the student had elaborated the generic
structure into well-organized text. It started to the identification what the
student would describe then it was narrowed down into detailed
description.
3) The student‟s writing ability in the aspect of grammar
In this case, the researcher focused on grammar structure aspect and tense
that required in descriptive text and the student had some grammar
mistakes in this text. The grammar mistakes as follows:
a) now she university, should be “now her university”
b) I‟m proud have a sister as she, should be “I‟m proud of having a sister
like her”
c) I want become as she, should be “I want to be like her”
70
d) She body tall, beauty, nose pointed, should be “Her body is tall. She is
beautiful. She has a pointed nose”
e) Now she become, should be “She have become a teacher now”
f) I‟m have, should be “I have”
g) He ever university, should be “he has ever studied at university”
h) He very smart, should be “he is very smart”
i) I proud have two sister n‟ elder brother as she he, should be “I proud of
having two sister and brother like them.
j) I have a elder brother, it must be “I have an elder brother”
k) I pround have, should be “I am proud of you”
4) Student‟s writing ability in the aspect of vocabulary
From the text above, the researcher focused on diction or vocabulary and
the researcher found that the student had written some inappropriate
vocabularies as follows:
a) Sister n‟ elder brother, should be “sister and elder brother”
b) The first letter of the word in sentence must be in capital. The mistakes
as follows: “she was born, he ever university, he very smart”. They
must be corrected into “She was born, He had ever studied at university,
He is very smart”.
c) The tittle My sister n‟ my elder brother favorite, should be “My sister
and My elder brother”
d) To be success, should be “to be successful”
71
5) The student‟s ability in the aspect of mechanic
These aspects are about capitalization, punctuation and spelling. In
general, the student‟s ability in this aspect was good enough. However,
there were some mistakes as follows:
a. The first paragraph cannot be conjunction like “and I‟m have”, should
be just “I have”
b. “elder Brother”, should be “elder brother”
Written by JR
My friend
I Have friend. She‟s name is NovitaMawarni. She is school in SMA N 1
KLEGO. Now She‟s Class X IPS 2 with Me But I am school in MAN 2
BOYOLALI. Adreee Home‟s in Pancuran, Sempulur, Karanggede.
She‟s was born in Boyolali 30 november 2001.
I with She Past be friend near four Years, I with She very near.
that‟snovita like eat SOTO, MIE AYAM, AND BAKSO.
Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval face,
flat nose, fussy Big Body.
Personality Characteristic novita Active, Humorous, agresive.
1. In the text above, the researcher found that the student wrote a text about
her closefriend. Her name is NovitaMawarni.
2. The student‟s writing ability in the aspect of organization
3. The student‟s writing ability in the aspect of grammar.
a. I have friend should be I have a friend
b. She‟s name is NovitaMawarni should be She is NovitaMawarni or her
name is NovitaMawarni.
c. Now She‟s Class X IPS 2 with Me But I am school in MAN 2
BOYOLALI should be Now she is in Class X IPS 2 with me, but I am
school in MAN 2 BOYOLALI
72
d. Adreee Home‟sinPancuran, Sempulur, Karanggede should be Her
address is in Pancuran, Sempulur, Karanggede.
e. She‟s was born in Boyolali 30 november 2001 should be She was born
in Boyolali 30 november 2001
f. I with She Past be friend near four Years, I with She very near should
be, We were being friend for four years, I‟m closed with her.
g. that‟snovita like eat SOTO, MIE AYAM, AND BAKSO should be She
likes to eat SOTO, MIE AYAM, AND BAKSO.
h. Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval
face, flat nose, fussy Big Body should be Her physical appearance is
Beautiful, Wavy Hair, Black eyes, oval face, flat nose, fussy Big Body.
i. Personality Characteristic novita Active, Humorous, aggressive should
be Her Personality Characteristic is Active, Humorous, and aggressive.
4. The student‟s writing ability in the aspect of Vocabulary
a. I with She Past be friend near four Years, I with She very near should
be “We were being friend for four years, I‟m closed with her”
b. Physical appearance novita is Beautiful should be “She is Beautiful”.
c. Personality Characteristic novita Active, Humorous, aggressive should
be “She also Active, Humorous, aggressive”.
5. The student‟s writing ability in the aspect of mechanic
a. My friend should be My Friend
b. I Have friend should be I have a friend.
73
c. Now She‟s Class X IPS 2 with Me But I am school in MAN 2
BOYOLALI should be Now she is in Class X IPS 2 with me, but I am
school in MAN 2 Boyolali.
d. that‟snovita like eat SOTO, MIE AYAM, AND BAKSO should be
That‟s Novita like eat Soto, Mie Ayam, And Bakso.
e. Physical appearance novita is Beautiful, Wavy Hair, Black eyes, oval
face, flat nose, fussy Big Body should be Physical appearance Novita is
beautiful, wavy hair, black eyes, oval face, flat nose, fussy big body.
f. Personality Characteristic novita Active, Humorous, agresive should be
Personality characteristic Novita active, humorous, agresive.
Written by LRD
Dina Septika Sari
Dina Septika Sari is a student. She clever. The Little lady was born in
Boyolali on 20 September 2001. She is short but good looking.
She always to depart school with motorcycle. She has brown Skin Pointed
nose, and wary hair. Her Father‟s name is Sartono. Her mother‟s name is Sri
Lestari. Her younger brother name is Hanafi.
Dina resides in South tlogo, Demangan, Sambi, Boyolali. She is a Student of
MA Negeri 2 Boyolali.
1. In the text above, the researcher found that the student wrote a text about
her friend, named Dina Septika Sari.
2. The student‟s writing ability in the aspect of organization
3. The student‟s writing ability in the aspect of grammar
a. She clever.
b. She always to depart school with motorcycle.
In this aspect, the student ability in grammar was good. It can be seen
from her writing. There were just two mistakes. In the first point, she
74
should insert is (to be) after “She” (Noun). In the second point was the
use of „always‟ or „adverb of frequency‟. If there was a verb in the
sentence, the use of adverb of frequency is written before the verb. The
form is: Subject + adv of frequency + verb. So, the correct sentence is
„She always departs to school‟.
4. The student‟s writing ability in the aspect of vocabulary
She always to depart school with motorcycle.In the sentence above, the
word „to depart‟ would be better by using „go to‟.
5. The student‟s writing ability in the aspect of mechanic
a. The Little lady was born in Boyolali on 20 September 2001shoul be
The little lady was born in Boyolali, on 20 September 2001..
b. She has brown Skin Pointed nose, and wary hairshoul be She has brown
skin pointed nose and wary hair..
Written by NM S
My Father
My father name is Juwarna. The was born in Boyolali on 17 Agustus 1985.
He is short but good looking. He have brown skin, nose pointed, and general
aspect a handsome. Her father‟s name is Bader, her mother‟s name is Aisyah.
My father is a buruhblagung. He to work buruh same buruh-buruhother.He to
work in morning.
My father like is a food vegetable. He like is a drink copy
1. The student‟s writing ability in the aspect of content
In the worksheet, the researcher found that the student wrote a text related
to the topic family that she had chosen. She told her family about her
father. She explained the content sequentially. From the text, she explained
the identification and the description.
75
2. The student‟s writing ability in the aspect of organization.
In this aspect, the student showed that her ability in generating idea into
well-organized composition was good. It indicates that the students had
known well about the descriptive text. She was able to deliver the
messages to the readers. But, in the description of the text she decreased
some sentences.
3. The student‟s writing ability in the aspect of the grammar.
In this aspect, the researcher focused on the Student‟s writing ability in
composing grammatically with the correct simple present tenses,
prepositions, and auxiliary verbs because those grammatical errors were
often made by the students in writing. The researcher found some
following mistakes in the sentences:
a. The was born in Boyolali on 17 Agustus 1985 should be, he was born in
Boyolali on 17 august 1985.
b. He have brown skin should be he has brown skin.
c. Nose pointed and general aspect a handsome.her father‟s name is bader.
d. He to work buruh same buruhburuhother should be he goes to work
place like another worker.
4. The student‟s writing ability in the aspect of vocabulary.
From the text, the researcher found that the vocabulary was inappropriate.
It can be seen in the following sentence:
a. Nose pointed and general aspect a handsome.her father‟s name is bader
should be nose pointed and general aspect handsome should be he has
nose pointed and handsome.
76
b. He to work buruh same buruhburuhother should be he goes to work
place like another worker.
c. He to work in the morning should be he goes to work.
5. The student‟s writing ability in the aspect of mechanic.
In general, the Student‟s writing ability in this aspect was good. It means
the student had known well about the use punctuation, capitalization and
spelling. The common mistakes, the students commonly made
werecapitalization in each sentence.
Written by SJK
My Friend
My friend name is Tiara, Tiara aulia. She‟s and I old friend from Junior High
School.I happy together you everyday.
She‟s short but good looking, and beautiful, best liver, patient. Straight hair
and round face. born in Boyolali November29 2000. She‟s very smart
student.
She‟s to stay in Jayan, Senting, Sambi, Boyolali. She school in Senior high
school 1 Sambi. I very love you.
1. In the text above, the researcher found that the student wrote a text about
Tiara Aulia. Tiara Aulia is her friend since they were in Junior High School.
2. The student‟s writing ability in the aspect of organization
3. The student‟s writing ability in the aspect of grammar
a. My friend name is Tiara, Tiara aulia should beMy friend‟s name is
Tiara, Tiara Aulia
b. She‟s and I old friend from Junior High School should be We were
being friend from Junior High School
c. I happy together you everyday should be I‟m happy together with her
every day
77
d. born inBoyolali November29 2000 should be She was born in Boyolali
November29 2000
e. She‟s to stay inJayan, Senting, Sambi, Boyolal should beShe lives in
Jayan, Senting, Sambi, Boyolali
f. She school in Senior high school 1 Sambi should be She is school in
Senior high school 1 Sambi
g. I very love you should be I love her very much
According to statements above, The student‟s writing ability in the
aspect of grammar was still low. There was a mistake in every sentence.
4. The student‟s writing ability in the aspect of vocabulary.
She‟s to stay in Jayan, Senting, Sambi, Boyolali.It better if the word „to
say‟ changed with „lives‟.
5. The student‟s writing ability in the aspect of mechanic
“born in Boyolali November29 2000. She‟s very smart student”.In this
aspect, the student ability was god. There was a mistake about
capitalization. The use of letter “B” in the word born should be capitalized.
Written by S
MY Friend
ZAINAL MA‟ARIF
ZAINAL MA‟ARIF is a student. She smart
The little dog was born in Boyolali on 21 Desember 2000. She is hair long,
flat nose, Chubby Cheek, Skin Black
She always to depart school with Motorcycle
Her father‟s name is Nururudin
Her mother‟s name is Tukiyem
Her younger sister‟s name is Aldi
Zainal resides in South Plugo, Karanggede,Boyolali She is a Student of SMK
6 Muhammadiyah
1. In the text above, the researcher found that the student wrote a descriptive
text. She told about his friend, named ZainalMa‟arif who lives in Plugo.
78
2. The student‟s writing ability in the aspect of Organization
3. The student‟s writing ability in the aspect of Grammar
a. He smartshoul be She is smart
b. He is hair long, should be She haslong hair
c. He always to depart school should be She always depart to school
4. The student‟s writing ability in the aspect of Vocabulary
a. She always to depart school with Motorcycle should be She always go
toschool by Motorcycle
b. Zainalresides in South Plugo, Karanggede, Boyolalishoul be Zainal
lives in South Plugo, Karanggede, Boyolali
5. The student‟s writing ability in the aspect of mechanic
a. MY Friend should beMy Friend
b. ZAINAL MA‟ARIFis a student should be ZainalMa‟arif is a student
c. He is hair long, flat nose, Chubby Cheek, Skin Black should be He is
hair long, flat nose, chubby cheek, black skin
d. He always to depart school with Motorcycle should be She always to
depart school with motorcycle.
Written by ON
My Friend
My friend name is via, via puspitasari. She is started my friend when class
one SMP. She born in Boyolali on 29 July 2001. She is she is good looking.
She has brown skin. Pointed nose and nice smile.
Her father‟s name is sopyan. Her mother‟s is SitiNurjanah. She has two
brothers. Her old brother‟s name Rizki. Her young brother‟s name is M.
Rizal.
She like playing musical instrument, and singing.She favorite food is
NasiGoreng and favorite drink is Strawberies juice.
79
1) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote the text
related a genre of texts. That is descriptive text. She could make a
sequence of events starting from the introduction to the depicted person to
general information about her. Thus, she could deliver the point of what
she was disposed for telling.
2) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that her ability was good enough. The
generic structures of descriptive text are identification and description. In
the text above, the student had elaborated the generic structure into well-
organized text. It started from the identification what the student would
describe then it was narrowed down into a detailed description.
3) The student‟s writing ability in the aspect of grammar
In this case, the researcher focused on grammar structure aspect and tense
that are required in descriptive text and the student had some grammar
mistakes in this text. The grammar mistakes are as follows:
a) My friend name, should be “my friend‟s name”
b) She is started, should be “started”
c) She born, should be “she was born”
d) On 29 July 2001, should be “on 29th July 2001”
e) She is she is good looking, should be “she is good looking”
f) She like playing, should be “she likes playing”
g) She favorite food, should be “her favorite food”
h) Favorite drink, should be “her favorite”
80
i) She has brown skin, pointed nose and nice smile, should be “She has a
brown skin, a pointed nose and a nice smile
j) Her brother‟s name Rizki, should be “Her brother‟s name is Rizki”
k) Strawberies juice, should be “Strawberry Juice”
4) Student‟s writing ability in the aspect of vocabulary
From the text above, the researcher focused on diction or vocabulary and
the researcher found that the student had written some inappropriate
vocabularies as follows:
a) “When class one SMP”, should be when “my friend was at the first
grade in junior high school”
b) “Nasi goring”, should be “fried rice”
5) The student‟s ability in the aspect of mechanic
In general, the student‟s ability in this aspect was good enough. However,
there were some mistakes as follows:
a) My friend name is Via, ViaPuspita Sari, should be just “my friend‟s
name is Via Puspita Sari”
b) Her father‟s name is Sopyan, Her mother‟s… ,should be “Her father‟s
name is Sopyan. Her mother‟s…
c) Favorite Drink, should be “favorite drink”
d) Strawberies Juice, should be “strawberry juice”
Written by UP L
My Sister
FebrianaSurviatin
Febrianasurviatin is a young talented singer, cooking.
The little lady was born in Boyolali on 27 february 1999. She is short but
good looking. She has brown skin, flat nose and nice smile. Her chuby cheek
makes her face is easy to remember.
81
Her father‟s is Suradi. Her mother‟s name is supriahatin.
Febri resides in Boyolali. She is a Student of SMA TarunatamSalatiga.
1) The student‟s writing ability in the aspect of content
In the text above, the researcher found that the student wrote the text
related to a genre of texts. That is descriptive text. He could make a
sequence of events starting from the introduction to the depicted person to
general information about the person. Thus, he could deliver the point of
what he wanted to tell.
2) The student‟s writing ability in the aspect of organization
In this aspect, the student showed that her ability in this aspect was good
enough. The generic structures of descriptive text are identification and
description. In the text above, the student had elaborated the generic
structure into well-organized text. It started from to the identification what
the student would describe then it was narrowed down into a detailed
description.
3) The student‟s writing ability in the aspect of grammar
In this case, the researcher focused on grammar structure aspect and tense
that are required in descriptive text and the student had some grammar
mistakes in this text. The grammar mistakes are as follows:
a) “On 27 February 1999”, should be “on 27th February 1999”
b) Her chubby makes her face is easy to remember, should be “Her
chubby makes her face easy to remember”
c) “She has long hair”, flat nose and nice smile, should be “She has a long
hair, a flat nose and a nice smile.
82
4) Student‟s writing ability in the aspect of vocabulary
From the text above, the researcher focused on diction or vocabulary and
the researcher found that the student had written some inappropriate
vocabularies as follows:
a) FebrianaSurviatin is a young talented singer, cooking, should be
“FebrianaSurviatin is a young talented singer and cooker”
b) SMA Taruma tama Salatiga, should be “The Senior High School of
Taruma Tama in Salatiga”
5) The student‟s ability in the aspect of mechanic
These aspects are about capitalization, punctuation and spelling. In
general, the student‟s ability in this aspect was good enough. However,
there were some mistakes as follows:
a) The first sentence should be in capital like “her chubby cheek, her
parent‟s name, her mother‟s name”, wichshould be “Her chubby cheek,
Her parent‟s name, Her mother‟s name”
b) A letter in words cannot be in capital if the words are in the middle of
sentence like “she is a Student, Loyal and Friendly”, should be “she is a
student, loyal and friendly”
c) Febri resides in boyolali, she is a student, should be “Febri resides in
Boyolali. She is a student…”
83
2. The Difficulties Faced by the Student’s in Composing Descriptive Text.
From the research findings above itis found that the students had
difficulties in many aspects descriptive text that is:
a. The students still difficulties in arranging the sentences. In the document
it can be seen on Andriya‟s text on the sentence “Andriya‟s”. It can be
concluded that she could not arrange the sentence correctly. On the
sentence, the word “hobby hem” should be deleted, after the word “day”
should be changed His hobby.
It can be seen from the Jovika‟s in the text above, the researcher found that
the student wrote a text about her close friend. Her name is Novita
Mawarni.
b. The students were still lack of vocabulary It can be seen from the
Andriya‟s text in the sentence “I‟m cange to my uncle home, should be “I
went to my uncle‟s home”. The word “cange” should be that changed into
“went”.
It can be seen from the Jovika‟s “I with She Past be friend near four Years,
I with She very near” should be “We were being friend for four years, I‟m
closed with her”
c. The students did not master the grammar well It can be seen on the
Andriya‟s text in the sentence “He white skin” which should be “He
has a white skin”.
It can be seen from the Jovika‟s “She‟s name is Novita Mawarni should be
She is Novita Mawarni or her name is Novita Mawarni”.
84
B. Discussion
1. Analyzing the Student’s writing ability in Composing Descriptive Text.
The following discussion explain about the research findings covering
XIPS2 MAN 2 Boyolali students‟ composing writing descriptive text in the
aspect of writing, and the discussion of the results of this research based on some
related theories. The researcher observed the teaching and learning process in
writing descriptive text. XIPS2 class consisted of 27 students, but when the
researcher did the observation 4 students did not join the class. In the teaching
and learning process, the teacher told the students about descriptive text, but as the
researcher observed the teacher did not teach about the theory of the writing
process. Based on the observation of the researcher the students wrote the text by
using free writing process. The teacher asked the students to write descriptive text
about vacation. The researcher analyzed the students‟ worksheets from the
teacher. To encourage the observation, the researcher showed and analyzed the
students worksheets of writing descriptive texts by using Hughes theory. The
researcher found the research finding, as follows:
Table 4.1 of Student‟s Composing Writing Score
No Name Assessor Assessor Score Criteria
I II
1 A ZainalMa‟ruf 80 82 81 Excellent
2 Ainunnisa Farah 76 76 76 Good
3 AldiHidayat 92 92 92 Excellent
4 Andriya Elisa Warda 72 72 72 Good
5 ArvianAdi s 64 64 64 Good
6 Dina Septika Sari 88 84 86 Excellent
7 HappytaQurrota A 96 92 94 Excellent
8 IinNurSafrina 64 68 66 Good
9 JovikaRamadhani 92 88 90 Excellent
10 LiaRatnaDewi 96 92 94 Excellent
11 Muh. Nurrodin 84 80 82 Excellent
12 Muhammad Anang M 88 92 90 Excellent
85
13 Muhammad Yoga A 88 84 86 Excellent
14 M FahrurRohman F 92 96 94 Excellent
15 NisaMaulianaJari 88 88 88 Excellent
16 OktaviaNingrum 76 72 74 Good
17 PutriRahmawati 88 84 86 Excellent
18 SyafiraJihanKamila 84 92 88 Excellent
19 Syaifullah 84 84 84 Excellent
20 UnikPuji L 76 76 76 Good
21 UswatunChasanah 80 84 82 Excellent
22 Wahyuana A. M 76 76 76 Good
23 Yudistira 64 64 64 Good
Table 4.2 The Classification of Student‟s writing ability in
Composing Descriptive Texts on Score
No Score Criteria Frequency %
1 80-100 Excellent 15 Students 65%
2 61-80 Good 8 Students 35%
3 41-60 Fair - -
4 21-40 Poor - -
5 <20 Failed - -
Total 100%
From the tables above it can be reported that 15 students or
(65%) were categorized as excellent, 8 students (35%) were categorized
as good, and there was no studentwho were categorized as fair, poor and
failed. Most students got Excellent scores. It means that the half of
students got the score between 81 to 100. It can be considered that the
MAN 2 Boyolali students ‟composing writing were Excellent in the result
of students‟ descriptive text writing showed the range of percentage were
mostly in excellent category.
86
2. The Difficulties by the Students in Composing Descriptive Text.
Based on the research finding above, the researcher finds that there
are some causes of students‟ difficulties in descriptive text in XIPS2 class
MAN 2 Boyolali. The result of the observation and interview shows the
difficulties that most of the students do not completely the three element of
writing:
a. The students still faced difficult in arranging the sentences.
b. The students were lack of vocabulary.
c. The students did not master grammar the tenses well.
Based on the interview to the students, the students tried to solve their
problems by asking to the teacher about their difficulties, opening the
dictionary, and joining private course.
87
CHAPTER V
CONCLUSIONS AND SUGGESTIONS
A. Conclusions
In this chapter, the researcher comes to conclude this research. Based on
the result of the students‟ worksheet in writing descriptive text and the discussion
presented in the previous chapter, it can be concluded that the XIPS2 students‟
writing ability in composing descriptive text at MAN 2 Boyolali in the academic
year 2016/2017.
The students wrote the text used free writing. Based on the result of the
analysis 23 students writing scores in the XIPS2 of MAN 2 Boyolali, it was found
that15 students or (65%) was categorized as excellent, 8 students (35%) were
categorized as good, there was no students were categorized as fair, poor and
failed. It showed that the ability of the XIPS2 students of MAN 2 Boyolali was
generally Excellent.
The difficulties in writing descriptive text faced by the students ware in
arranging the sentences, lackin vocabulary, low mastery of grammar well.To solve
their problems above the students asking the teacher, opening the dictionaries, and
joining the private courses.
88
B.Suggestions
After analyzing the data and making conclusion, the researcher has some
suggestions for teacher, students, and the next researchers, as follows:
1. For the English Teacher
a. The English teacher is suggested to give the students more practice in
writing in order to improve the students‟ writing ability.
b. The teacher should be more creative in teaching, and using media when
He teach.
c. The teacher also should teach about the theory of writing process in
order that the students will be able to produce a good writing.
2. For the Students
a.They need to improve their ability in grammar, mechanic, and
vocabulary andalways try to improve their abilities, especially in
writing skill by starting to write. Students may write everything, it may
be short stories.
b. Students shouldalso read books, magazines or anything else. After
reading, they should write down the new vocabularies they have fond,
then develop them into sentences, and paragraphs. Or when the teacher
have given the students the theory of writing process, they should use it
in order to make a good writing.
3. For the Next Researcher. The result of this research can be used as
additonal reference for the research. They are able to conduct other
research relating to the students‟ability its in writingdescriptive
textsinorder that the students” ability in writing descriptive text can be
89
improved. Further, they also able to apply certain teaching techniques,
media in teaching writing, or teaching methods in order to know the
effectiveness in the process of the teaching-learning in writing skill.
90
Bibliography
Al-Khasawneh, Fadi Maher. 2008. Error Analysis of Written English Paragraphs
by Jordanian Undergraduate Students: A Case Study. International
Journal on Studies in English Language, Literature and Humanities.
Ajloun National University: Jordan.
Anderson, mark and Anderson, Cathy, Text Types in English.(new
york)Maimillan, 1997)
Arikunto, Suharsini.2006. Procedure Penelitian Suatu Pendekatan Praktek, PT.
Rineka Cipta, Jakarta.
Brown, H. Douglas1980. Principles of Language Learning and Teaching. New
Jersey: Prentice-Hall, Inc.
Brown, H. D, 2001. Teaching by principles: An Interactive Approuch to
Language Pedagogy. Second Edition, San Francisco State University.
Brown, H. Douglass. 2004. Language Assessment Principle And Classroom
Practice . San Frasisco: Longman.
Byrne, donn. 1997. Teaching Writing skills. New York: longman, Inc.
Byrne, Donn.1997. Teaching Writing Skill. London: Longman Group UK.
Derewianka, B.Exploring How Texts Work.1990. Sydney: Primery Teaching.
Association.
Depdiknas. 2006. Permendinas RI No 22 Tahun 2006 Tetang Standar Isi. Jakarta:
BSNP
Djiwandono, M. S. 1996. Tes Bahasa Dalam Pengajaran. Bandung: ITB.
91
Fauziati, Endang. 2009. Reading on Applied Linguistics: A Handbook for
Language Teacher and Teacher Researcher. Surakarta: Era Pustaka.
Gerot, linda and Wignell, Peter. 1994. Making Sense of functional Grammar.
Sydney: GerdStabler.
Harmer, Jeremy. 1998.How to Teach English: an introduction to the practice of
English Language Teaching. England: addison Weslay longman limited.
Harmer. 2004. How to Teach Writing. England: Addison Wesley Longman
Limited.
Harris, John. 1993. Introduction Writing London: Allen and Unwinx.
Hornby, A. S.1995.oxford advanced Learners’ Dictionary of Current English,
Huberman, A. M. Miles M. B. 1984. Data Management and analysis Method. In
Prof. Dr Emzir, M.Pd. Methode Penelitian Kualitatif : Analysis Data.
Jakarta: PT Rajagrafindo Persada.
Hughes, A. 2003. Testing For Language Teacher. (Second Edition). New York:
Cambridge University.
Hyland, Ken, Genre and Second Language Writing, (London: University of
Michigan Press,2004).
Mark, Joy, Cathy, Ann. 1997. Text, Role and Context. Australia: Cambridge
University Press.
Moleong, Lexy J. 1990. Metodology Penelitian Kualitatif. Bandung:PT Remaja
Rosdakarya.
92
Nunan, David. 1998. Designing Task for the Communicative Classroom. Boston:
Heile & Heinle Publishers.
(Oxford : Oxford Uneversity Press, 1974).
Oxford Learner’s Pocket Dictionarry : third Editing.2003, Oxford: Oxford
University Press.
Oxford Advanced learner’s Pocket Dictionary.2008, Oxford: Oxford University
Press.
Oshima, A. and A.Hogue.1977.Introduction to Academic Writing (2nd Ed). New
York: Pearson Education.
Ricards, J.C., and W.A. Renandya. 2002. Methodology in Language Teaching:
Anthology of Current Practice Cambridge: Cambridge Uneversity Press.
Sugiyono, Memahami Penelitian Kualitatif, (Bandung:Alfabeta,2008)4th Ed.
93
APPENDICES
94
SILABUS PEMBELAJARAN
Sekola :MTsNegeriBekonang
Kelas : VIII ( Delapan )
Mata Pelajaran : BAHASA INGGRIS
Semester : Gasal
StandarKompetensi : 6. Menulis
Mengungkapkanmaknadalamtekstulisfungsionaldaneseipendeksederhanaberbentuk descriptive texts.
KompetisDasar MateriDasar
Pembelajaran Penilaian AlokasiWaktu SumberBelajar
1.1 Mensyukuri Teks deskriptif
Mengamati Kriteria penilaian: Audio CD/
kesempatan lisan dan tulis, VCD/DVD
dapat sederhana, Siswa memperhatikan / Pencapaian fungsi 9 x 2 JP
mempelajari tentang orang, menonton beberapa contoh sosial SUARA GURU
bahasa Inggris tempat wisata,
teks/ filmtentang Kelengkapan dan Koran/ majalah
penggambaran orang, keruntutan struktur
sebagai bahasa dan bangunan berbahasa Inggris
tempat wisata, dan teksdeskriptif
pengantar bersejarah bangunan bersejarah. Ketepatan unsur www.dailyenglish.
95
komunikasi terkenal Siswa menirukan contoh kebahasaan: tata com
internasional secara terbimbing. bahasa, kosa kata,
Fungsi sosial http://americaneng
yang ucapan, tekanan
Siswa belajar menemukan kata, intonasi,
lish.state.gov/files/
diwujudkan Membanggakan gagasan pokok, informasi ae/resource_files
ejaan, dan tulisan
dalam semangat , mengenalkan, rinci dan informasi tertentu tangan http://learnenglish.
belajar dari teks
mengidentifikas Kesesuaian format britishcouncil.org/
i, memuji, Mempertanyakan penulisan/ en/
2.3 penyampaian
mengritik, (questioning)
Menunjukkanka
mempromosika
n perilaku Dengan bimbingan dan Unjuk kerja
n, dsb.
tanggung jawab, arahan guru, siswa
Struktur text mempertanyakan antara lain Melakukan
peduli, monolog tentang
perbedaan antar berbagai
kerjasama, dan (1) Penyebutan deskripsi orang,
teks deskripsi yang ada
cinta damai, nama orang, dalam bahasa Inggris, tempatwisata,
dalam tempat perbedaan teks dalam bahasa bangunanbersejara
melaksanakan wisata, dan Inggris dengan yang ada hterkenaldidepan
komunikasi bangunan dalam bahasa Indonesia kelas / berpasangan
bersejarah
Ketepatan dan
terkenal dan Siswa mempertanyakan
fungsional
3.7. Menganalisis nama gagasan pokok, informasi kesesuaian
fungsi sosial, rinci dan informasi tertentu dalammenggunaka
bagian-
struktur teks, dari teks deskriptif n strukturteks dan
bagiannya
dan unsur unsur kebahasaan
yang dipilih Mengeksplorasi
kebahasaan pada dalam membuat
untuk
teks deskriptif
teks deskriptif dideskripsika Siswa secara kelompok
sederhana n membacakan teks deskriptif Pengamatan
tentang orang, (2) Penyebutan lain dari berbagai sumber (observations):
tempat wisata, sifat orang, dengan pengucapan, tekanan
dan bangunan tempat kata dan intonasi yang tepat Bukan penilaian
96
bersejarah wisata, dan Siswa berpasangan formal seperti tes,
terkenal, sesuai bangunan menemukan gagasan pokok, tetapi untuk tujuan
dengan konteks bersejarah informasi rinci dan memberi
penggunaannya. terkenal dan informasi tertentu balikan.Sasaranpenilai
bagiannya, sertafungsisosial dari teks
4.8. Menangkap an
dan deskripsi yang
makna dalam Perilaku tanggung
(3) Penyebutan dibaca/didengar.
teks deskriptif jawab, peduli,
tindakan dari
lisan dan tulis
atau terkait Siswamenyuntingteksdeskri kerjasama, dan
sederhana. psi yang diberikan guru cinta damai, dalam
dengan
4.9. Menyunting teks orang, darisegistrukturdankebahasa melaksanakan
deskriptif lisan tempat an Komunikasi
dan tulis, wisata, dan Berkelompok, siswa Ketepatan dan
sederhana, bangunan menggambarkan tempat kesesuaian dalam
tentang orang, bersejarah wisata lain dalam konteks menyampaikan dan
tempatwisata, terkenal. penyampaian informasi yang menulis teks
danbangunanber wajar terkait dengan tujuan deskriptif
yang semuanya
sejarahterkenal, yang hendak dicapai dari
dengan sesuai dengan
model yang dipelajari Kesungguhan
memperhatikan fungsi sosial siswa dalam proses
fungsi sosial, yang hendak Mengasosiasi pembelajaran
struktur teks, dicapai. Dalam kerja kelompok dalam setiap
dan unsur terbimbing siswa tahapan
kebahasaan yang Unsur menganalisis dengan Ketepatan dan
benar dan sesuai kebahasaan membandingkan berbagai kesesuaian
konteks. teks yang menggambarkan
(1) Kata benda menggunakan
4.10. Menyusun yang terkait orang, tempat wisata, strategi dalam
teks deskriptif dengan bangunanan bersejarah membaca
lisan dan tulis orang, terkenal dengan fokus pada
struktur teks, dan unsur Portofolio
sederhana tempat
97
tentang orang, wisata, dan kebahasaan. Kumpulan catatan
tempat wisata, bangunan kemajuan belajar
Siswa mengelompokkan
dan bangunan bersejarah berupa catatan
teksdeskripsisesuaidenganf
bersejarah terkenal atau rekaman
ungsisosialnya.
terkenal, (2) Kata sifat monologteksdeskri
dengan yang terkait Siswa memperoleh balikan ptif.
memperhatikan dengan (feedback) dari guru dan
tujuan, struktur orang, Kumpulan karya
teman tentang setiap yang
teks, dan unsur tempat siswa yang
dia sampaikan dalam kerja
kebahasaan, wisata, dan mendukung proses
kelompok.
secara benar bangunan penulisan teks
dan sesuai bersejarah diskriptif berupa:
dengan terkenal draft, revisi,
Mengkomunikasikan editing sampai
konteks. (3) Ejaan dan
tulisan Berkelompok, siswa hasil terbaik untuk
. menyusun teks deskripsi dipublikasi
tangan dan c
etak yang tentang orang/ tempat Kumpulan hasil
jelas dan rapi wisata/ bangunan bersejarah tes dan latihan.
(4) Ucapan, sesuai dengan fungsi sosial
tekanan kata, tujuan, struktur dan unsur Catatan atau
intonasi, kebahasaannya rekaman penilaian
ketika diri dan penilaian
Siswamenyuntingdeskripsi sejawat, berupa
mempresenta yang dibuatteman.
sikan secara komentar atau cara
lisan. Siswa penilaian lainnya
(5) Rujukan kata menyampaikandeskripsinya Penilaian Diri dan
didepan guru dan teman Penilaian Sejawat
Topik
danmempublikasikannya di
Keteladanan mading. Bentuk: diary,
jurnal, format
tentang perilaku Siswa membuat kliping
khusus, komentar,
98
toleran, deskripsitentang orang, atau bentuk
kewirausahaan, tempat wisata atau penilaian lain
nasionalisme, bangunan bersejarah yang
mereka sukai.
percaya diri.
Siswa membuat laporan
evaluasi diri secara tertulis
tentang pengalaman dalam
menggambarkan tempat
wisata dan bangunan
termasuk menyebutkan
dukungan dan kendala yang
dialami.
Siswa dapat menggunakan
„learning journal‟
99
RENCANA PELAKSANAAN PEMBELAJARAN
(RPP)
NamaSekolah : MAN 2 Boyolali
Mata Pelajaran : BahasaInggris
Kelas / Semester :X/1
MateriPembelajaran : Descriptive
Tema : Descriptive Thing, Person, Place
Skill : Writing
AlokasiWaktu : 2 X 45Menit
A. KompetensiInti :
KI 1: Menghayati dan mengamalkan ajaran agama yang dianutnya.
KI 2: Menghayati dan mengamalkan perilaku jujur, disiplin, tanggung jawab,
peduli (gotong royong, kerjasama, toleran, damai), santun, responsif dan
pro-aktif dan menunjukan sikap sebagai bagian dari solusi atas berbagai
permasalahan dalam berinteraksi secara efektif dengan lingkungan sosial dan
alam serta dalam menempatkan diri sebagai cerminan bangsa dalam
pergaulan dunia.
KI 3: Memahami, menerapkan, menganalisis pengetahuan faktual, konseptual,
prosedural dan metakognitif berdasarkan rasa ingin tahunya tentang ilmu
pengetahuan, teknologi, seni, budaya, dan humaniora dengan wawasan
kemanusiaan, kebangsaan, kenegaraan, dan peradaban terkait penyebab
fenomena dan kejadian, serta menerapkan pengetahuan prosedural pada
bidang kajian yang spesifik sesuai dengan bakat dan minatnya untuk
memecahkan masalah.
KI 4: Mengolah, menalar, dan menyaji dalam ranah konkret dan ranah abstrak
terkait dengan pengembangan dari yang dipelajarinya di sekolah secara
mandiri, bertindak secara efektif dan kreatif, serta mampu menggunakan
metoda sesuai kaidah keilmuan.
B. Kompetensi Dasar :
KompetensiDasar Indikator Pencapaian
Kompetensi
1.1. Mensyukuri kesempatan dapat mempelajari
bahasa Inggris sebagai bahasa pengantar
komunikasi internasional yang diwujudkan
dalam semangat belajar
100
2.2 Menunjukkan perilaku jujur, disiplin,
percaya diri, dan bertanggung jawab
dalam melaksanakan komunikasi
transaksional dengan guru dan teman.
3.3 Menganalisisfungsisosial, strukturteks, 3.3.1 Mengidentifikasitujuant
danunsurkebahasaanpadaDescriptiveText,s eks padaDescriptive
esuaidengankontekspenggunaannya. Textsecara kontekstual.
3.3.2 Mengidentifikasistruktur
teks padaDescriptive
Text.
3.3.3 Mengidentifikasiunsurke
bahasaanDescriptive
Text.
3.3.4 Menjawabpertanyaanten
tang Descriptive Text
dari audio yang di
dengarkan.
4.3 Mendengarkan dan Menjawab 4.3.1 Menjawabpertanyaante
pertanyaantentangDescriptive ntang Descriptive Text
Text,sesuaidengankontekspenggunaannya. dari sebuah teks
denganmemperhatikanfungsisosial, monologue atau short
strukturteks, danunsurkebahasaan, yang conversation dari audio
benardansesuaikontekspenggunaannya. yang di dengarkan
sesuaikontekspengguna
annya.
C. Tujuan Pembelajaran
Setelah mengikuti serangkaian kegiatan pembelajaran peserta didik dapat:
1. Mengidentifikasi tujuan teks Descriptive Text.
2. Mengidentifikasi struktur teks Descriptive Text.
3. Mengidentifikasi unsur kebahasaanDescriptive Text.
4. Mendengar dan menjawab pertanyaan tentang teksDescriptive Text dari audio
yang didengarkan.
5. Mendengar dan menjawab pertanyaan tentang teksDescriptive Text dari sebuah
teks monologue atau short conversation dari audio yang didengarkan.
D. Materi Pembelajaran
Teks tulis menunjukkanDescriptive Text.
a) Definition of Descriptive Text:
Descriptive Text
Descriptive text or description is a kind of text functions to describe a
particular person, place, animal or thing.
Generic Structure
- Identification, identifying the phenomenon to be described
101
- Description, Describing the phenomenon in parts, Qualities, or/and
Characteristics.
The Laguage of Features
Use of simple present tense.
(S + am/is/are + P) or (S + V1(+s/es))
Use of linking verb (kata kerjapenghubung) like ; is, are, appear,
feel, grow, look, prove, remain, smell, sound, taste, and turn. Ex:
He is handsome; It smell nice; The song sounds beautiful; etc.
To describe things or noun, we use adjective can be in the form of
adjective clauses.
Adjective is used to describe noun (things and people)
For example:
An old car
A beautiful girl
A rich businesswoman
A red chair
A flowery shirt
Adjective clauses ORDER:
DETER OPINION SIZE AGE SHAPE COLOR ORIGIN MATE NOUN
MINER RIAL
The wonderful small old Round green German wooden vase
A Beautiful large new red Indonesian cotton skirt
SIZE : big, small, little, huge, midle,
SHAPE : round, oval, regtangular, square
CONDITION : smooth, hard
AGE : old, modern, ancient
COLOR : red, yellow, blue, green
ORIGIN : germany, american
MATERIAL : wooden, metal, iron, paper
PATTERN : checked, flowery, spotted, striped, etc.
OPINION : beautiful, wonderful,expensive, cheap,etc
102
Contoh Descriptive Text
Example of Describing Things
My Doll
My favorite toy is a doll. I named my doll Becky. I got in in my 12th
birthday. My dad bought it for me when he was in England.
Becky is 16 cm tall doll with plastic head, arms, and legs and a white cloth
stuffed body. Her body is covered with yellow, orange, and green flower bud
prints. She has a long auburn-red brush-able hair, blue eye. There are freckles on
her cheek. There are also two dimples near her mouth on the left and on the right.
They make her more beautiful. I put her at my side when I sleep at night.
I like my doll very much. I sometimes ask my friends to come to my house
and play with Becky. They like Becky too.
EXERCISE
LISTENING SECTION
In this section of the test, you will have an opportunity to demonstrate
your ability to understand conversations and talks in English. There isone part to
this section. Answer all the questions on the basis of what is stated by the
speakers you hear. Do not take notes or write in your test book at any time. Do not
turn the pages until you are told to do so.
PART A
Directions: In this part A you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
103
test book, so you must listen carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.
The dialogue to answer question number 1 until 5.
Dialog 1
Umma : Hello Fuad. You look great? What is wrong?
Fuad : My uncle bought me a new bag yesterday, when I win the speech contest.
The color is blue. Can for a place to books, laptop, and writting tools.
Umma : Wow.congratulations Fuad.
Fuad : Thank you.
1. What is the dialogue about?
a. Narative Text
b. Recount Tex
c. Describtive Text
d. Report Text
2. Why Fuad bought a new bag?
a. Get a good mark
b. Happy birthday
c. Happy wedding
d. The win of speech contest
3. Who is bought Fuad‟s new bag?
a. Umma
b. Umi
c. Father
d. uncle
4. What is the color Fuad‟s new bag?
a. black
b. blue
c. with
d. red
5. What is the function those bag?
a. Place a books, laptop, and raiting tools.
b. Place a books
c. Place a laptop
d. Place a raiting tools.
Funsisosial :
Menjagahubungan interpersonal dengan guru, teman, dan orang lain.
UnsurKebahasaan :
a. Kosa kata terkaittempat, barang, orang.
b. Frasa nominal denganadjective:Adjective is used to describe noun (things and
people)
104
For example:
An old car
A beautiful girl
A rich businesswoman
A red chair
A flowery shirt
c. Ucapan, tekanan kata, intonasi
d. Ejaandantandabaca
e. Tulisantangan
Topik :
Descriptive Thingsyang seringdigunakandalamkehidupansehari – hari.
Fakta :
Descriptive Textadalah ungkapan yang sering digunankan dalam kehidupan
sehari hari.
Konsep:
Descriptive
Textmerupakanperwujudanperhatianuntukfungsisosialmenjagahubungan
interpersonal dengan guru, temandan orang lain
Prinsip
Struktur teks
Use of simple present tense.
(S + am/is/are + P) or (S + V1(+s/es))
Unsur kebahasaan
1. Kata terkaitdenganhubungankekeluargaandankekerabatan.
2. Ucapan, tekanan kata, intonasi, ejaan, tulisantangan yang rapi.
3. Rujukan kata
Prosedur:
Descriptive
Textdisusundenganmemperhatikanstrukturdanbentukbahasasesuaidengankonte
ksnya.
105
E. MetodePembelajaran:
Pendekatan : Scientifik approach
Metode : Communicative Language Teaching
F. Media, Sumber Pembelajaran:
1. Media : Laptop, LCD, Loudspeaker, Picture, Power Point, whiteboar and
boardmarker
2. Sumber :
Buku Guru B. Inggris SMA/SMK Kls X
G. Langkah-langkahPembelajaran :
1. KegiatanPendahuluan
a. Guru memberi salam
b. Berdoa bersama-sama sebelum pelajaran dimulai
c. Guru memeriksa kehadiran siswanya.
d. Guru memberi motivasi belajar siswa sesuai manfaat dan aplikasi materi ajar
dalam kehidupan sehari-hari.
e. Guru mengajukan pertanyaan antara pengetahuan sebelumnya dengan materi
yang akan di pelajari.
f. Guru menjelaskantujuanpembelajaranataukompetensidasar yang
akandicapai.
g. Guru menyampaikan cakupan materi dan uraian kegiatan.
2. Kegiatan Inti
a.) Mengamati (Observing)
1) Peserta didik Mengamati Gambar yang disajikan oleh guru
2) Dengan bimbingan dan arahan guru,peserta didik mengidentifikasi isi
Gambar dan menghubungkannya dengan Descriptive Things
b.) Menanya (Questioning)
1.) Dengan pengarahan guru, peserta didik menanyakan tetang fungsi sosial,
struktur teks, dan unsur kebahasaan dari Descriptive Things
2.) Peserta didik memperoleh pengetahuan tambahan tentang Descriptive
Things, fungsi sosial, struktur teks, dan unsur kebahasaan.
c.) Mencoba (Eksploring)
1.) Peserta didik menjawab pertanyaan dari teks Descriptive Things.
2.) Peserta didik juga diharapkan bisa membuat kalimat Descriptive Things
d.) Menalar (associating)
1.) Dengan bimbingan guru, peserta didik menjawab pertanyaan terkait isi
teks Descriptive Things.
2.) Peserta didik mendapat balikan (feedback) dari guru atau teman yang
lainya tentang setiap yang dia sampaikan dalam diskusi.
e.) Mengkomunikasikan (communicating)
1.) Peserta didik mempresentasikan hasil dari pekerjaan menjawab teks
Descriptive Thingstersebut.
2.) Peserta didik memperoleh balikan (feedback) dari guru dan teman
tentang hasil pekerjaan yang telah dipresentasikan.
3. Penutup
a. Guru memberikanumpanbalikterhadap proses danhasilpembelajaran;
b. Guru bersama –samadenganpesertadidikmenyimpulkanpembelajaran
c. Berdoa bersama-sama membaca hamdallah selesai pelajaran
106
d. Guru memberi salam penutup.
e.
H. Evaluasi
LISTENING SECTION
In this section of the test, you will have an opportunity to demonstrate
your ability to understand conversations and talks in English. There are four parts
to this section. Answer all the questions on the basis of what is stated by the
speakers you hear. Do not take notes or write in your test book at any time. Do not
turn the pages until you are told to do so.
PART A
Directions: In this part A you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.
The dialogue to answer number 1 until 5.
Dialogue 1
Qoyyimah : Hendra. What is your favorite toys?
Hendra : My favorite toy is a doll. I named my doll Juwita. I got in my
eighth birthday. My dad bought it for me when he was in England. Becky is 16
cm tall doll with plastic head, arms, and legs and a white cloth stuffed body. Her
body is covered with yellow, orange, and green flower bud prints. She has a long
auburn-red brush-able hair, blue eye. I like my doll.
1. What is the dialogue about?
a. Narrative Text
b. Recount Tex
c. Describtive Text
d. Report Text
2. What is favorite toy‟s Hendra?
a. Car
b. Robot
c. Doll
d. Play station
3. What is color hendra‟s doll?
a. Yellow
b. Red
c. Pink
107
d. Blue
4. What is color hendra‟s eye doll?
a. Yellow eye
b. Red eye
c. Pink eye
d. Blue eye
5. Does Hendra love his doll?
a. Yes, he do
b. Yes, he does
c. No, he do not
d. No, he does not
PART B
Directions: In this part B you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.
The dialogue to answer number 6 until 8.
Ainun : Fadhil. What‟s wrong? You look like sad.
Fadhil : my wallet is lost. The color is pink. It Has two pockets.
Ainun : I‟m sorry to hear that.
6. Why fadhil look like sad?
a. His wallet was lost
b. His wallet were lost
c. His wallet are lost
d. His wallet is lost
7. What is the color Fadhil‟s wallet?
a. Brown
b. Black
c. Blue
d. Pink
8. Who lost his wallet?
a. Fuad
b. Hainun
c. Fadhil
d. Hendra
PART C
Directions: In this part C you will hear short conversations between two people.
After each conversation, you will hear a question about the conversation. The
conversation and questions will be spoken twice. They will not be printed in your
108
test book, so you must listen be carefully to understand what the speakers are say.
After you hear a question, and then answers in your test book and choose the best
answer to each question.
The Dialogue to answer number 9 until 13.
Muhajir: Can you describe your necklace?
Zuzun : I got my necklace from my boyfriend. Silver colors. There is a love-
shaped pendant. I always wear it.
Muhajir : it‟s wonderfull.
9. What the dialogue tells about?
a. Describing things
b. Describing people
c. Describing animal
d. Describing place
10. What the dialogue discribe about?
a. Bracelate
b. Necklace
c. Diamond
d. Ring
11. Who has own the necklace?
a. Niken
b. Ninda
c. Zuzun
d. Sri
12. Does she always wear it?
a. No, She does not
b. No, She do not
c. Yes, She does
d. Yes, She do
13. What color of Zuzun‟s necklace?
a. Gold
b. White
c. Blue
d. Silver
PART D
Directions: In this part D you will hear a Text about Descriptive Text. Each a
Text about Descritive Things will be sopken two times. They will not be printed
in your test book, so you must listen be carefully to understand what the speakers
say. After you hear a Text about Descritive Things and please answer fill in the
blank in the text.
The text to answer number 14 until 20.
109
Guitar
My most valuable possession is (14)......, slightly warped blond guitar--the
first (15)........taught me how to play.
It's nothing fancy, just a Madeira folk guitar, all scuffed and scratched and
finger-printed. At the top is a bramble of copper-wound strings, each one hooked
through the eye of a (16)........ tuning key.
The body of the Madeira is shaped like an enormous
(17)......... pear, one that was slightly damaged in shipping. The blond
wood has been (18).....
No, it's not (19)......... instrument, but it still lets me make music, and for
that I will always (20).......... it.
1. Aspek – aspek Penilaian SikapSosial, Pengetahuan,dan Ketrampilan.
a. AspekSikap Sosial
1.) Teknik Penilaian : Pengamatan
2.) Bentuk Instrument : Uraian bebas
3.) Indikator
a.) Indikator Sikap Sosial JUJUR.
Tidak menyontek dalam mengerjakan ujian/ulangan
Tidak menjadi plagiat (mengambil/menyalin karya orang lain tanpa
menyebutkan sumber)
Mengungkapkan perasaan apa adanya
b.) Indikator sikap sosial PERCAYA DIRI;
Berpendapat atau melakukan kegiatan tanpa ragu-ragu
Berani presentasidideoan kelas
Berani berpendapat, bertanya, atau menjawab pertanyaan.
c.) Indikator sikap sosial BERTANGGUNG JAWAB:
Melaksanakan tugas individu dengan baik
Melaksanakan kerja sama(kelompok dengan baik)
Menerima resiko dan tindakan yang dilakukan
110
d.) Indikator sikap DISIPLIN:
Datang tepat waktu
Patuh pada tata tertib atau peraturan bersama/sekolah.
Menegrjakan atau mengumpulkan tugas sesuai dengan waktu yang
ditentukan
4.) Pedoman Penskoran
Skor perolehan
NA = x4
Skor maksimal
Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap
Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1
b. Pengetahuan
1.) Tehnik Penilaian : Tes Tertulis
2.) Bentuk Instrument :
Mengidentifikasi isi Teks Descriptive Things
Menjawab pertanyaan dari teks Descriptive Things
3.) Kisi-kisi
No Indikator ButirInstrumen
1 SiswaterampilMengidentifikasi dan menjawab 2
pertanyaan dariteksDescriptive Things
4.) Pedoman Penskoran
Skor perolehan
NA = x4
Skor maksimal
111
Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap
Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1
c. Ketrampilan
1.) Tehnik Penilaian : Unjuk Kerja
2.) Bentuk Instrumen :
3.) Tes Ketrampilan membuat teks Descriptive Things
4.) Kisi-kisi
No Indikator ButirInstrumen
1. Siswaterampilmembuat teks Descriptive 1
Things.
5.) Pedoman Penskoran
Skor perolehan
NA = x4
Skor maksimal
112
Konvesri Kompetensi Pengetahuan, Ketrampilan dan Sikap
Predikat NilaiKompetensi
Pengetahuan Ketrampilan Sikap
A 4 4 SB
A- 3.66 3.66
B+ 3.66 3.66 B
B 3 3
B- 2.66 2.66
C+ 2.33 2.33 C
C 2 2
C- 1.66 1.66
D+ 1.33 1.33 K
D- 1 1
2. Kolom Penilaian
a.) Rubik Penilaian Sikap
No Nama Aspek Penilaian Sikap Total
Siswa Jujur Percaya Tanggung Disiplin Skor
Diri Jawab
1
2
3
4
5
b.) Rubik Penilaian Pengetahuan
No Nama AspekPenilaian Ketrampilan Total Skor
Siswa Benar Salah
1
2
3
4
5
113
c.) Rubik Penilaian Ketrampilan
No Nama AspekPenilaian Ketrampilan Total Skor
Siswa Benar Salah
1
2
3
4
5
Simo, 3 Desember2016
Kepala Sekolah MAN 2 Boyolali Guru Mata Pelajaran
Drs. H. Mahsun Alwa’id, M.Ag Rining Pangastuti,S.Pd.I
NIP : 19661103 199203 1 006
114
The Students Data of XIPS2 Class of MAN 2 Boyolali in the Academic Year
2016/2017
No Name Class
1 A ZainalMa‟ruf XIPS2
2 Ainunnisa Farah XIPS2
3 AldiHidayat XIPS2
4 Andriya Elisa Warda XIPS2
5 ArvianAdi s XIPS2
6 Dina Septika Sari XIPS2
7 Febri Dian Mayasari XIPS2
8 HappytaQurrota A XIPS2
9 Hastutik XIPS2
10 IinNurSafrina XIPS2
11 JovikaRamadhani XIPS2
12 LailatulMukarromah XIPS2
13 LiaRatnaDewi XIPS2
14 M. FahrurRohmanFauzi XIPS2
15 Muh. Nurrodin XIPS2
16 Muhammad Anang M XIPS2
17 Muhammad Yoga A XIPS2
18 NihayatulKhusna XIPS2
19 NisaMaulianaJari XIPS2
20 OktaviaNingrum XIPS2
21 PutriRahmawati XIPS2
22 SyafiraJihanKamila XIPS2
23 Syaifullah XIPS2
24 UnikPuji L XIPS2
25 UswatunChasanah XIPS2
26 Wahyuana A. M XIPS2
27 Yudistira XIPS2
115
INTERVIEW WITH TEACHER
Judul : Wawancaramengenaipembelajaranbahasainggris
Tempat : Ruang Guru MAN 2 Boyolali
Waktu : 18 Januari 2016
Researcher :“beberapapekaninikansayasudah di kelas XIPS2 yabu,
bagaimanaibumengajar writing/
menulisdalammatapelajaranbahasaInggrisbu?”
IbuRinning :“Yakalaumengajar writing di siniituagakkesulitanya mas,
makanyabiasanyasayapakai mapping, mapping
itusepertiklu;kludalam writing, andaikankitamengajar writing
contohnyadescriptivekan? Andaikan di situ Prambana Temple
jenengansudahadamappingnya, kalau place berarti kata kataini
yang di gunakanharusada, kalau person jugabegitu, kalukelas 10
itumenulismemangcukupsulitgitu, berartisayapakai mapping.”
Researcher :“kalau mapping ituapakahcara-caramenulisataulangkah-
langkah?”
IbuRinning :“Kalau mapping itulangkah-langkahnya,
kalaucaramenulisitukanCumakaludescriptiitupakau past tense
tapikalaulangkah- langkahkanlangsungjelas, semumpama
descriptiveituadaidentivikationnya,
setelahitudescriptivicationnya, berartitinggalcarikira-kira kata-
kata mana yang digunakanuntukidentivicatin, mana yang
buatmendescripsikan, itusudah di mappiingkansecarajelasdulu,
karenainimasihkelassepuluh,
kecualisudahkelasebelasataunantikelas du
belasmungkinbisalangsungtanpa mapping.
Researcher :“owyaibu, hlakemarinkansiswasudahmenulis descriptive
mengenai orang, barang, maupuntempatyabu, beberapasiswa
yang
sayawawancaraiitukesulitandalammenulisbahasainggrisituadala
116
hmenyusunkalimatdan kata-kata yang susah,
caraibuuntukmengatasihaltersebutdenganapa?
IbuRinning :“hlaw yam as, makanyasayamengajarkannyadengancara
mapping itu, jadi kaya tinggalmenggabungkan kata
inidenganinidanseterusnya, karenamasihkelassepuluh.”
Researcher :“kalauibumewajibkandalampelajaranmemakaikamustidakibu?”
IbuRinning :”yaharus, kalaubahasainggrisharuspakaikamus, rencanamulai
semester depanitudarisiswasetiappekannyahafalan5 kosa-kata,
karenabiarlebihbanyaktautentangvocabularynya.”
Researcher : “berartisetiapsiswawajibbawakamuyaibu?”
IbuRinning :”ya mas,
setidaknyasatumejaadasatukamuskalutidaksyasuruhkeluar mas,
biarbawakamusitusebagaikewajiban.
Researcher : “mungkincukupitubudari interview saya,
terimakasihsebelumnya”
IbuRinning : “yam as, sama-sama.”
117
INTERVIEW WITH THE STUDENTS
Judul : Wawancara mengenai kesulitan siswa
Tempat : Ruang kelas XIPS2 MAN 2 Boyolali
Waktu : 18 Januari 2016
Name: Aldi
Researcher : “menurutmu bahasa inggris itu gimana dek?”
Student : “gampang-gampang susah”
Researcher : “gampangnya bahasa inggris dimana dek?”
Student :”kalau tau artinya”
Researcher : “kalau pengajaran bu Rinnging Sepertiapa”
Student :”ceramah”
Researcher : “kalau menulis descriptive text kemarin gimana?
Student :”agaksusah”
Researcher : “susahnya dimana?”
Student :”mengartikan”
Researcher : “caramengatasi kesulitannya dengan apa?”
Student :”melihat kamus dan Tanya guru”
Researcher : “apa bu Rinning mewajibkan pakai kamus?”
Student : “wajib, kalu tidak ada hukuman”
Nama :Jovika
Researcher : menurutmu bahasa inggris itu gimana dek?
Student :”seru”
118
Researcher : “Serunya dimana ini?”
Student :”yak arena bahasa Asing”
Researcher : “kalau menulis descriptive texs kemarin gimana?”
Student :”gampang”
Researcher : “gampangnya gimana?”
Student :”ya karena bisa”
Researcher : “kalau pengajaran bu Rinning bagaimana?”
Student :””enak”
Researcher : “kalau kesulitan dalam bahasa inggris biasanya ngapain?”
Student : “buka kamus”
Nama :Lia
Researcher : “menurutmu bahasa inggris itu gimana dek?”
Student : “gak enak, Sulit”
Researcher : “kesulitannya dimana bahasa inggris itu?”
Student : “mengartikan, menyusun kalimatnya.”
Researcher : “cara mengatasi kesulitan itu biasanya ngapain dek?”
Student : “belajar, buka kamus, Tanya teman-teman.”
Researcher : “tapi nilai menulis descriptive kemarin bagus, gimana caranya?”
Student :”Belajar, kan itu dah pernah di ajarkan jadi tau. Cuma hafalin
saja.”
Researcher : “kalau pengajaran bu Rinning dalam bahasa inggris gimana dek?”
Student :”bu Rinning, enak sih, tapi susah di mengerti”
119
Nama :Yoga
Researcher : menurutmu bahasa inggris itu gimana dek?
Student :”menyenangkan tapi sulit”
Researcher : “kalau pembelajaran bu Rinning bagaimana menurutmu?”
Student :”jelas kurang seru”
Researcher : “kalau menulis descriptive text kemarin gimana?”
Student : “Susah-susah gampang”
Researcher : “Susahnya dimana?”
Student :dalam mengartikan”
Researcher : “hlaw kalau susah mengartikan biasanya biar tau bagaimana?”
Student :buka kamus, Tanya teman dan guru”
Nama :Hapyta
Researcher : menurutmu bahasa inggris itu gimana dek?
Student :”asyik, soalnya bahasa asing tapi agak sulit”
Researcher : “susahnya dimana ini?”
Student :”menyusun kalimat”
Researcher : “kalau menulis descriptive texts kemarin gimana?”
Student :”gampang-gampang susah”
Researcher : “susahnya dimana?”
Student :”kalimat yang jarang di baca”
Researcher : “cara mengatasinya gmana?”
Student :”Tanya temandan guru”
Researcher : “kalau pengajaran bur inning gimana?”
Student :”sebenere enak tapi agak tegang”
120
Nama :Iin
Researcher : “menurutmu bahasa inggris itu gimana dek?”
Student :”enak, mudah”
Researcher : “Enaknya dimana dek?
Student :”bahasa asing mudah di cermati”
Researcher : “kalau pembelajaran bu Rinning Bagaimana?
Student :”jelas, enak, menyenangkan”
Researcher : “kalau menulis kemarin ada kesulitan tidak?”
Student :”sedikit”
Researcher : “kesulitannya dimana dek?”
Student :”mengartikannya”
Researcher : “cara mengatasi hal tersebut dengan apa?”
Student :”buka kamus”
Nama :Unik
Researcher : menurutmu bahasa inggris itu gimana dek?
Student :”senang, bikin happy, tidak membosankan, lucu”
Researcher : “ada kesuliatan tidak dek?”
Student :”ada, di cara menulis dan mengartikan”
Researcher : “cara mengatasinya gmana?”
Student :”lebih giat dalam belajar”
Researcher : “kalau pembelajaran Bu Rinning gimana dek?”
Student :lebih rincidan dapat di pahami
Researcher : kalau menulis descriptive texts kemarin gimana?”
Student :“biasa saja tidak begitu sulit”
121
Nama :Oktavia
Researcher : “menurutmu bahasa inggris itu gimana dek?”
Student :”menyenangkan, bikins enang”
Researcher : “kalau menulis descriptive texts gimana dek?”
Student :”sulit, pengetahuan belum banyak”
Researcher : “kesulitannya dimana dek?”
Student :cara menulis dan mengartikan”
Researcher : “kalau pengajaran bu Rinning Gimana?”
Student :”mudah di mengerti dan di pahami”
Researcher : “cara mengatasi kesulitannya dalam bahasa inggris biasanya
ngapain?”
Student :“mencari di kamusdan Tanya-tanya”
Researcher : “apa pada saat pembelajaran bu Rinning, bawa KamusWajib?”
Student : “iya”
Nama :Andriya
Researcher : “menurutmu bahasa inggris itu gimana dek?”
Student :”susah”
Researcher : “susahnya dimna?”
Student :”mengartikan”
Researcher : “kalau menulis descriptive texs kemarin?”
Student :”susah”
Researcher : “susahnya sama dalam mengartikan?
122
”Student :“iya, mengartikan bahasa Indonesia kebahasa inggris dan
menyusun kalimatnya”
Researcher : “kalau pengajarannya bu rinning gimana?”
Student : “menyenangkan”
Researcher : “dalam pembelajarannya apa wajib bawa kamu?”
Student : “wajib pakai kamus”
Nama :Yudistira
Researcher : menurutmu bahasa inggris itu gimana dek?
Student :lumayan susah, lumayan gampang”
Researcher : “pembelajarannya bu Rinning gimana?”
Student : Bisa masuk”
Researcher : “kalau menulis Descriptive kemarin gimana?
Student :lumayan pusing bisa dikit”
Researcher : “kesulitannya dimana?”
Student :”mengartikan, menyusun kalimat”
Researcher : “hlaw nilai kamu pas menulis kemari jelek kenapa?”
Student :sudah bingung gak bisa mikir
Researcher : “cara mengatasi kesulitan gimana?”
Student : cari di kamusatau Tanya teman”
123
FIELD NOTE OBSERVATION
Day/Date : Wednesday, 16th November 2016
Time : 09.30 – 10.40
Teacher : Miss. Rinning
Description :
First observation here was pre-observation. It was done on16th November 2016.
The researcher observed the condition of class XIPS2 class. The material in the
first observation was descriptive text. The students‟ condition inXIPS2 class was
good. The students were serious in teaching learning process. In the teaching and
learning process, Miss. Rinning explained the material to the students. Then,
Miss. Rinning asked to the students active in teaching learning process. In
teaching learning process Miss. Rinning used opening, main activity and closing
as the agenda of teaching learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinning with the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.
b. Main activities
The teacher gave a material to the students. It was about descriptive text. Miss.
Rinning told the students about the materials. The students learned about reading
skill. In making the condition in the classroom more life, the teacher asked some
question to the students to make the students active in the class. Then, the teacher
asked to the students to read a story on their handbook. The students read the
text and translating the text. In translating the text the teacher asked the students
one by one. One students translated one sentence. The teacher also asked to
the students to underline the difficult word. This technique used to increasing
the students in vocabulary. In translating the text, the XIPS2 students was
enthusiasm, the students was immediately looking for the meaning of the
underline word in that text in dictionary. The students‟ response in teaching
learning process that day was good. There was feedback between teacher and
students.
c. Closing
The teacher reviewed some material that had discussed in the meeting, after
that the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
124
FIELD NOTE OBSERVATION
Day/Date : Wednesday, 23th November 2016
Time : 09.30 – 10.40
Teacher : Miss. Rinning
Description :
Second observation was done on 23th November 2016. The researcher observed
the condition of class XIPS2 class. The material is descriptive text. The
students‟ condition in XIPS2 class was very good. The students were
serious in teaching learning process. In the teaching and learning process, Miss.
Rinning explained the material to the students. Then, Miss. Rinning asked to
the students active in teaching learning process. In teaching learning process
Miss. Rinning used opening, main activity and closing as the agenda of teaching
learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good
morning. After that Miss. Rinning with the students pray by saying Basmallah
together and Miss. Rinningchecked students‟ attendance list.
b. Main activities
The teacher gave a material to the students. It was about descriptive text.
Miss. Rinning told the students about the materials. The students learned about
the organization of the descriptive text. In making the condition in the
classroom more life, the teacher asked some question to the students to
make the students active in the class. Then, the teacher asked to the
students to read a story on their handbook. The students read the text and
translating the text. In translating the text the teacher asked the students
one by one. One students translated one sentence. The teacher also asked to the
students to underline the difficult word. This technique used to increasing
the students in vocabulary. In translating the text, the XIPS2 students was
enthusiasm, the students was immediately looking for the meaning of the
underline wor in that text in dictionary. The students‟ response in teaching
learning process that day was good. There was feedback between teacher and
students.
c. Closing
The teacher reviewed some material that had discussed in the meeting, after
that the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
125
FIELD NOTE OBSERVATION
Day/Date : Wednesday, 30th November 2016
Time : 09.30 – 10.40
Teacher : Miss. Rinning
Description:
Third observation was done on 30th November 2016. The researcher observed the
condition of class XIPS2 class. The material was still descriptive text. The
students‟ condition inXIPS2 class was very good. The students were serious in
teaching learning process. In the teaching and learning process, Miss. Rinning
explained the material to the students. Then, Miss. Rinning asked to the students
active in teaching learning process. In teaching learning process Miss. Rinning
used opening, main activity and closing as the agenda of teaching learning
process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinning with the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.
b. Main activities
The teacher reviewed a material yesterday to the students. It was about
descriptive text. Then in this meeting Miss. Rinning told about using of Simple
Past Tense. In making the condition in the classroom more life, the teacher asked
some question to the students to make the students active in the class. Then the
teacher asked to the students to read a story on their handbook. The students read
the text and translating the text. In translating the text the teacher asked the
students about miss understanding sentence on the text. This technique used to
increasing the students in tenses. After that the teacher asked the students to make
some sentences in the form of Simple Past Tense, and asked the students to write
one by one on the whiteboard. The students‟ response in teaching learning
process that day was good. There was feedback between teacher and students.
c. Closing
The teacher reviewed some material that had discussed in the meeting,
then, the teacher gave a task to the students. After that, the teacher say
Hamdallah with the students as the sign the time in teaching learning
process was done.
126
FIELD NOTE OBSERVATION
Day/Date : Wednesday, 18thJanuary 2016
Time : 09.30 – 10.40
Teacher : Miss. Rinning
Description:
Fourth observation was done on15th January 2016. The researcher observed the
condition of class XIPS2 class. The material was still descriptive text. The
students‟ condition in XIPS2 class was very good. The students were serious in
teaching learning process. In the teaching and learning process, Miss. Rinning
explained the material to the students. Then, Miss. Rinning asked to the
students active in teaching learning process. In teaching learning process Miss.
Rinning used opening, main activity and closing as the agenda of teaching
learning process, as follows:
a. Opening
In opening section, Miss. Rinning opened the meeting by saying good morning.
After that Miss. Rinningwith the students pray by saying Basmallah together and
Miss. Rinning checked students‟ attendance list.
b. Main activities
The teacher reviewed a material yesterday to the students. It was about
descriptive text. Then, in this meeting Miss. Rinning teach in writing skill. In
making the condition in the classroom more life, the teacher asked some
question to the students to make the students active in the class. He asked about
the material yesterday. After that, Miss. Rinning asked the students to write
about descriptive text. He gave the topic about vacation.
c. Closing
The teacher asked the students to collect the text. The teacher reviewed some
material that had discussed in the meeting. After that, the teacher say Hamdallah
with the students as the sign the time in teaching learning process was done.
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147