Think Python
Think Python
ThinkPython/Printversion Preface
Chapter0:Preface
Thestrangehistoryofthisbook
(ThissectionwaswrittenbyAllenB.Downey[1]) InJanuary1999,IwaspreparingtoteachanintroductoryprogrammingclassinJava.IhadtaughtitthreetimesandIwasgettingfrustrated.Thefailurerate intheclasswastoohighand,evenforstudentswhosucceeded,theoveralllevelofachievementwastoolow. OneoftheproblemsIsawwasthebooks.Theyweretoobig,withtoomuchunnecessarydetailaboutJava,andnotenoughhighlevelguidanceabouthowto program.Andtheyallsufferedfromthe"trapdooreffect":theywouldstartouteasy,proceedgradually,andthensomewherearoundChapter5thebottom wouldfallout.Thestudentswouldgettoomuchnewmaterial,toofast,andIwouldspendtherestofthesemesterpickingupthepieces. Twoweeksbeforethefirstdayofclass,Idecidedtowritemyownbook. Mygoalswere: Keepitshort.Itisbetterforstudentstoread10pagesthanread50pages. Becarefulwithvocabulary.Itriedtominimizethejargonanddefineeachtermatfirstuse. Buildgradually.Toavoidtrapdoors,Itookthemostdifficulttopicsandsplitthemintoaseriesofsmallsteps. Focusonprogramming,nottheprogramminglanguage.IincludedtheminimumusefulsubsetofJavaandleftouttherest. Ineededatitle,soonawhimIchose HowtoThinkLikeaComputerScientist . Myfirstversionwasrough,butitworked.Studentsdidthereading,andtheyunderstoodenoughthatIcouldspendclasstimeonthehardtopics,the interestingtopicsand(mostimportant)lettingthestudentspractice. IreleasedthebookundertheGNUFreeDocumentationLicense,whichallowsuserstocopy,modify,anddistributethebook. Whathappenednextisthecoolpart.JeffElkner,ahighschoolteacherinVirginia,adoptedmybookandtranslateditintoPython.Hesentmeacopyofhis translation,andIhadtheunusualexperienceoflearningPythonbyreadingmyownbook. JeffandIrevisedthebook,incorporatedacasestudybyChrisMeyers,andin2001wereleased HowtoThinkLikeaComputerScientist:Learningwith Python,alsoundertheGNUFreeDocumentationLicense.AsGreenTeaPress,IpublishedthebookandstartedsellinghardcopiesthroughAmazon.comand collegebookstores.OtherbooksfromGreenTeaPressareavailableatgreenteapress.com(http://www.greenteapress.com/). In2003,IstartedteachingatOlinCollegeandIgottoteachPythonforthefirsttime.ThecontrastwithJavawasstriking.Studentsstruggledless,learned more,workedonmoreinterestingprojects,andgenerallyhadalotmorefun. OverthelastfiveyearsIhavecontinuedtodevelopthebook,correctingerrors,improvingsomeoftheexamplesandaddingmaterial,especiallyexercises.In
en.wikibooks.org/wiki/Think_Python/Print_version
1/282
10/24/13
OverthelastfiveyearsIhavecontinuedtodevelopthebook,correctingerrors,improvingsomeoftheexamplesandaddingmaterial,especiallyexercises.In 2008Istartedworkonamajorrevisionatthesametime,IwascontactedbyaneditoratCambridgeUniversityPresswhowasinterestedinpublishingthe nextedition.Goodtiming! Theresultisthisbook,nowwiththelessgrandiosetitle ThinkPython.Someofthechangesare: Iaddedasectionaboutdebuggingattheendofeachchapter.Thesesectionspresentgeneraltechniquesforfindingandavoidingbugs,andwarnings aboutPythonpitfalls. Iremovedthematerialinthelastfewchaptersabouttheimplementationoflistsandtrees.Istilllovethosetopics,butIthoughttheywereincongruent withtherestofthebook. Iaddedmoreexercises,rangingfromshorttestsofunderstandingtoafewsubstantialprojects. Iaddedaseriesofcasestudieslongerexampleswithexercises,solutions,anddiscussion.SomeofthemarebasedonSwampy,asuiteofPython programsIwroteforuseinmyclasses.Swampy,codeexamples,andsomesolutionsareavailablefromthinkpython.com (http://www.thinkpython.com). Iexpandedthediscussionofprogrammingdevelopmentplansandbasicdesignpatterns. TheuseofPythonismoreidiomatic.Thebookisstillaboutprogramming,notPython,butnowIthinkthebookgetsmoreleveragefromthelanguage. Ihopeyouenjoyworkingwiththisbook,andthatithelpsyoulearntoprogramandthink,atleastalittlebit,likeacomputerscientist. AllenB.Downey NeedhamMA AllenDowneyisanAssociateProfessorofComputerScienceattheFranklinW.OlinCollegeofEngineering.
Acknowledgements
Firstandmostimportantly,IthankJeffElkner,whotranslatedmyJavabookintoPython,whichgotthisprojectstartedandintroducedmetowhathasturned outtobemyfavoritelanguage. IalsothankChrisMeyers,whocontributedseveralsectionsto HowtoThinkLikeaComputerScientist . AndIthanktheFreeSoftwareFoundationfordevelopingtheGNUFreeDocumentationLicense,whichhelpedmakemycollaborationwithJeffandChris possible. IalsothanktheeditorsatLuluwhoworkedon HowtoThinkLikeaComputerScientist . Ithankallthestudentswhoworkedwithearlierversionsofthisbookandallthecontributors(listedbelow)whosentincorrectionsandsuggestions. AndIthankmywife,Lisa,forherworkonthisbook,andGreenTeaPress,andeverythingelse,too.
ContributorList
en.wikibooks.org/wiki/Think_Python/Print_version
Morethan100sharpeyedandthoughtfulreadershavesentinsuggestionsandcorrectionsoverthepastfewyears.Theircontributions,andenthusiasmfor
2/282
10/24/13
Morethan100sharpeyedandthoughtfulreadershavesentinsuggestionsandcorrectionsoverthepastfewyears.Theircontributions,andenthusiasmfor thisproject,havebeenahugehelp. Ifyouhaveasuggestionorcorrection,pleasesendemailto f e e d b a c k @ t h i n k p y t h o n . c o m .IfImakeachangebasedonyourfeedback,Iwilladdyoutothecontributor list(unlessyouasktobeomitted). Ifyouincludeatleastpartofthesentencetheerrorappearsin,thatmakesiteasyformetosearch.Pageandsectionnumbersarefine,too,butnotquiteas easytoworkwith.Thanks! LloydHughAllensentinacorrectiontoSection8.4. YvonBouliannesentinacorrectionofasemanticerrorinChapter5. FredBremmersubmittedacorrectioninSection2.1. JonahCohenwrotethePerlscriptstoconverttheLaTeXsourceforthisbookintobeautifulHTML. MichaelConlonsentinagrammarcorrectioninChapter2andanimprovementinstyleinChapter1,andheinitiateddiscussiononthetechnical aspectsofinterpreters. BenoitGirardsentinacorrectiontoahumorousmistakeinSection5.6. CourtneyGleasonandKatherineSmithwrote h o r s e b e t . p y ,whichwasusedasacasestudyinanearlierversionofthebook.Theirprogramcannowbe foundonthewebsite. LeeHarrsubmittedmorecorrectionsthanwehaveroomtolisthere,andindeedheshouldbelistedasoneoftheprincipaleditorsofthetext. JamesKaylinisastudentusingthetext.Hehassubmittednumerouscorrections. DavidKershawfixedthebroken c a t T w i c e functioninSection3.10. EddieLamhassentinnumerouscorrectionstoChapters1,2,and3.HealsofixedtheMakefilesothatitcreatesanindexthefirsttimeitisrunand helpedussetupaversioningscheme. ManYongLeesentinacorrectiontotheexamplecodeinSection2.4. DavidMayopointedoutthattheword"unconsciously"inChapter1neededtobechangedto"subconsciously". ChrisMcAloonsentinseveralcorrectionstoSections3.9and3.10. MatthewJ.Moelterhasbeenalongtimecontributorwhosentinnumerouscorrectionsandsuggestionstothebook. SimonDiconMontfordreportedamissingfunctiondefinitionandseveraltyposinChapter3.Healsofounderrorsinthe i n c r e m e n t functioninChapter13. JohnOuztscorrectedthedefinitionof"returnvalue"inChapter3. KevinParkssentinvaluablecommentsandsuggestionsastohowtoimprovethedistributionofthebook. DavidPoolsentinatypointheglossaryofChapter1,aswellaskindwordsofencouragement. MichaelSchmittsentinacorrectiontothechapteronfilesandexceptions. RobinShawpointedoutanerrorinSection13.1,wherethe p r i n t T i m e functionwasusedinanexamplewithoutbeingdefined. PaulSleighfoundanerrorinChapter7andabuginJonahCohensPerlscriptthatgeneratesHTMLfromLaTeX. CraigT.SnydalistestingthetextinacourseatDrewUniversity.Hehascontributedseveralvaluablesuggestionsandcorrections.
en.wikibooks.org/wiki/Think_Python/Print_version 3/282
10/24/13
IanThomasandhisstudentsareusingthetextinaprogrammingcourse.Theyarethefirstonestotestthechaptersinthelatterhalfofthebook,and theyhavemadenumerouscorrectionsandsuggestions. KeithVerheydensentinacorrectioninChapter3. PeterWinstanleyletusknowaboutalongstandingerrorinourLatininChapter3. ChrisWrobelmadecorrectionstothecodeinthechapteronfileI/Oandexceptions. MosheZadkahasmadeinvaluablecontributionstothisproject.InadditiontowritingthefirstdraftofthechapteronDictionaries,he providedcontinualguidanceintheearlystagesofthebook. ChristophZwerschkesentseveralcorrectionsandpedagogicsuggestions,andexplainedthedifferencebetween gleichand selbe. JamesMayersentusawholeslewofspellingandtypographicalerrors,includingtwointhecontributorlist. HaydenMcAfeecaughtapotentiallyconfusinginconsistencybetweentwoexamples. AngelArnalispartofaninternationalteamoftranslatorsworkingontheSpanishversionofthetext.HehasalsofoundseveralerrorsintheEnglish version. TauhidulHoqueandLexBerezhnycreatedtheillustrationsinChapter1andimprovedmanyoftheotherillustrations. Dr.MicheleAlzettacaughtanerrorinChapter8andsentsomeinterestingpedagogiccommentsandsuggestionsaboutFibonacciandOldMaid. AndyMitchellcaughtatypoinChapter1andabrokenexampleinChapter2. KalinHarveysuggestedaclarificationinChapter7andcaughtsometypos. ChristopherP.SmithcaughtseveraltyposandishelpinguspreparetoupdatethebookforPython2.2. DavidHutchinscaughtatypointheForeword. GregorLinglisteachingPythonatahighschoolinVienna,Austria.HeisworkingonaGermantranslationofthebook,andhecaughtacoupleofbad errorsinChapter5. JuliePeterscaughtatypointhePreface. FlorinOprinasentinanimprovementin m a k e T i m e ,acorrectionin p r i n t T i m e ,andanicetypo. D.J.WebresuggestedaclarificationinChapter3. KenfoundafistfuloferrorsinChapters8,9and11. IvoWevercaughtatypoinChapter5andsuggestedaclarificationinChapter3. CurtisYankosuggestedaclarificationinChapter2. BenLogansentinanumberoftyposandproblemswithtranslatingthebookintoHTML. JasonArmstrongsawthemissingwordinChapter2. LouisCordiernoticedaspotinChapter16wherethecodedidn'tmatchthetext. BrianCainsuggestedseveralclarificationsinChapters2and3. RobBlacksentinapasselofcorrections,includingsomechangesforPython2.2. JeanPhilippeReyatEcoleCentraleParissentanumberofpatches,includingsomeupdatesforPython2.2andotherthoughtfulimprovements. JasonMaderatGeorgeWashingtonUniversitymadeanumberofusefulsuggestionsandcorrections. JanGundtofteBruunremindedusthataerrorisanerror.
en.wikibooks.org/wiki/Think_Python/Print_version 4/282
10/24/13
AbelDavidandAlexisDinnoremindedusthatthepluralofmatrixismatrices,notmatrixes.Thiserrorwasinthebookforyears,buttworeaders withthesameinitialsreporteditonthesameday.Weird. CharlesThayerencouragedustogetridofthesemicolonswehadputattheendsofsomestatementsandtocleanupouruseofargumentand parameter. RogerSperbergpointedoutatwistedpieceoflogicinChapter3. SamBullpointedoutaconfusingparagraphinChapter2. AndrewCheungpointedouttwoinstancesofusebeforedef. C.CoreyCapelspottedthemissingwordintheThirdTheoremofDebuggingandatypoinChapter4. AlessandrahelpedclearupsomeTurtleconfusion. WimChampagnefoundabrainoinadictionaryexample. DouglasWrightpointedoutaproblemwithfloordivisionin a r c . JaredSpindorfoundsomejetsamattheendofasentence. LinPeihengsentanumberofveryhelpfulsuggestions. RayHagtvedtsentintwoerrorsandanotquiteerror. TorstenHbschpointedoutaninconsistencyinSwampy. IngaPetuhhovcorrectedanexampleinChapter14. ArneBabenhauserheidesentseveralhelpfulcorrections. MarkE.Casidaisisgoodatspottingrepeatedwords. ScottTylerfilledinathatwasmissing.Andthensentinaheapofcorrections. GordonShephardsentinseveralcorrections,allinseparateemails. AndrewTurner s p o t tedanerrorinChapter8. AdamHobartfixedaproblemwithfloordivisionin a r c . DarylHammondandSarahZimmermanpointedoutthatIservedup m a t h . p i tooearly.AndZimspottedatypo. GeorgeSassfoundabuginaDebuggingsection. BrianBinghamsuggestedExercise11.9. LeahEngelbertFentonpointedoutthatIused t u p l e asavariablename,contrarytomyownadvice.Andthenfoundabunchoftyposandausebefore def. JoeFunkespottedatypo. ChaochaoChenfoundaninconsistencyintheFibonacciexample. JeffPaineknowsthedifferencebetweenspaceandspam. LubosPintessentinatypo. GreggLindandAbigailHeithoffsuggestedExercise14.6. MaxHailperinpointedoutachangecominginPython3.0.Maxisoneoftheauthorsoftheextraordinary ConcreteAbstractions,whichyoumightwant toreadwhenyouaredonewiththisbook. ChotipatPornavalaifoundanerrorinanerrormessage.
en.wikibooks.org/wiki/Think_Python/Print_version 5/282
10/24/13
StanislawAntolsentalistofveryhelpfulsuggestions. EricPashmansentanumberofcorrectionsforChapters411. MiguelAzevedofoundsometypos. JianhuaLiusentinalonglistofcorrections. NickKingfoundamissingword. MartinZuthersentalonglistofsuggestions. AdamZimmermanfoundaninconsistencyinmyinstanceofaninstanceandseveralothererrors. RatnakarTiwarisuggestedafootnoteexplainingdegeneratetriangles. AnuragGoelsuggestedanothersolutionfor i s _ a b e c e d a r i a n andsentsomeadditionalcorrections.AndheknowshowtospellJaneAusten. KelliKratzerspottedoneoftheytypos. MarkGriffithspointedoutaconfusingexampleinChapter3. RoydanOngiefoundanerrorinmyNewtonsmethod.
Thefurtherstrangeadventuresofthisbook
InSeptemberof2008,WhiteknightconvertedtheHTMLversionof"ThinkPython"atGreenTeaPress[2]toaWikitextversionatWikibooks[3].Nowanyone canimprovethetext. 1. "Thestrangehistoryofthisbook"(http://www.greenteapress.com/thinkpython/html/book001.html)byAllenB.Downey 2. "ThinkPython"atGreenTeaPress(http://thinkpython.com/) 3. Wikibooks:ThinkPython(http://en.wikibooks.org/wiki/Think_Python)
Thewayoftheprogram
Thegoalofthisbookistoteachyoutothinklikeacomputerscientist.Thiswayofthinkingcombinessomeofthebestfeaturesofmathematics,engineering, andnaturalscience.Likemathematicians,computerscientistsuseformallanguagestodenoteideas(specificallycomputations).Likeengineers,theydesign things,assemblingcomponentsintosystemsandevaluatingtradeoffsamongalternatives.Likescientists,theyobservethebehaviorofcomplexsystems,form hypotheses,andtestpredictions. Thesinglemostimportantskillforacomputerscientistis problemsolving.Problemsolvingmeanstheabilitytoformulateproblems,thinkcreativelyabout solutions,andexpressasolutionclearlyandaccurately.Asitturnsout,theprocessoflearningtoprogramisanexcellentopportunitytopracticeproblem solvingskills.Thatswhythischapteriscalled,Thewayoftheprogram. Ononelevel,youwillbelearningtoprogram,ausefulskillbyitself.Onanotherlevel,youwilluseprogrammingasameanstoanend.Aswegoalong,that endwillbecomeclearer.
ThePythonprogramminglanguage
TheprogramminglanguageyouwilllearnisPython.Pythonisanexampleofa highlevellanguageotherhighlevellanguagesyoumighthaveheardofare C,C++,Perl,andJava.
en.wikibooks.org/wiki/Think_Python/Print_version 6/282
10/24/13
Therearealso lowlevellanguages,sometimesreferredtoasmachinelanguagesorassemblylanguages.Looselyspeaking,computerscanonlyexecute programswritteninlowlevellanguages.Soprogramswritteninahighlevellanguagehavetobeprocessedbeforetheycanrun.Thisextraprocessingtakes sometime,whichisasmalldisadvantageofhighlevellanguages. Theadvantagesareenormous.First,itismucheasiertoprograminahighlevellanguage.Programswritteninahighlevellanguagetakelesstimetowrite, theyareshorterandeasiertoread,andtheyaremorelikelytobecorrect.Second,highlevellanguagesare portable,meaningthattheycanrunondifferent kindsofcomputerswithfewornomodifications.Lowlevelprogramscanrunononlyonekindofcomputerandhavetoberewrittentorunonanother. Duetotheseadvantages,almostallprogramsarewritteninhighlevellanguages.Lowlevellanguagesareusedonlyforafewspecializedapplications. Twokindsofprogramsprocesshighlevellanguagesintolowlevellanguages: interpretersand compilers.Aninterpreterreadsahighlevelprogramand executesit,meaningthatitdoeswhattheprogramsays.Itprocessestheprogramalittleatatime,alternatelyreadinglinesandperformingcomputations.
Thechevron, > > > ,isthe prompttheinterpreterusestoindicatethatitisready.Ifyoutype 1+1 ,theinterpreterreplies 2 . Alternatively,youcanstorecodeinafileandusetheinterpretertoexecutethecontentsofthefile,whichiscalleda script.Byconvention,Pythonscripts havenamesthatendwith . p y .
en.wikibooks.org/wiki/Think_Python/Print_version 7/282
10/24/13
Whatisaprogram?
A programisasequenceofinstructionsthatspecifieshowtoperformacomputation.Thecomputationmightbesomethingmathematical,suchassolvinga systemofequationsorfindingtherootsofapolynomial,butitcanalsobeasymboliccomputation,suchassearchingandreplacingtextinadocumentor (strangelyenough)compilingaprogram. Thedetailslookdifferentindifferentlanguages,butafewbasicinstructionsappearinjustabouteverylanguage: input: Getdatafromthekeyboard,afile,orsomeotherdevice. output: Displaydataonthescreenorsenddatatoafileorotherdevice. math: Performbasicmathematicaloperationslikeadditionandmultiplication. conditionalexecution: Checkforcertainconditionsandexecutetheappropriatesequenceofstatements. repetition: Performsomeactionrepeatedly,usuallywithsomevariation. Believeitornot,thatsprettymuchallthereistoit.Everyprogramyouveeverused,nomatterhowcomplicated,ismadeupofinstructionsthatlookpretty muchlikethese.Soyoucanthinkofprogrammingastheprocessofbreakingalarge,complextaskintosmallerandsmallersubtasksuntilthesubtasksare simpleenoughtobeperformedwithoneofthesebasicinstructions. Thatmaybealittlevague,butwewillcomebacktothistopicwhenwetalkabout algorithms.
Whatisdebugging?
Programmingiserrorprone.Forwhimsicalreasons,programmingerrorsarecalled bugsandtheprocessoftrackingthemdowniscalled debugging. Threekindsoferrorscanoccurinaprogram:syntaxerrors,runtimeerrors,andsemanticerrors.Itisusefultodistinguishbetweentheminordertotrackthem downmorequickly. Syntaxerrors Pythoncanonlyexecuteaprogramifthesyntaxiscorrectotherwise,theinterpreterdisplaysanerrormessage. Syntaxreferstothestructureofaprogram andtherulesaboutthatstructure.Forexample,parentheseshavetocomeinmatchingpairs,so ( 1+2 ) islegal,but 8 ) isa syntaxerror.
en.wikibooks.org/wiki/Think_Python/Print_version 8/282
10/24/13
InEnglishreaderscantoleratemostsyntaxerrors,whichiswhywecanreadthepoetryofE.E.Cummingswithoutspewingerrormessages.Pythonisnotso forgiving.Ifthereisasinglesyntaxerroranywhereinyourprogram,Pythonwilldisplayanerrormessageandquit,andyouwillnotbeabletorunyour program.Duringthefirstfewweeksofyourprogrammingcareer,youwillprobablyspendalotoftimetrackingdownsyntaxerrors.Asyougainexperience,you willmakefewererrorsandfindthemfaster. Runtimeerrors Thesecondtypeoferrorisaruntimeerror,socalledbecausetheerrordoesnotappearuntilaftertheprogramhasstartedrunning.Theseerrorsarealso called exceptionsbecausetheyusuallyindicatethatsomethingexceptional(andbad)hashappened. Runtimeerrorsarerareinthesimpleprogramsyouwillseeinthefirstfewchapters,soitmightbeawhilebeforeyouencounterone. Semanticerrors Thethirdtypeoferroristhe semanticerror.Ifthereisasemanticerrorinyourprogram,itwillrunsuccessfullyinthesensethatthecomputerwillnot generateanyerrormessages,butitwillnotdotherightthing.Itwilldosomethingelse.Specifically,itwilldowhatyoutoldittodo. Theproblemisthattheprogramyouwroteisnottheprogramyouwantedtowrite.Themeaningoftheprogram(itssemantics)iswrong.Identifyingsemantic errorscanbetrickybecauseitrequiresyoutoworkbackwardbylookingattheoutputoftheprogramandtryingtofigureoutwhatitisdoing. Experimentaldebugging Oneofthemostimportantskillsyouwillacquireisdebugging.Althoughitcanbefrustrating,debuggingisoneofthemostintellectuallyrich,challenging,and interestingpartsofprogramming. Insomeways,debuggingislikedetectivework.Youareconfrontedwithclues,andyouhavetoinfertheprocessesandeventsthatledtotheresultsyousee. Debuggingisalsolikeanexperimentalscience.Onceyouhaveanideaaboutwhatisgoingwrong,youmodifyyourprogramandtryagain.Ifyourhypothesis wascorrect,thenyoucanpredicttheresultofthemodification,andyoutakeastepclosertoaworkingprogram.Ifyourhypothesiswaswrong,youhaveto comeupwithanewone.AsSherlockHolmespointedout,Whenyouhaveeliminatedtheimpossible,whateverremains,howeverimprobable,mustbethe truth.(A.ConanDoyle, TheSignofFour) Forsomepeople,programminganddebuggingarethesamething.Thatis,programmingistheprocessofgraduallydebuggingaprogramuntilitdoeswhat youwant.Theideaisthatyoushouldstartwithaprogramthatdoes somethingandmakesmallmodifications,debuggingthemasyougo,sothatyoualways haveaworkingprogram. Forexample,Linuxisanoperatingsystemthatcontainsthousandsoflinesofcode,butitstartedoutasasimpleprogramLinusTorvaldsusedtoexplorethe Intel80386chip.AccordingtoLarryGreenfield,OneofLinussearlierprojectswasaprogramthatwouldswitchbetweenprintingAAAAandBBBB.Thislater evolvedtoLinux.(TheLinuxUsersGuideBetaVersion1). Laterchapterswillmakemoresuggestionsaboutdebuggingandotherprogrammingpractices.
Formalandnaturallanguages
en.wikibooks.org/wiki/Think_Python/Print_version 9/282
10/24/13
Naturallanguagesarethelanguagespeoplespeak,suchasEnglish,Spanish,andFrench.Theywerenotdesignedbypeople(althoughpeopletrytoimpose someorderonthem)theyevolvednaturally. Formallanguagesarelanguagesthataredesignedbypeopleforspecificapplications.Forexample,thenotationthatmathematiciansuseisaformal languagethatisparticularlygoodatdenotingrelationshipsamongnumbersandsymbols.Chemistsuseaformallanguagetorepresentthechemicalstructure ofmolecules.Andmostimportantly: Programminglanguagesareformallanguagesthathavebeendesignedtoexpresscomputations. Formallanguagestendtohavestrictrulesaboutsyntax.Forexample,3+3=6isasyntacticallycorrectmathematicalstatement,but3+=3$6isnot. H2O isasyntacticallycorrectchemicalformula,but 2Zzisnot. Syntaxrulescomeintwoflavors,pertainingto tokensandstructure.Tokensarethebasicelementsofthelanguage,suchaswords,numbers,andchemical elements.Oneoftheproblemswith3+=3$6isthat $ isnotalegaltokeninmathematics(atleastasfarasIknow).Similarly, 2Zzisnotlegalbecause thereisnoelementwiththeabbreviation Zz. Thesecondtypeofsyntaxerrorpertainstothestructureofastatementthatis,thewaythetokensarearranged.Thestatement3+=3$6isillegalbecause eventhough+and=arelegaltokens,youcanthaveonerightaftertheother.Similarly,inachemicalformulathesubscriptcomesaftertheelementname, notbefore. Exercise1 WriteawellstructuredEnglishsentencewithinvalidtokensinit.Thenwriteanothersentencewithallvalidtokensbutwithinvalidstructure. WhenyoureadasentenceinEnglishorastatementinaformallanguage,youhavetofigureoutwhatthestructureofthesentenceis(althoughinanatural languageyoudothissubconsciously).Thisprocessiscalled parsing. Forexample,whenyouhearthesentence,Thepennydropped,youunderstandthatthepennyisthesubjectanddroppedisthepredicate.Onceyouhave parsedasentence,youcanfigureoutwhatitmeans,orthesemanticsofthesentence.Assumingthatyouknowwhatapennyisandwhatitmeanstodrop, youwillunderstandthegeneralimplicationofthissentence. Althoughformalandnaturallanguageshavemanyfeaturesincommontokens,structure,syntax,andsemanticstherearesomedifferences: ambiguity: Naturallanguagesarefullofambiguity,whichpeopledealwithbyusingcontextualcluesandotherinformation.Formallanguagesaredesignedtobe nearlyorcompletelyunambiguous,whichmeansthatanystatementhasexactlyonemeaning,regardlessofcontext. redundancy: Inordertomakeupforambiguityandreducemisunderstandings,naturallanguagesemploylotsofredundancy.Asaresult,theyareoftenverbose. Formallanguagesarelessredundantandmoreconcise. literalness: Naturallanguagesarefullofidiomandmetaphor.IfIsay,Thepennydropped,thereisprobablynopennyandnothingdropping[1].Formallanguages meanexactlywhattheysay.
en.wikibooks.org/wiki/Think_Python/Print_version 10/282
10/24/13
Peoplewhogrowupspeakinganaturallanguageeveryoneoftenhaveahardtimeadjustingtoformallanguages.Insomeways,thedifferencebetween formalandnaturallanguageislikethedifferencebetweenpoetryandprose,butmoreso: Poetry: Wordsareusedfortheirsoundsaswellasfortheirmeaning,andthewholepoemtogethercreatesaneffectoremotionalresponse.Ambiguityisnot onlycommonbutoftendeliberate. Prose: Theliteralmeaningofwordsismoreimportant,andthestructurecontributesmoremeaning.Proseismoreamenabletoanalysisthanpoetrybutstill oftenambiguous. Programs: Themeaningofacomputerprogramisunambiguousandliteral,andcanbeunderstoodentirelybyanalysisofthetokensandstructure. Herearesomesuggestionsforreadingprograms(andotherformallanguages).First,rememberthatformallanguagesaremuchmoredensethannatural languages,soittakeslongertoreadthem.Also,thestructureisveryimportant,soitisusuallynotagoodideatoreadfromtoptobottom,lefttoright. Instead,learntoparsetheprograminyourhead,identifyingthetokensandinterpretingthestructure.Finally,thedetailsmatter.Smallerrorsinspellingand punctuation,whichyoucangetawaywithinnaturallanguages,canmakeabigdifferenceinaformallanguage.
Thefirstprogram
Traditionally,thefirstprogramyouwriteinanewlanguageiscalledHello,World!becauseallitdoesisdisplaythewords,Hello,World!InPython,itlooks likethis:
p r i n t' H e l l o ,W o r l d ! '
Debugging
Itisagoodideatoreadthisbookinfrontofacomputersoyoucantryouttheexamplesasyougo.Youcanrunmostoftheexamplesininteractivemode, butifyouputthecodeintoascript,itiseasiertotryoutvariations.
en.wikibooks.org/wiki/Think_Python/Print_version
Wheneveryouareexperimentingwithanewfeature,youshouldtrytomakemistakes.Forexample,intheHello,world!program,whathappensifyouleave
11/282
10/24/13
Wheneveryouareexperimentingwithanewfeature,youshouldtrytomakemistakes.Forexample,intheHello,world!program,whathappensifyouleave outoneofthequotationmarks?Whatifyouleaveoutboth?Whatifyouspell p r i n t wrong? Thiskindofexperimenthelpsyourememberwhatyoureaditalsohelpswithdebugging,becauseyougettoknowwhattheerrormessagesmean.Itisbetter tomakemistakesnowandonpurposethanlaterandaccidentally. Programming,andespeciallydebugging,sometimesbringsoutstrongemotions.Ifyouarestrugglingwithadifficultbug,youmightfeelangry,despondentor embarrassed. Thereisevidencethatpeoplenaturallyrespondtocomputersasiftheywerepeople[3].Whentheyworkwell,wethinkofthemasteammates,andwhenthey areobstinateorrude,werespondtothemthesamewaywerespondtorude,obstinatepeople. Preparingforthesereactionsmighthelpyoudealwiththem.Oneapproachistothinkofthecomputerasanemployeewithcertainstrengths,likespeedand precision,andparticularweaknesses,likelackofempathyandinabilitytograspthebigpicture. Yourjobistobeagoodmanager:findwaystotakeadvantageofthestrengthsandmitigatetheweaknesses.Andfindwaystouseyouremotionstoengage withtheproblem,withoutlettingyourreactionsinterferewithyourabilitytoworkeffectively. Learningtodebugcanbefrustrating,butitisavaluableskillthatisusefulformanyactivitiesbeyondprogramming.Attheendofeachchapterthereisa debuggingsection,likethisone,withmythoughtsaboutdebugging.Ihopetheyhelp!
Glossary
problemsolving: Theprocessofformulatingaproblem,findingasolution,andexpressingthesolution. highlevellanguage: AprogramminglanguagelikePythonthatisdesignedtobeeasyforhumanstoreadandwrite. lowlevellanguage: Aprogramminglanguagethatisdesignedtobeeasyforacomputertoexecutealsocalledmachinelanguageorassemblylanguage. portability: Apropertyofaprogramthatcanrunonmorethanonekindofcomputer. interpret: Toexecuteaprograminahighlevellanguagebytranslatingitonelineatatime. compile: Totranslateaprogramwritteninahighlevellanguageintoalowlevellanguageallatonce,inpreparationforlaterexecution. sourcecode: Aprograminahighlevellanguagebeforebeingcompiled. objectcode: Theoutputofthecompilerafterittranslatestheprogram. executable: Anothernameforobjectcodethatisreadytobeexecuted.
en.wikibooks.org/wiki/Think_Python/Print_version 12/282
10/24/13
prompt: Charactersdisplayedbytheinterpretertoindicatethatitisreadytotakeinputfromtheuser. script: Aprogramstoredinafile(usuallyonethatwillbeinterpreted). interactivemode: AwayofusingthePythoninterpreterbytypingcommandsandexpressionsattheprompt. scriptmode: AwayofusingthePythoninterpretertoreadandexecutestatementsinascript. program: Asetofinstructionsthatspecifiesacomputation. algorithm: Ageneralprocessforsolvingacategoryofproblems. bug: Anerrorinaprogram. debugging: Theprocessoffindingandremovinganyofthethreekindsofprogrammingerrors. syntax: Thestructureofaprogram. syntaxerror: Anerrorinaprogramthatmakesitimpossibletoparse(andthereforeimpossibletointerpret). exception: Anerrorthatisdetectedwhiletheprogramisrunning. semantics: Themeaningofaprogram. semanticerror: Anerrorinaprogramthatmakesitdosomethingotherthanwhattheprogrammerintended. naturallanguage: Anyoneofthelanguagesthatpeoplespeakthatevolvednaturally. formallanguage: Anyoneofthelanguagesthatpeoplehavedesignedforspecificpurposes,suchasrepresentingmathematicalideasorcomputerprogramsall programminglanguagesareformallanguages. token: Oneofthebasicelementsofthesyntacticstructureofaprogram,analogoustoawordinanaturallanguage. parse: Toexamineaprogramandanalyzethesyntacticstructure.
en.wikibooks.org/wiki/Think_Python/Print_version 13/282
10/24/13
printstatement: AninstructionthatcausesthePythoninterpretertodisplayavalueonthescreen.
Exercises
Exercise2 UseawebbrowsertogotothePythonwebsite,http://python.org/.ThispagecontainsinformationaboutPythonandlinkstoPythonrelatedpages,andit givesyoutheabilitytosearchthePythondocumentation.Forexample,ifyouenter p r i n t inthesearchwindow,thefirstlinkthatappearsisthedocumentation ofthe p r i n t statement.Atthispoint,notallofitwillmakesensetoyou,butitisgoodtoknowwhereitis. Exercise3 StartthePythoninterpreterandtype'h e l p ( ) 'tostarttheonlinehelputility.Oryoucantype h e l p ( ' p r i n t ' ) togetinformationaboutthe'p r i n t 'statement. Ifthis exampledoesntwork,youmayneedtoinstalladditionalPythondocumentationorsetanenvironmentvariablethedetailsdependonyouroperatingsystem andversionofPython. Exercise4 StartthePythoninterpreteranduseitasacalculator.Pythonssyntaxformathoperationsisalmostthesameasstandardmathematicalnotation.For example,thesymbols'+ ',''and'/ 'denoteaddition,subtractionanddivision,asyouwouldexpect.Thesymbolformultiplicationis'* '. Ifyouruna10kilometer racein43minutes30seconds,whatisyouraveragetimepermile?Whatisyouraveragespeedinmilesperhour?(Hint:thereare1.61kilometersinamile).
References
1. Thisidiommeansthatsomeonerealizedsomethingafteraperiodofconfusion. 2. InPython3.0, p r i n t isafunction,notastatement,sothesyntaxis p r i n t ( H e l l o ,W o r l d ! ) .Wewillgettofunctionssoon! 3. SeeReevesandNass, TheMediaEquation:HowPeopleTreatComputers,Television,andNewMediaLikeRealPeopleandPlaces.
Variables,expressionsandstatements
Valuesandtypes
A valueisoneofthebasicthingsaprogramworkswith,likealetteroranumber.Thevalueswehaveseensofarare 1 , 2 ,and ' H e l l o ,W o r l d ! ' . Thesevaluesbelongtodifferent types: 2 isaninteger,and ' H e l l o ,W o r l d ! ' isa string,socalledbecauseitcontainsastringofletters.You(andthe interpreter)canidentifystringsbecausetheyareenclosedinquotationmarks. Theprintstatementalsoworksforintegers.
en.wikibooks.org/wiki/Think_Python/Print_version
14/282
10/24/13
Ifyouarenotsurewhattypeavaluehas,theinterpretercantellyou.
> > >t y p e ( ' H e l l o ,W o r l d ! ' ) < t y p e' s t r ' > > > >t y p e ( 1 7 ) < t y p e' i n t ' >
Variables
Oneofthemostpowerfulfeaturesofaprogramminglanguageistheabilitytomanipulate variables.Avariableisanamethatreferstoavalue. An assignmentstatementcreatesnewvariablesandgivesthemvalues:
en.wikibooks.org/wiki/Think_Python/Print_version
15/282
10/24/13
> > >m e s s a g e=' A n dn o wf o rs o m e t h i n gc o m p l e t e l yd i f f e r e n t ' > > >n=1 7 > > >p i=3 . 1 4 1 5 9 2 6 5 3 5 8 9 7 9 3 1
Todisplaythevalueofavariable,youcanuseaprintstatement:
> > >p r i n tn 1 7 > > >p r i n tp i 3 . 1 4 1 5 9 2 6 5 3 5 9
Thetypeofavariableisthetypeofthevalueitrefersto.
> > >t y p e ( m e s s a g e ) < t y p e' s t r ' > > > >t y p e ( n ) < t y p e' i n t ' > > > >t y p e ( p i ) < t y p e' f l o a t ' >
Exercise1 Ifyoutypeanintegerwithaleadingzero,youmightgetaconfusingerror:
> > >z i p c o d e=0 2 4 9 2 ^ S y n t a x E r r o r :i n v a l i dt o k e n
Othernumberseemtowork,buttheresultsarebizarre:
en.wikibooks.org/wiki/Think_Python/Print_version
16/282
10/24/13
Canyoufigureoutwhatisgoingon?Hint:printthevalues 0 1 , 0 1 0 , 0 1 0 0 and 0 1 0 0 0 .
Variablenamesandkeywords
Programmersgenerallychoosenamesfortheirvariablesthataremeaningfultheydocumentwhatthevariableisusedfor. Variablenamescanbearbitrarilylong.Theycancontainbothlettersandnumbers,buttheyhavetobeginwithaletter.Itislegaltouseuppercaseletters,but itisagoodideatobeginvariablenameswithalowercaseletter(you'llseewhylater). Theunderscorecharacter(_ )canappearinaname.Itisoftenusedinnameswithmultiplewords,suchas m y _ n a m e or a i r s p e e d _ o f _ u n l a d e n _ s w a l l o w . Ifyougiveavariableanillegalname,yougetasyntaxerror:
> > >7 6 t r o m b o n e s=' b i gp a r a d e ' S y n t a x E r r o r :i n v a l i ds y n t a x > > >m o r e @=1 0 0 0 0 0 0 S y n t a x E r r o r :i n v a l i ds y n t a x > > >c l a s s=' A d v a n c e dT h e o r e t i c a lZ y m u r g y ' S y n t a x E r r o r :i n v a l i ds y n t a x
7 6 t r o m b o n e s isillegalbecauseitdoesnotbeginwithaletter. m o r e @ isillegalbecauseitcontainsanillegalcharacter, @ .Butwhat'swrongwith c l a s s ?
a s s e r t e l s e b r e a k c l a s s
p a s s y i e l d
e x c e p ti m p o r tp r i n t e x e c i n r a i s e r e t u r n
c o n t i n u ef i n a l l yi s d e f f o r
l a m b d at r y
Youmightwanttokeepthislisthandy.Iftheinterpretercomplainsaboutoneofyourvariablenamesandyoudon'tknowwhy,seeifitisonthislist.
en.wikibooks.org/wiki/Think_Python/Print_version 17/282
10/24/13
youcanseethat y i e l d hasbeenrecognizedasakeywordandnotasanordinaryvariable,sinceitiscoloredorange.
Statements
AstatementisaunitofcodethatthePythoninterpretercanexecute.Wehaveseentwokindsofstatements:printandassignment. Whenyoutypeastatementininteractivemode,theinterpreterexecutesitanddisplaystheresult,ifthereisone. Ascriptusuallycontainsasequenceofstatements.Ifthereismorethanonestatement,theresultsappearoneatatimeasthestatementsexecute. Forexample,thescript
p r i n t1 x=2 p r i n tx
producestheoutput
1 2
Theassignmentstatementproducesnooutput.
Operatorsandoperands
Operatorsarespecialsymbolsthatrepresentcomputationslikeadditionandmultiplication.Thevaluestheoperatorisappliedtoarecalled operands. Theoperators + , , * , / and * * performaddition,subtraction,multiplication,divisionandexponentiation,asinthefollowingexamples:
2 0 + 3 2 h o u r 1 h o u r * 6 0 + m i n u t e m i n u t e / 6 0 5 * * 2 ( 5 + 9 ) * ( 1 5 7 )
10/24/13
Thedivisionoperatormightnotdowhatyouexpect:
> > >m i n u t e=5 9 > > >m i n u t e / 6 0 0
Expressions
An expressionisacombinationofvalues,variables,andoperators.Avalueallbyitselfisconsideredanexpression,andsoisavariable,sothefollowingare alllegalexpressions(assumingthatthevariable x hasbeenassignedavalue):
1 7 x x+1 7
Ifyoutypeanexpressionininteractivemode,theinterpreter evaluatesitanddisplaystheresult:
> > >1+1 2
en.wikibooks.org/wiki/Think_Python/Print_version
19/282
10/24/13
Nowputthesamestatementsintoascriptandrunit.Whatistheoutput?Modifythescriptbytransformingeachexpressionintoaprintstatementandthen runitagain.
Orderofoperations
Whenmorethanoneoperatorappearsinanexpression,theorderofevaluationdependsonthe rulesofprecedence.Formathematicaloperators,Python followsmathematicalconvention.Theacronym PEMDAS isausefulwaytoremembertherules: P arentheseshavethehighestprecedenceandcanbeusedtoforceanexpressiontoevaluateintheorderyouwant.Sinceexpressionsinparentheses areevaluatedfirst, 2*( 3 1 ) is4,and ( 1 + 1 ) * * ( 5 2 ) is8.Youcanalsouseparenthesestomakeanexpressioneasiertoread,asin ( m i n u t e*1 0 0 )/6 0 ,even ifitdoesn'tchangetheresult. E xponentiationhasthenexthighestprecedence,so 2 * * 1 + 1 is3,not4,and 3 * 1 * * 3 is3,not27. Multiplicationand Divisionhavethesameprecedence,whichishigherthan Additionand S ubtraction,whichalsohavethesameprecedence.So 2 * 3 1 is 5,not4,and 6 + 4 / 2 is8,not5. Operatorswiththesameprecedenceareevaluatedfromlefttoright.Sointheexpression d e g r e e s/2*p i ,thedivisionhappensfirstandtheresultis multipliedby p i .Todivideby2,youcanreordertheoperandsoruseparentheses.
Stringoperations
Ingeneral,youcannotperformmathematicaloperationsonstrings,evenifthestringslooklikenumbers,sothefollowingareillegal:
' 2 ' ' 1 ' ' e g g s ' / ' e a s y ' ' t h i r d ' * ' ac h a r m '
Theoutputofthisprogramis t h r o a t w a r b l e r . The * operatoralsoworksonstringsitperformsrepetition.Forexample, S p a m * 3 is ' S p a m S p a m S p a m ' .Ifoneoftheoperandsisastring,theotherhastobean integer. Thisuseof + and * makessensebyanalogywithadditionandmultiplication.Justas 4 * 3 isequivalentto 4 + 4 + 4 ,weexpect ' S p a m ' * 3 tobethesameas ' S p a m ' + ' S p a m ' + ' S p a m ' ,anditis.Ontheotherhand,thereisasignificantwayinwhichstringconcatenationandrepetitionaredifferentfromintegeradditionand multiplication.Canyouthinkofapropertythatadditionhasthatstringconcatenationdoesnot?
Comments
en.wikibooks.org/wiki/Think_Python/Print_version 20/282
10/24/13
Inthiscase,thecommentappearsonalinebyitself.Youcanalsoputcommentsattheendofaline:
p e r c e n t a g e=( m i n u t e*1 0 0 )/6 0 #p e r c e n t a g eo fa nh o u r
Thiscommentcontainsusefulinformationthatisnotinthecode:
v=5 #v e l o c i t yi nm e t e r s / s e c o n d .
Goodvariablenamescanreducetheneedforcomments,butlongnamescanmakecomplexexpressionshardtoread,sothereisatradeoff.
Debugging
Atthispointthesyntaxerroryouaremostlikelytomakeisanillegalvariablename,like c l a s s and y i e l d ,whicharekeywords,or o d d ~ j o b and U S $ ,whichcontain illegalcharacters. Ifyouputaspaceinavariablename,Pythonthinksitistwooperandswithoutanoperator:
> > >b a dn a m e=5 S y n t a x E r r o r :i n v a l i ds y n t a x
10/24/13
Theruntimeerroryouaremostlikelytomakeisausebeforedefthatis,tryingtouseavariablebeforeyouhaveassignedavalue.Thiscanhappenifyou spellavariablenamewrong:
> > >p r i n c i p a l=3 2 7 . 6 8 > > >i n t e r e s t=p r i n c i p l e*r a t e N a m e E r r o r :n a m e' p r i n c i p l e 'i sn o td e f i n e d
Butthedivisionhappensfirst,soyouwouldget/2,whichisnotthesamething!ThereisnowayforPythontoknowwhatyoumeanttowrite,sointhis caseyoudontgetanerrormessageyoujustgetthewronganswer.
Glossary
value: Oneofthebasicunitsofdata,likeanumberorstring,thataprogrammanipulates. type: Acategoryofvalues.Thetypeswehaveseensofarareintegers(type i n t ),floatingpointnumbers(type f l o a t ),andstrings(type s t r ). integer: Atypethatrepresentswholenumbers. floatingpoint: Atypethatrepresentsnumberswithfractionalparts. string: Atypethatrepresentssequencesofcharacters. variable: Anamethatreferstoavalue. statement: Asectionofcodethatrepresentsacommandoraction.Sofar,thestatementswehaveseenareassignmentsandprintstatements. assignment: Astatementthatassignsavaluetoavariable. statediagram: Agraphicalrepresentationofasetofvariablesandthevaluestheyreferto. keyword:
en.wikibooks.org/wiki/Think_Python/Print_version 22/282
10/24/13
Areservedwordthatisusedbythecompilertoparseaprogramyoucannotusekeywordslike i f , d e f ,and w h i l e asvariablenames. operator: Aspecialsymbolthatrepresentsasimplecomputationlikeaddition,multiplication,orstringconcatenation. operand: Oneofthevaluesonwhichanoperatoroperates. floordivision: Theoperationthatdividestwonumbersandchopsoffthefractionpart. expression: Acombinationofvariables,operators,andvaluesthatrepresentsasingleresultvalue. evaluate: Tosimplifyanexpressionbyperformingtheoperationsinordertoyieldasinglevalue. rulesofprecedence: Thesetofrulesgoverningtheorderinwhichexpressionsinvolvingmultipleoperatorsandoperandsareevaluated. concatenate: Tojointwooperandsendtoend. comment: Informationinaprogramthatismeantforotherprogrammers(oranyonereadingthesourcecode)andhasnoeffectontheexecutionoftheprogram.
Exercises
Exercise3 Assumethatweexecutethefollowingassignmentstatements:
w i d t h=1 7 h e i g h t=1 2 . 0 d e l i m i t e r=' . '
Foreachofthefollowingexpressions,writethevalueoftheexpressionandthetype(ofthevalueoftheexpression).
w i d t h / 2 w i d t h / 2 . 0 h e i g h t / 3 1+2*5 d e l i m i t e r*5
UsethePythoninterpretertocheckyouranswers.
en.wikibooks.org/wiki/Think_Python/Print_version
23/282
10/24/13
Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
Functions
Functioncalls
Inthecontextofprogramming,a functionisanamedsequenceofstatementsthatperformsacomputation.Whenyoudefineafunction,youspecifythe nameandthesequenceofstatements.Later,youcan"call"thefunctionbyname.Wehavealreadyseenoneexampleofa functioncall :
Typeconversionfunctions
Pythonprovidesbuiltinfunctionsthatconvertvaluesfromonetypetoanother.Theintfunctiontakesanyvalueandconvertsittoaninteger,ifitcan,or complainsotherwise:
en.wikibooks.org/wiki/Think_Python/Print_version
24/282
10/24/13
> > >i n t ( ' 3 2 ' ) 3 2 > > >i n t ( ' H e l l o ' ) V a l u e E r r o r :i n v a l i dl i t e r a lf o ri n t ( ) :H e l l o
intcanconvertfloatingpointvaluestointegers,butitdoesn'troundoffitchopsoffthefractionpart:
> > >i n t ( 3 . 9 9 9 9 9 ) 3 > > >i n t ( 2 . 3 ) 2
floatconvertsintegersandstringstofloatingpointnumbers:
> > >f l o a t ( 3 2 ) 3 2 . 0 > > >f l o a t ( ' 3 . 1 4 1 5 9 ' ) 3 . 1 4 1 5 9
Finally,strconvertsitsargumenttoastring:
> > >s t r ( 3 2 ) ' 3 2 ' > > >s t r ( 3 . 1 4 1 5 9 ) ' 3 . 1 4 1 5 9 '
Mathfunctions
Pythonhasamathmodulethatprovidesmostofthefamiliarmathematicalfunctions.A moduleisafilethatcontainsacollectionofrelatedfunctions. Beforewecanusethemodule,wehavetoimportit:
> > >i m p o r tm a t h
Thisstatementcreatesa moduleobjectnamedmath.Ifyouprintthemoduleobject,yougetsomeinformationaboutit:
10/24/13
> > >r a t i o=s i g n a l _ p o w e r/n o i s e _ p o w e r > > >d e c i b e l s=1 0*m a t h . l o g 1 0 ( r a t i o ) > > >r a d i a n s=0 . 7 > > >h e i g h t=m a t h . s i n ( r a d i a n s )
> > >d e g r e e s=4 5 > > >r a d i a n s=d e g r e e s/3 6 0 . 0*2*m a t h . p i > > >m a t h . s i n ( r a d i a n s ) 0 . 7 0 7 1 0 6 7 8 1 1 8 7
Theexpressionmath.pigetsthevariablepifromthemathmodule.Thevalueofthisvariableisanapproximationof,accuratetoabout15digits. Ifyouknowyourtrigonometry,youcancheckthepreviousresultbycomparingittothesquarerootoftwodividedbytwo:
Composition
Sofar,wehavelookedattheelementsofaprogramvariables,expressions,andstatementsinisolation,withouttalkingabouthowtocombinethem. Oneofthemostusefulfeaturesofprogramminglanguagesistheirabilitytotakesmallbuildingblocksand composethem.Forexample,theargumentofa functioncanbeanykindofexpression,includingarithmeticoperators:
en.wikibooks.org/wiki/Think_Python/Print_version 26/282
10/24/13
Andevenfunctioncalls:
x=m a t h . e x p ( m a t h . l o g ( x + 1 ) )
Almostanywhereyoucanputavalue,youcanputanarbitraryexpression,withoneexception:theleftsideofanassignmentstatementhastobeavariable name.Anyotherexpressionontheleftsideisasyntaxerror.
> > >m i n u t e s=h o u r s*6 0 > > >h o u r s*6 0=m i n u t e s S y n t a x E r r o r :c a n ' ta s s i g nt oo p e r a t o r #r i g h t #w r o n g !
Addingnewfunctions
Sofar,wehaveonlybeenusingthefunctionsthatcomewithPython,butitisalsopossibletoaddnewfunctions.A functiondefinitionspecifiesthenameof anewfunctionandthesequenceofstatementsthatexecutewhenthefunctioniscalled. Hereisanexample:
d e fp r i n t _ l y r i c s ( ) : p r i n t" I ' mal u m b e r j a c k ,a n dI ' mo k a y . " p r i n t" Is l e e pa l ln i g h ta n dIw o r ka l ld a y . "
defisakeywordthatindicatesthatthisisafunctiondefinition.Thenameofthefunctionis p r i n t _ l y r i c s .Therulesforfunctionnamesarethesameasfor variablenames:letters,numbersandsomepunctuationmarksarelegal,butthefirstcharactercan'tbeanumber.Youcan'tuseakeywordasthenameofa function,andyoushouldavoidhavingavariableandafunctionwiththesamename. Theemptyparenthesesafterthenameindicatethatthisfunctiondoesn'ttakeanyarguments. Thefirstlineofthefunctiondefinitioniscalledthe headertherestiscalledthe body.Theheaderhastoendwithacolonandthebodyhastobeindented. Byconvention,theindentationisalwaysfourspaces(seeSection).Thebodycancontainanynumberofstatements. Thestringsintheprintstatementsareenclosedindoublequotes.Singlequotesanddoublequotesdothesamethingmostpeopleusesinglequotesexcept incaseslikethiswhereasinglequote(whichisalsoanapostrophe)appearsinthestring. Ifyoutypeafunctiondefinitionininteractivemode,theinterpreterprintsellipses(... )toletyouknowthatthedefinitionisn'tcomplete:
> > >d e fp r i n t _ l y r i c s ( ) : . . . p r i n t" I ' mal u m b e r j a c k ,a n dI ' mo k a y . "
en.wikibooks.org/wiki/Think_Python/Print_version 27/282
10/24/13
. . . . . .
Toendthefunction,youhavetoenteranemptyline(thisisnotnecessaryinascript). Definingafunctioncreatesavariablewiththesamename.
> > >p r i n tp r i n t _ l y r i c s < f u n c t i o np r i n t _ l y r i c sa t0 x b 7 e 9 9 e 9 c > > > >p r i n tt y p e ( p r i n t _ l y r i c s ) < t y p e' f u n c t i o n ' >
Onceyouhavedefinedafunction,youcanuseitinsideanotherfunction.Forexample,torepeatthepreviousrefrain,wecouldwriteafunctioncalled r e p e a t _ l y r i c s :
d e fr e p e a t _ l y r i c s ( ) : p r i n t _ l y r i c s ( ) p r i n t _ l y r i c s ( )
Andthencall r e p e a t _ l y r i c s :
> > >r e p e a t _ l y r i c s ( ) I ' mal u m b e r j a c k ,a n dI ' mo k a y . Is l e e pa l ln i g h ta n dIw o r ka l ld a y . I ' mal u m b e r j a c k ,a n dI ' mo k a y . Is l e e pa l ln i g h ta n dIw o r ka l ld a y .
Butthat'snotreallyhowthesonggoes.
en.wikibooks.org/wiki/Think_Python/Print_version 28/282
10/24/13
Definitionsanduses
Pullingtogetherthecodefragmentsfromtheprevioussection,thewholeprogramlookslikethis:
Exercise1
Movethelastlineofthisprogramtothetop,sothefunctioncallappearsbeforethedefinitions.Runtheprogramandseewhaterrormessageyouget.
Exercise2
Movethefunctioncallbacktothebottomandmovethedefinitionof p r i n t _ l y r i c s afterthedefinitionof r e p e a t _ l y r i c s .Whathappenswhenyourunthisprogram?
Flowofexecution
Inordertoensurethatafunctionisdefinedbeforeitsfirstuse,youhavetoknowtheorderinwhichstatementsareexecuted,whichiscalledthe flowof execution. Executionalwaysbeginsatthefirststatementoftheprogram.Statementsareexecutedoneatatime,inorderfromtoptobottom. Functiondefinitionsdonotaltertheflowofexecutionoftheprogram,butrememberthatstatementsinsidethefunctionarenotexecuteduntilthefunctionis called. Afunctioncallislikeadetourintheflowofexecution.Insteadofgoingtothenextstatement,theflowjumpstothebodyofthefunction,executesallthe statementsthere,andthencomesbacktopickupwhereitleftoff.
en.wikibooks.org/wiki/Think_Python/Print_version 29/282
10/24/13
Parametersandarguments
Someofthebuiltinfunctionswehaveseenrequirearguments.Forexample,whenyoucallmath.sinyoupassanumberasanargument.Somefunctions takemorethanoneargument:math.powtakestwo,thebaseandtheexponent. Insidethefunction,theargumentsareassignedtovariablescalled parameters.Hereisanexampleofauserdefinedfunctionthattakesanargument:
d e fp r i n t _ t w i c e ( b r u c e ) : p r i n tb r u c e p r i n tb r u c e
Thisfunctionassignstheargumenttoaparameternamedbruce.Whenthefunctioniscalled,itprintsthevalueoftheparameter(whateveritis)twice. Thisfunctionworkswithanyvaluethatcanbeprinted.
> > >p r i n t _ t w i c e ( ' S p a m ' ) S p a m S p a m > > >p r i n t _ t w i c e ( 1 7 ) 1 7 1 7 > > >p r i n t _ t w i c e ( m a t h . p i ) 3 . 1 4 1 5 9 2 6 5 3 5 9 3 . 1 4 1 5 9 2 6 5 3 5 9
Thesamerulesofcompositionthatapplytobuiltinfunctionsalsoapplytouserdefinedfunctions,sowecanuseanykindofexpressionasanargumentfor p r i n t _ t w i c e :
en.wikibooks.org/wiki/Think_Python/Print_version 30/282
10/24/13
> > >m i c h a e l=' E r i c ,t h eh a l fab e e . ' > > >p r i n t _ t w i c e ( m i c h a e l ) E r i c ,t h eh a l fab e e . E r i c ,t h eh a l fab e e .
Variablesandparametersarelocal
Whenyoucreateavariableinsideafunction,itis local ,whichmeansthatitonlyexistsinsidethefunction.Forexample:
d e fc a t _ t w i c e ( p a r t 1 ,p a r t 2 ) : c a t=p a r t 1+p a r t 2 p r i n t _ t w i c e ( c a t )
Thisfunctiontakestwoarguments,concatenatesthem,andprintstheresulttwice.Hereisanexamplethatusesit:
> > >l i n e 1=' B i n gt i d d l e' > > >l i n e 2=' t i d d l eb a n g . ' > > >c a t _ t w i c e ( l i n e 1 ,l i n e 2 )
en.wikibooks.org/wiki/Think_Python/Print_version 31/282
10/24/13
B i n gt i d d l et i d d l eb a n g . B i n gt i d d l et i d d l eb a n g .
When c a t _ t w i c e terminates,thevariablecatisdestroyed.Ifwetrytoprintit,wegetanexception:
Parametersarealsolocal.Forexample,outside p r i n t _ t w i c e ,thereisnosuchthingasbruce.
Stackdiagrams
Tokeeptrackofwhichvariablescanbeusedwhere,itissometimesusefultodrawa stackdiagram.Likestatediagrams,stackdiagramsshowthevalueof eachvariable,buttheyalsoshowthefunctioneachvariablebelongsto. Eachfunctionisrepresentedbya frame.Aframeisaboxwiththenameofafunctionbesideitandtheparametersandvariablesofthefunctioninsideit.The stackdiagramforthepreviousexamplelookslikethis: File:Book004.pngTheframesarearrangedinastackthatindicateswhichfunctioncalledwhich,andsoon.Inthisexample, p r i n t _ t w i c e wascalledby c a t _ t w i c e ,and c a t _ t w i c e wascalledby _ _ m a i n _ _ ,whichisaspecialnameforthetopmostframe.Whenyoucreateavariableoutsideofanyfunction, itbelongsto _ _ m a i n _ _ . Eachparameterreferstothesamevalueasitscorrespondingargument.So,part1hasthesamevalueasline1,part2hasthesamevalueasline2,andbruce hasthesamevalueascat. Ifanerroroccursduringafunctioncall,Pythonprintsthenameofthefunction,andthenameofthefunctionthatcalledit,andthenameofthefunctionthat called that ,allthewaybackto _ _ m a i n _ _ . Forexample,ifyoutrytoaccesscatfromwithin
p r i n t _ t w i c e ,yougetaNameError:
T r a c e b a c k( i n n e r m o s tl a s t ) :
en.wikibooks.org/wiki/Think_Python/Print_version 32/282
10/24/13
Fruitfulfunctionsandvoidfunctions
Someofthefunctionsweareusing,suchasthemathfunctions,yieldresultsforlackofabettername,Icallthem fruitful functions.Otherfunctions,like p r i n t _ t w i c e ,performanactionbutdon'treturnavalue.Theyarecalled voidfunctions. Whenyoucallafruitfulfunction,youalmostalwayswanttodosomethingwiththeresultforexample,youmightassignittoavariableoruseitaspartofan expression:
Whenyoucallafunctionininteractivemode,Pythondisplaystheresult:
Butinascript,ifyoucallafruitfulfunctionallbyitself,thereturnvalueislostforever!
m a t h . s q r t ( 5 )
en.wikibooks.org/wiki/Think_Python/Print_version
33/282
10/24/13
Thefunctionswehavewrittensofarareallvoid.Wewillstartwritingfruitfulfunctionsinafewchapters.
Whyfunctions?
Itmaynotbeclearwhyitisworththetroubletodivideaprogramintofunctions.Thereareseveralreasons: Creatinganewfunctiongivesyouanopportunitytonameagroupofstatements,whichmakesyourprogrameasiertoreadanddebug. Functionscanmakeaprogramsmallerbyeliminatingrepetitivecode.Later,ifyoumakeachange,youonlyhavetomakeitinoneplace. Dividingalongprogramintofunctionsallowsyoutodebugthepartsoneatatimeandthenassemblethemintoaworkingwhole. Welldesignedfunctionsareoftenusefulformanyprograms.Onceyouwriteanddebugone,youcanreuseit.
Debugging
Ifyouareusingatexteditortowriteyourscripts,youmightrunintoproblemswithspacesandtabs.Thebestwaytoavoidtheseproblemsistousespaces exclusively(notabs).MosttexteditorsthatknowaboutPythondothisbydefault,butsomedon't. Tabsandspacesareusuallyinvisible,whichmakesthemhardtodebug,sotrytofindaneditorthatmanagesindentationforyou.
en.wikibooks.org/wiki/Think_Python/Print_version
34/282
10/24/13
Glossary
function:Anamedsequenceofstatementsthatperformssome usefuloperation.Functionsmayormaynottakeargumentsandmayormaynotproducearesult. functiondefinition:Astatementthatcreatesanewfunction, specifyingitsname,parameters,andthestatementsitexecutes. functionobject:Avaluecreatedbyafunctiondefinition. Thenameofthefunctionisavariablethatreferstoafunctionobject. header:Thefirstlineofafunctiondefinition. body:Thesequenceofstatementsinsideafunctiondefinition. parameter:Anameusedinsideafunctiontorefertothevalue passedasanargument. functioncall:Astatementthatexecutesafunction.It consistsofthefunctionnamefollowedbyanargumentlist. argument:Avalueprovidedtoafunctionwhenthefunctioniscalled. Thisvalueisassignedtothecorrespondingparameterinthefunction. localvariable:Avariabledefinedinsideafunction.Alocal variablecanonlybeusedinsideitsfunction.
en.wikibooks.org/wiki/Think_Python/Print_version 35/282
10/24/13
returnvalue:Theresultofafunction.Ifafunctioncall isusedasanexpression,thereturnvalueisthevalueoftheexpression. fruitfulfunction:Afunctionthatreturnsavalue. voidfunction:Afunctionthatdoesn'treturnavalue. module:Afilethatcontainsa collectionofrelatedfunctionsandotherdefinitions. importstatement:Astatementthatreadsamodulefileandcreates amoduleobject. moduleobject:Avaluecreatedbyanimportstatement thatprovidesaccesstothevaluesdefinedinamodule. dotnotation:Thesyntaxforcallingafunctioninanother modulebyspecifyingthemodulenamefollowedbyadot(period)andthefunctionname. composition:Usinganexpressionaspartofalargerexpression, orastatementaspartofalargerstatement. flowofexecution:Theorderinwhichstatementsareexecutedduring aprogramrun. stackdiagram:Agraphicalrepresentationofastackoffunctions, theirvariables,andthevaluestheyreferto. frame:Aboxinastackdiagramthatrepresentsafunctioncall. Itcontainsthelocalvariablesandparametersofthefunction. traceback:Alistofthefunctionsthatareexecuting, printedwhenanexceptionoccurs.
Exercises
en.wikibooks.org/wiki/Think_Python/Print_version 36/282
10/24/13
Exercise3
Pythonprovidesabuiltinfunctioncalledlenthat returnsthelengthofastring,sothevalueof l e n ( ' a l l e n ' ) is5. Writeafunctionnamed r i g h t _ j u s t i f y thattakesastringnamedsasaparameterandprintsthestringwithenoughleadingspacessothatthelastletterofthe stringisincolumn70ofthedisplay.
' ' > > >r i g h t _ j u s t i f y ( ' a l l e n ' ) a l l e n ' '
Exercise4
Afunctionobjectisavalueyoucanassigntoavariableorpassasanargument.Forexample, d o _ t w i c e isafunctionthattakesafunctionobjectasan argumentandcallsittwice:
1. Typethisexampleintoascriptandtestit. 2. Modify d o _ t w i c e sothatittakestwoarguments,afunctionobjectandavalue,andcallsthefunctiontwice,passingthevalueasanargument. 3. Writeamoregeneralversionof p r i n t _ s p a m ,called p r i n t _ t w i c e ,thattakesastringasaparameterandprintsittwice. 4. Usethemodifiedversionof d o _ t w i c e tocall p r i n t _ t w i c e twice,passing ' s p a m ' asanargument. 5. Defineanewfunctioncalled d o _ f o u r thattakesafunctionobjectandavalueandcallsthefunctionfourtimes,passingthevalueasaparameter.There shouldbeonlytwostatementsinthebodyofthisfunction,notfour. Youcanseemysolutionatthinkpython.com/code/do_four.py.
en.wikibooks.org/wiki/Think_Python/Print_version 37/282
10/24/13
Exercise5
Thisexercise' canbedoneusingonlythestatementsandotherfeatureswehavelearnedsofar. 1. Writeafunctionthatdrawsagridlikethefollowing:
' ' +----+----+ | | | | | | | | | | | | +----+----+ | | | | | | | | | | | | +----+----+ ' '
Hint:toprintmorethanonevalueonaline,youcanprintacommaseparatedsequence:
' ' p r i n t' + ' ,' '' '
Ifthesequenceendswithacomma,Pythonleavesthelineunfinished,sothevalueprintednextappearsonthesameline.
' ' p r i n t' + ' ,p r i n t' '' '
Casestudy:interfacedesign
TurtleWorld
en.wikibooks.org/wiki/Think_Python/Print_version
Toaccompanythisbook,IhavewrittenasuiteofmodulescalledSwampy.OneofthesemodulesisTurtleWorld,whichprovidesasetoffunctionsfordrawing 38/282
10/24/13
TurtleWorldprovidesseveralturtlesteeringfunctions: f d and b k forforwardandbackward,and l t and r t forleftandrightturns.Also,eachTurtleisholdinga pen,whichiseitherdownorupifthepenisdown,theTurtleleavesatrailwhenitmoves.Thefunctions p u and p d standforpenupandpendown. Todrawarightangle,addtheselinestotheprogram(aftercreating b o b andbeforecalling w a i t _ f o r _ u s e r ):
f d ( b o b ,1 0 0 ) r t ( b o b ) f d ( b o b ,1 0 0 )
Simplerepetition
en.wikibooks.org/wiki/Think_Python/Print_version 39/282
10/24/13
Chancesareyouwrotesomethinglikethis(leavingoutthecodethatcreatesTurtleWorldandwaitsfortheuser):
f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 ) l t ( b o b ) f d ( b o b ,1 0 0 )
Youshouldseesomethinglikethis:
H e l l o ! H e l l o ! H e l l o ! H e l l o !
10/24/13
Exercises
ThefollowingisaseriesofexercisesusingTurtleWorld.Theyaremeanttobefun,buttheyhaveapoint,too.Whileyouareworkingonthem,thinkabout whatthepointis. Thefollowingsectionshavesolutionstotheexercises,sodontlookuntilyouhavefinished(oratleasttried). Writeafunctioncalled s q u a r e thattakesaparameter named t ,whichisaturtle.Itshouldusetheturtletodrawasquare.Writeafunctioncallthatpasses b o b asanargumentto s q u a r e ,andthenruntheprogram again. Addanotherparameter,named l e n g t h ,to s q u a r e . Modifythebodysolengthofthesidesis l e n g t h ,andthenmodifythefunctioncalltoprovideasecondargument.Runtheprogramagain.Testyourprogram witharangeofvaluesfor l e n g t h . Thefunctions l t and r t make90degreeturnsby default,butyoucanprovideasecondargumentthatspecifiesthenumberofdegrees.Forexample, l t ( b o b ,4 5 ) turns b o b 45degreestotheleft.Makeacopyof s q u a r e andchangethenameto p o l y g o n .Addanotherparameternamed n andmodifythebodysoitdrawsannsidedregularpolygon.Hint:Theanglesofann sidedregularpolygonare360.0/ ndegrees.
Hint:figureoutthecircumferenceofthecircleandmakesurethat l e n g t h*n=c i r c u m f e r e n c e . Anotherhint:if b o b istooslowforyou,youcanspeedhimupbychanging b o b . d e l a y ,whichisthetimebetweenmoves,inseconds. b o b . d e l a y=0 . 0 1 oughttoget himmoving. Makeamoregeneralversionof c i r c l e called a r c
en.wikibooks.org/wiki/Think_Python/Print_version 41/282
10/24/13
Encapsulation
Thefirstexerciseasksyoutoputyoursquaredrawingcodeintoafunctiondefinitionandthencallthefunction,passingtheturtleasaparameter.Hereisa solution:
d e fs q u a r e ( t ) : f o rii nr a n g e ( 4 ) : f d ( t ,1 0 0 ) l t ( t ) s q u a r e ( b o b )
Theinnermoststatements, f d and l t areindentedtwicetoshowthattheyareinsidethe f o r loop,whichisinsidethefunctiondefinition.Thenextline, s q u a r e ( b o b ) ,isflushwiththeleftmargin,sothatistheendofboththe f o r loopandthefunctiondefinition. Insidethefunction, t referstothesameturtle b o b refersto,so l t ( t ) hasthesameeffectas l t ( b o b ) .Sowhynotcalltheparameter b o b ?Theideaisthat t canbe anyturtle,notjust b o b ,soyoucouldcreateasecondturtleandpassitasanargumentto s q u a r e :
r a y=T u r t l e ( ) s q u a r e ( r a y )
Generalization
Thenextstepistoadda l e n g t h parameterto s q u a r e .Hereisasolution:
d e fs q u a r e ( t ,l e n g t h ) : f o rii nr a n g e ( 4 ) : f d ( t ,l e n g t h ) l t ( t ) s q u a r e ( b o b ,1 0 0 )
10/24/13
Thisdrawsa7sidedpolygonwithsidelength70.Ifyouhavemorethanafewnumericarguments,itiseasytoforgetwhattheyare,orwhatordertheyshould bein.Itislegal,andsometimeshelpful,toincludethenamesoftheparametersintheargumentlist:
p o l y g o n ( b o b ,n = 7 ,l e n g t h = 7 0 )
Interfacedesign
Thenextstepistowrite c i r c l e ,whichtakesaradius, r ,asaparameter.Hereisasimplesolutionthatuses p o l y g o n todrawa50sidedpolygon:
d e fc i r c l e ( t ,r ) : c i r c u m f e r e n c e=2*m a t h . p i*r n=5 0 l e n g t h=c i r c u m f e r e n c e/n p o l y g o n ( t ,n ,l e n g t h )
approximatesacirclewithradius r . Onelimitationofthissolutionisthat n isaconstant,whichmeansthatforverybigcircles,thelinesegmentsaretoolong,andforsmallcircles,wewastetime drawingverysmallsegments.Onesolutionwouldbetogeneralizethefunctionbytaking n asaparameter.Thiswouldgivetheuser(whoevercalls c i r c l e )more control,buttheinterfacewouldbelessclean. The interfaceofafunctionisasummaryofhowitisused:whataretheparameters?Whatdoesthefunctiondo?Andwhatisthereturnvalue?Aninterfaceis cleanifitisassimpleaspossible,butnotsimpler.(Einstein) Inthisexample, r belongsintheinterfacebecauseitspecifiesthecircletobedrawn. n islessappropriatebecauseitpertainstothedetailsof howthecircle shouldberendered.
en.wikibooks.org/wiki/Think_Python/Print_version 43/282
10/24/13
Ratherthanclutteruptheinterface,itisbettertochooseanappropriatevalueof n dependingon c i r c u m f e r e n c e :
d e fc i r c l e ( t ,r ) : c i r c u m f e r e n c e=2*m a t h . p i*r n=i n t ( c i r c u m f e r e n c e/3 )+1 l e n g t h=c i r c u m f e r e n c e/n p o l y g o n ( t ,n ,l e n g t h )
Refactoring
WhenIwrote c i r c l e ,Iwasabletoreuse p o l y g o n becauseamanysidedpolygonisagoodapproximationofacircle.But a r c isnotascooperativewecantuse p o l y g o n or c i r c l e todrawanarc. Onealternativeistostartwithacopyof p o l y g o n andtransformitinto a r c .Theresultmightlooklikethis:
d e fa r c ( t ,r ,a n g l e ) : a r c _ l e n g t h=r*m a t h . r a d i a n s ( a n g l e ) n=i n t ( a r c _ l e n g t h/3 )+1 s t e p _ l e n g t h=a r c _ l e n g t h/n s t e p _ a n g l e=f l o a t ( a n g l e )/n f o rii nr a n g e ( n ) : f d ( t ,s t e p _ l e n g t h ) l t ( t ,s t e p _ a n g l e )
10/24/13
Finally,wecanrewrite c i r c l e touse a r c :
d e fc i r c l e ( t ,r ) : a r c ( t ,r ,3 6 0 )
Adevelopmentplan
A developmentplanisaprocessforwritingprograms.Theprocessweusedinthiscasestudyisencapsulationandgeneralization.Thestepsofthisprocess are: Startbywritingasmallprogramwithnofunctiondefinitions. Onceyougettheprogramworking,encapsulateitinafunction andgiveitaname. Generalizethefunctionbyaddingappropriateparameters. Repeatsteps13untilyouhaveasetofworkingfunctions. Copyandpasteworkingcodetoavoidretyping(andredebugging). Lookforopportunitiestoimprovetheprogrambyrefactoring. Forexample,ifyouhavesimilarcodeinseveralplaces,considerfactoringitintoanappropriatelygeneralfunction. Thisprocesshassomedrawbackswewillseealternativeslaterbutitcanbeusefulifyoudontknowaheadoftimehowtodividetheprograminto functions.Thisapproachletsyoudesignasyougoalong.
docstring
en.wikibooks.org/wiki/Think_Python/Print_version
45/282
10/24/13
A docstringisastringatthebeginningofafunctionthatexplainstheinterface(docisshortfordocumentation).Hereisanexample:
d e fp o l y l i n e ( t ,l e n g t h ,n ,a n g l e ) : " " " D r a wnl i n es e g m e n t sw i t ht h eg i v e nl e n g t ha n d a n g l e( i nd e g r e e s )b e t w e e nt h e m . ti sat u r t l e . " " " f o rii nr a n g e ( n ) : f d ( t ,l e n g t h ) l t ( t ,a n g l e )
Debugging
Aninterfaceislikeacontractbetweenafunctionandacaller.Thecalleragreestoprovidecertainparametersandthefunctionagreestodocertainwork. Forexample, p o l y l i n e requiresfourarguments.ThefirsthastobeaTurtle(orsomeotherobjectthatworkswith f d and l t ).Thesecondhastobeanumber, anditshouldprobablybepositive,althoughitturnsoutthatthefunctionworksevenifitisnt.Thethirdargumentshouldbeaninteger r a n g e complains otherwise(dependingonwhichversionofPythonyouarerunning).Thefourthhastobeanumber,whichisunderstoodtobeindegrees. Theserequirementsarecalled preconditionsbecausetheyaresupposedtobetruebeforethefunctionstartsexecuting.Conversely,conditionsattheendof thefunctionare postconditions.Postconditionsincludetheintendedeffectofthefunction(likedrawinglinesegments)andanysideeffects(likemovingthe TurtleormakingotherchangesintheWorld). Preconditionsaretheresponsibilityofthecaller.Ifthecallerviolatesa(properlydocumented!)preconditionandthefunctiondoesntworkcorrectly,thebugis inthecaller,notthefunction.However,forpurposesofdebuggingitisoftenagoodideaforfunctionstochecktheirpreconditionsratherthanassumetheyare true.Ifeveryfunctionchecksitspreconditionsbeforestarting,thenifsomethinggoeswrong,youwillknowwhichfunctiontoblame.
Glossary
instance: Amemberofaset.TheTurtleWorldinthischapterisamemberofthesetofTurtleWorlds. loop: Apartofaprogramthatcanexecuterepeatedly. encapsulation: Theprocessoftransformingasequenceofstatementsintoafunctiondefinition.
en.wikibooks.org/wiki/Think_Python/Print_version 46/282
10/24/13
generalization: Theprocessofreplacingsomethingunnecessarilyspecific(likeanumber)withsomethingappropriatelygeneral(likeavariableorparameter). keywordargument: Anargumentthatincludesthenameoftheparameterasakeyword. interface: Adescriptionofhowtouseafunction,includingthenameanddescriptionsoftheargumentsandreturnvalue. developmentplan: Aprocessforwritingprograms. docstring: Astringthatappearsinafunctiondefinitiontodocumentthefunctionsinterface. precondition: Arequirementthatshouldbesatisfiedbythecallerbeforeafunctionstarts. postcondition: Arequirementthatshouldbesatisfiedbythefunctionbeforeitends.
Exercises
Exercise1 Downloadthecodeinthischapterfrom't h i n k p y t h o n . c o m / c o d e / p o l y g o n . p y '. Writeappropriatedocstringsfor'p o l y g o n ','a r c 'and 'c i r c l e '. Drawastackdiagramthatshowsthestateoftheprogram whileexecuting'c i r c l e ( b o b ,r a d i u s ) '.Youcandothearithmeticbyhandoradd'p r i n t 'statementstothecode. Theversionof'a r c 'inSection'4.7'isnot veryaccuratebecausethelinearapproximationofthecircleisalwaysoutsidethetruecircle.Asaresult,theturtleendsupafewunitsawayfromthecorrect destination.Mysolutionshowsawaytoreducetheeffectofthiserror.Readthecodeandseeifitmakessensetoyou.Ifyoudrawadiagram,youmightsee howitworks. Exercise2 Writeanappropriatelygeneralsetoffunctionsthat candrawflowerslikethis: <IMGSRC="book005.png"> Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / f l o w e r . p y '. Exercise3 Writeanappropriatelygeneralsetoffunctionsthat candrawshapeslikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 47/282
10/24/13
<IMGSRC="book006.png"> Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / p i e . p y '. Exercise4 '' Thelettersofthealphabetcanbeconstructedfromamoderatenumberofbasicelements,likeverticalandhorizontallinesandafewcurves.Designafont thatcanbedrawnwithaminimalnumberofbasicelementsandthenwritefunctionsthatdrawlettersofthealphabet. Youshouldwriteonefunctionforeachletter,withnames d r a w _ a , d r a w _ b ,etc.,andputyourfunctionsinafilenamed'l e t t e r s . p y '.Youcandownloadaturtle typewriterfrom't h i n k p y t h o n . c o m / c o d e / t y p e w r i t e r . p y 'tohelpyoutestyourcode. Youcandownloadasolutionfrom't h i n k p y t h o n . c o m / c o d e / l e t t e r s . p y '.
Conditionalandrecursion
Modulusoperator
The modulusoperatorworksonintegersandyieldstheremainderwhenthefirstoperandisdividedbythesecond.InPython,themodulusoperatorisa percentsign(% ).Thesyntaxisthesameasforotheroperators:
> > >q u o t i e n t=7/ /3 > > >p r i n t ( q u o t i e n t ) 2 > > >r e m a i n d e r=7%3 > > >p r i n t ( r e m a i n d e r ) 1
So7dividedby3is2with1leftover. Themodulusoperatorturnsouttobesurprisinglyuseful.Forexample,youcancheckwhetheronenumberisdivisiblebyanotherif x%y iszero,then x is divisibleby y . Also,youcanextracttherightmostdigitordigitsfromanumber.Forexample, x%1 0 yieldstherightmostdigitof x (inbase10).Similarly x%1 0 0 yieldsthe lasttwodigits.
Booleanexpressions
A booleanexpressionisanexpressionthatiseithertrueorfalse.Thefollowingexamplesusetheoperator = = ,whichcomparestwooperandsandproduces T r u e iftheyareequaland F a l s e otherwise:
> > >5= =5 T r u e
en.wikibooks.org/wiki/Think_Python/Print_version 48/282
10/24/13
> > >t y p e ( T r u e ) < t y p e' b o o l ' > > > >t y p e ( F a l s e ) < t y p e' b o o l ' >
Logicaloperators
Therearethree logicaloperators: a n d , o r ,and n o t .Thesemantics(meaning)oftheseoperatorsissimilartotheirmeaninginEnglish.Forexample, x>0a n dx <1 0 istrueonlyif x isgreaterthan0 andlessthan10.
n % 2= =0o rn % 3= =0 istrueif eitheroftheconditionsistrue,thatis,ifthenumberisdivisibleby2 or3.
Thisflexibilitycanbeuseful,buttherearesomesubtletiestoitthatmightbeconfusing.Youmightwanttoavoidit(unlessyouknowwhatyouaredoing).
Conditionalexecution
Inordertowriteusefulprograms,wealmostalwaysneedtheabilitytocheckconditionsandchangethebehavioroftheprogramaccordingly. Conditional
en.wikibooks.org/wiki/Think_Python/Print_version
49/282
10/24/13
#n e e dt oh a n d l en e g a t i v ev a l u e s !
Alternativeexecution
Asecondformofthe i f statementis alternativeexecution,inwhichtherearetwopossibilitiesandtheconditiondetermineswhichonegetsexecuted.The syntaxlookslikethis:
i fx%2= =0 : p r i n t' xi se v e n ' e l s e : p r i n t' xi so d d '
Chainedconditionals
Sometimestherearemorethantwopossibilitiesandweneedmorethantwobranches.Onewaytoexpressacomputationlikethatisa chainedconditional :
i fx<y : p r i n t' xi sl e s st h a ny ' e l i fx>y : p r i n t' xi sg r e a t e rt h a ny ' e l s e : p r i n t' xa n dya r ee q u a l '
10/24/13
hastobeattheend,buttheredoesnthavetobeone.
i fc h o i c e= =' a ' : d r a w _ a ( ) e l i fc h o i c e= =' b ' : d r a w _ b ( ) e l i fc h o i c e= =' c ' : d r a w _ c ( )
Eachconditionischeckedinorder.Ifthefirstisfalse,thenextischecked,andsoon.Ifoneofthemistrue,thecorrespondingbranchexecutes,andthe statementends.Evenifmorethanoneconditionistrue,onlythefirsttruebranchexecutes.
Nestedconditionals
Oneconditionalcanalsobenestedwithinanother.Wecouldhavewrittenthetrichotomyexamplelikethis:
i fx= =y : p r i n t' xa n dya r ee q u a l ' e l s e : i fx<y : p r i n t' xi sl e s st h a ny ' e l s e : p r i n t' xi sg r e a t e rt h a ny '
en.wikibooks.org/wiki/Think_Python/Print_version
51/282
10/24/13
Recursion
Itislegalforonefunctiontocallanotheritisalsolegalforafunctiontocallitself.Itmaynotbeobviouswhythatisagoodthing,butitturnsouttobeoneof themostmagicalthingsaprogramcando.Forexample,lookatthefollowingfunction:
d e fc o u n t d o w n ( n ) : i fn< =0 : p r i n t' B l a s t o f f ! ' e l s e : p r i n tn c o u n t d o w n ( n 1 )
Theexecutionof c o u n t d o w n beginswith n = 0 ,andsince n isnotgreaterthan0,itoutputstheword,Blastoff!andthen returns. The c o u n t d o w n thatgot n = 1 returns. The c o u n t d o w n thatgot n = 2 returns. The c o u n t d o w n thatgot n = 3 returns. Andthenyourebackin _ _ m a i n _ _ .So,thetotaloutputlookslikethis:
3 2 1 B l a s t o f f !
en.wikibooks.org/wiki/Think_Python/Print_version 52/282
10/24/13
If n< =0 the r e t u r n statementexitsthefunction.Theflowofexecutionimmediatelyreturnstothecaller,andtheremaininglinesofthefunctionarenot executed. Therestofthefunctionissimilarto c o u n t d o w n :if n isgreaterthan0,itdisplays s andthencallsitselftodisplay s n1additionaltimes.Sothenumberoflinesof outputis 1+( n-1 ) ,whichaddsupto n . Forsimpleexampleslikethis,itisprobablyeasiertousea f o r loop.Butwewillseeexampleslaterthatarehardtowritewitha f o r loopandeasytowritewith recursion,soitisgoodtostartearly.
Stackdiagramsforrecursivefunctions
InSection3.10,weusedastackdiagramtorepresentthestateofaprogramduringafunctioncall.Thesamekindofdiagramcanhelpinterpretarecursive function. Everytimeafunctiongetscalled,Pythoncreatesanewfunctionframe,whichcontainsthefunctionslocalvariablesandparameters.Forarecursivefunction, theremightbemorethanoneframeonthestackatthesametime. Thisfigureshowsastackdiagramfor c o u n t d o w n calledwith n=3 : <IMGSRC="book007.png"> Asusual,thetopofthestackistheframefor _ _ m a i n _ _ .Itisemptybecausewedidnotcreateanyvariablesin _ _ m a i n _ _ orpassanyargumentstoit. Thefour c o u n t d o w n frameshavedifferentvaluesfortheparameter n .Thebottomofthestack,where n = 0 ,iscalledthe basecase.Itdoesnotmakearecursive call,sotherearenomoreframes. Drawastackdiagramfor p r i n t _ n calledwith s=' H e l l o ' and n = 2 . Writeafunctioncalled d o _ n thattakesafunctionobjectandanumber, n asarguments,andthatcallsthegivenfunction n times.
Infiniterecursion
Ifarecursionneverreachesabasecase,itgoesonmakingrecursivecallsforever,andtheprogramneverterminates.Thisisknownas infiniterecursion, anditisgenerallynotagoodidea.Hereisaminimalprogramwithaninfiniterecursion:
en.wikibooks.org/wiki/Think_Python/Print_version 53/282
10/24/13
d e fr e c u r s e ( ) : r e c u r s e ( )
Inmostprogrammingenvironments,aprogramwithinfiniterecursiondoesnotreallyrunforever.Pythonreportsanerrormessagewhenthemaximum recursiondepthisreached:
F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e . . . F i l e" < s t d i n > " ,l i n e2 ,i nr e c u r s e R u n t i m e E r r o r :M a x i m u mr e c u r s i o nd e p t he x c e e d e d
Thistracebackisalittlebiggerthantheonewesawinthepreviouschapter.Whentheerroroccurs,thereare1000 r e c u r s e framesonthestack!
Keyboardinput
Theprogramswehavewrittensofarareabitrudeinthesensethattheyacceptnoinputfromtheuser.Theyjustdothesamethingeverytime. Pythonprovidesabuiltinfunctioncalled r a w _ i n p u t thatgetsinputfromthekeyboard[1].Whenthisfunctioniscalled,theprogramstopsandwaitsfortheuserto typesomething.WhentheuserpressesReturnorEnter,theprogramresumesand r a w _ i n p u t returnswhattheusertypedasastring.
> > >i n p u t=r a w _ i n p u t ( ) W h a ta r ey o uw a i t i n gf o r ? > > >p r i n ti n p u t W h a ta r ey o uw a i t i n gf o r ?
Beforegettinginputfromtheuser,itisagoodideatoprintaprompttellingtheuserwhattoinput. r a w _ i n p u t cantakeapromptasanargument:
> > >n a m e=r a w _ i n p u t ( ' W h a t . . . i sy o u rn a m e ? \ n ' ) W h a t . . . i sy o u rn a m e ? A r t h u r ,K i n go ft h eB r i t o n s ! > > >p r i n tn a m e A r t h u r ,K i n go ft h eB r i t o n s !
10/24/13
> > >p r o m p t=' W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? \ n ' > > >s p e e d=r a w _ i n p u t ( p r o m p t ) W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? 1 7 > > >i n t ( s p e e d ) 1 7
Butiftheusertypessomethingotherthanastringofdigits,yougetanerror:
> > >s p e e d=r a w _ i n p u t ( p r o m p t ) W h a t . . . i st h ea i r s p e e dv e l o c i t yo fa nu n l a d e ns w a l l o w ? W h a td oy o um e a n ,a nA f r i c a no raE u r o p e a ns w a l l o w ? > > >i n t ( s p e e d ) V a l u e E r r o r :i n v a l i dl i t e r a lf o ri n t ( )
Wewillseehowtohandlethiskindoferrorlater.
Debugging
ThetracebackPythondisplayswhenanerroroccurscontainsalotofinformation,butitcanbeoverwhelming,especiallywhentherearemanyframesonthe stack.Themostusefulpartsareusually: Whatkindoferroritwas,and Whereitoccurred. Syntaxerrorsareusuallyeasytofind,butthereareafewgotchas.Whitespaceerrorscanbetrickybecausespacesandtabsareinvisibleandweareusedto ignoringthem.
> > >x=5 > > > y=6 F i l e" < s t d i n > " ,l i n e1 y=6 ^ S y n t a x E r r o r :i n v a l i ds y n t a x
10/24/13
Butwhenyourunit,yougetanerrormessage:
T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" s n r . p y " ,l i n e5 ,i n? d e c i b e l s=1 0*m a t h . l o g 1 0 ( r a t i o ) O v e r f l o w E r r o r :m a t hr a n g ee r r o r
Glossary
modulusoperator: Anoperator,denotedwithapercentsign(% ),thatworksonintegersandyieldstheremainderwhenonenumberisdividedbyanother. booleanexpression: Anexpressionwhosevalueiseither T r u e or F a l s e . comparisonoperator: Oneoftheoperatorsthatcomparesitsoperands: = = , ! = , > , < , > = ,and < = . logicaloperator: Oneoftheoperatorsthatcombinesbooleanexpressions: a n d , o r ,and n o t . conditionalstatement: Astatementthatcontrolstheflowofexecutiondependingonsomecondition. condition: Thebooleanexpressioninaconditionalstatementthatdetermineswhichbranchisexecuted. compoundstatement: Astatementthatconsistsofaheaderandabody.Theheaderendswithacolon(:).Thebodyisindentedrelativetotheheader. body: Thesequenceofstatementswithinacompoundstatement. branch: Oneofthealternativesequencesofstatementsinaconditionalstatement.
en.wikibooks.org/wiki/Think_Python/Print_version 56/282
10/24/13
chainedconditional: Aconditionalstatementwithaseriesofalternativebranches. nestedconditional: Aconditionalstatementthatappearsinoneofthebranchesofanotherconditionalstatement. recursion: Theprocessofcallingthefunctionthatiscurrentlyexecuting. basecase: Aconditionalbranchinarecursivefunctionthatdoesnotmakearecursivecall. infiniterecursion: Afunctionthatcallsitselfrecursivelywithouteverreachingthebasecase.Eventually,aninfiniterecursioncausesaruntimeerror.
Exercises
Exercise1 FermatsLastTheoremsaysthattherearenointegers'a','b',and'c'suchthat an+ bn= cn foranyvaluesof'n'greaterthan2. Writeafunctionnamed c h e c k _ f e r m a t thattakesfour parameters'a ','b ','c 'and'n 'andthatcheckstoseeifFermatstheoremholds.If 'n'isgreaterthan2anditturnsouttobetruethat 'a''n ' '+ b''n ' '= c''n ' '' 'theprogramshouldprint,Holysmokes,Fermatwaswrong!Otherwisetheprogramshouldprint,No,thatdoesntwork.' 'Writeafunctionthatpromptstheusertoinputvalues for'''a ''','''b ''','''c '''and'''n ''',convertsthemtointegers,anduses'' c h e c k _ f e r m a t ' 'tocheckwhethertheyviolateFermatstheorem.' Exercise2 Ifyouaregiventhreesticks,youmayormaynotbeabletoarrangetheminatriangle.Forexample,ifoneofthesticksis12incheslongandthe othertwoareoneinchlong,itisclearthatyouwillnotbeabletogettheshortstickstomeetinthemiddle.Foranythreelengths,thereisasimpletesttosee ifitispossibletoformatriangle: Ifanyofthethreelengthsisgreaterthanthesumoftheothertwo,thenyoucannotformatriangle.Otherwise,youcan[2]. Writeafunctionnamed i s _ t r i a n g l e thattakesthree
en.wikibooks.org/wiki/Think_Python/Print_version
57/282
10/24/13
Exercise4 TheKochcurveisafractalthatlookssomethinglikethis: <IMGSRC="book008.png"> TodrawaKochcurvewithlength'x',allyouhavetodois DrawaKochcurvewithlength'x/3'. Turnleft60degrees. DrawaKochcurvewithlength'x/3'. Turnright120degrees. DrawaKochcurvewithlength'x/3'. Turnleft60degrees. DrawaKochcurvewithlength'x/3'.
en.wikibooks.org/wiki/Think_Python/Print_version 58/282
10/24/13
Theonlyexceptionisif'x'islessthan3.Inthatcase, youcanjustdrawastraightlinewithlength'x'. Writeafunctioncalled'k o c h 'thattakesaturtleand alengthasparameters,andthatusestheturtletodrawaKochcurvewiththegivenlength. Writeafunctioncalled's n o w f l a k e 'thatdrawsthree Kochcurvestomaketheoutlineofasnowflake. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / k o c h . p y '. TheKochcurvecanbegeneralizedinseveralways.See 'w i k i p e d i a . o r g / w i k i / K o c h _ s n o w f l a k e 'forexamplesandimplementyourfavorite.
Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
Fruitfulfunctions
Returnvalues
Someofthebuiltinfunctionswehaveused,suchasthemathfunctions,produceresults.Callingthefunctiongeneratesavalue,whichweusuallyassigntoa variableoruseaspartofanexpression.
e=m a t h . e x p ( 1 . 0 ) h e i g h t=r a d i u s*m a t h . s i n ( r a d i a n s )
10/24/13
r e t u r nm a t h . p i*r a d i u s * * 2
Bytheway,Pythonprovidesabuiltinfunctioncalled a b s thatcomputesabsolutevalues.
Exercise1
Writea'c o m p a r e 'functionthatreturns'1 'if'x>y ','0 'if'x= =y ',and'1 'if'x<y '.
Incrementaldevelopment
Asyouwritelargerfunctions,youmightfindyourselfspendingmoretimedebugging.
en.wikibooks.org/wiki/Think_Python/Print_version
Todealwithincreasinglycomplexprograms,youmightwanttotryaprocesscalled incrementaldevelopment.Thegoalofincrementaldevelopmentisto
60/282
10/24/13
10/24/13
Again,youwouldruntheprogramatthisstageandchecktheoutput(whichshouldbe25).Finally,youcanuse m a t h . s q r t tocomputeandreturntheresult:
d e fd i s t a n c e ( x 1 ,y 1 ,x 2 ,y 2 ) : d x=x 2-x 1 d y=y 2-y 1 d s q u a r e d=d x * * 2+d y * * 2 r e s u l t=m a t h . s q r t ( d s q u a r e d ) r e t u r nr e s u l t
Ifthatworkscorrectly,youaredone.Otherwise,youmightwanttoprintthevalueof r e s u l t beforethereturnstatement. Thefinalversionofthefunctiondoesntdisplayanythingwhenitrunsitonlyreturnsavalue.The p r i n t statementswewroteareusefulfordebugging,butonce yougetthefunctionworking,youshouldremovethem.Codelikethatiscalled scaffoldingbecauseitishelpfulforbuildingtheprogrambutisnotpartofthe finalproduct. Whenyoustartout,youshouldaddonlyalineortwoofcodeatatime.Asyougainmoreexperience,youmightfindyourselfwritinganddebuggingbigger chunks.Eitherway,incrementaldevelopmentcansaveyoualotofdebuggingtime. Thekeyaspectsoftheprocessare: Startwithaworkingprogramandmakesmallincrementalchanges.Atanypoint,ifthereisanerror,youshouldhaveagoodideawhereitis. Usetemporaryvariablestoholdintermediatevaluessoyoucandisplayandcheckthem. Oncetheprogramisworking,youmightwanttoremovesomeofthescaffoldingorconsolidatemultiplestatementsintocompoundexpressions,but onlyifitdoesnotmaketheprogramdifficulttoread.
Exercise2
Useincrementaldevelopmenttowriteafunctioncalled'h y p o t e n u s e 'thatreturnsthelengthofthehypotenuseofarighttrianglegiventhelengthsofthetwolegs asarguments.Recordeachstageofthedevelopmentprocessasyougo.
Composition
Asyoushouldexpectbynow,youcancallonefunctionfromwithinanother.Thisabilityiscalled composition. Asanexample,wellwriteafunctionthattakestwopoints,thecenterofthecircleandapointontheperimeter,andcomputestheareaofthecircle. Assumethatthecenterpointisstoredinthevariables x c and y c ,andtheperimeterpointisin x p and y p .Thefirststepistofindtheradiusofthecircle,whichis en.wikibooks.org/wiki/Think_Python/Print_version 62/282
10/24/13
Thenextstepistofindtheareaofacirclewiththatradiuswejustwrotethat,too:
r e s u l t=a r e a ( r a d i u s )
Encapsulatingthesestepsinafunction,weget:
d e fc i r c l e _ a r e a ( x c ,y c ,x p ,y p ) : r a d i u s=d i s t a n c e ( x c ,y c ,x p ,y p ) r e s u l t=a r e a ( r a d i u s ) r e t u r nr e s u l t
Booleanfunctions
Functionscanreturnbooleans,whichisoftenconvenientforhidingcomplicatedtestsinsidefunctions.Forexample:
d e fi s _ d i v i s i b l e ( x ,y ) : i fx%y= =0 : r e t u r nT r u e e l s e : r e t u r nF a l s e
10/24/13
Theresultofthe = = operatorisaboolean,sowecanwritethefunctionmoreconciselybyreturningitdirectly:
d e fi s _ d i v i s i b l e ( x ,y ) : r e t u r nx%y= =0
Booleanfunctionsareoftenusedinconditionalstatements:
i fi s _ d i v i s i b l e ( x ,y ) : p r i n t' xi sd i v i s i b l eb yy '
Itmightbetemptingtowritesomethinglike:
i fi s _ d i v i s i b l e ( x ,y )= =T r u e : p r i n t' xi sd i v i s i b l eb yy '
Morerecursion
WehaveonlycoveredasmallsubsetofPython,butyoumightbeinterestedtoknowthatthissubsetisa completeprogramminglanguage,whichmeansthat anythingthatcanbecomputedcanbeexpressedinthislanguage.Anyprogrameverwrittencouldberewrittenusingonlythelanguagefeaturesyouhave learnedsofar(actually,youwouldneedafewcommandstocontroldeviceslikethekeyboard,mouse,disks,etc.,butthatsall). ProvingthatclaimisanontrivialexercisefirstaccomplishedbyAlanTuring,oneofthefirstcomputerscientists(somewouldarguethathewasa mathematician,butalotofearlycomputerscientistsstartedasmathematicians).Accordingly,itisknownastheTuringThesis.Foramorecomplete(and accurate)discussionoftheTuringThesis,IrecommendMichaelSipsersbook IntroductiontotheTheoryofComputation. Togiveyouanideaofwhatyoucandowiththetoolsyouhavelearnedsofar,wellevaluateafewrecursivelydefinedmathematicalfunctions.Arecursive definitionissimilartoacirculardefinition,inthesensethatthedefinitioncontainsareferencetothethingbeingdefined.Atrulycirculardefinitionisnotvery useful: frabjuous: Anadjectiveusedtodescribesomethingthatisfrabjuous. Ifyousawthatdefinitioninthedictionary,youmightbeannoyed.Ontheotherhand,ifyoulookedupthedefinitionofthefactorialfunction,denotedwiththe symbol!,youmightgetsomethinglikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 64/282
10/24/13
0!=1 n!= n(n1)! Thisdefinitionsaysthatthefactorialof0is1,andthefactorialofanyothervalue, n,is nmultipliedbythefactorialof n1. So3!is3times2!,whichis2times1!,whichis1times0!.Puttingitalltogether,3!equals3times2times1times1,whichis6. Ifyoucanwritearecursivedefinitionofsomething,youcanusuallywriteaPythonprogramtoevaluateit.Thefirststepistodecidewhattheparameters shouldbe.Inthiscaseitshouldbeclearthat f a c t o r i a l takesaninteger:
d e ff a c t o r i a l ( n ) :
Iftheargumenthappenstobe0,allwehavetodoisreturn1:
d e ff a c t o r i a l ( n ) : i fn= =0 : r e t u r n1
Otherwise,andthisistheinterestingpart,wehavetomakearecursivecalltofindthefactorialof n1andthenmultiplyitby n:
d e ff a c t o r i a l ( n ) : i fn= =0 : r e t u r n1 e l s e : r e c u r s e=f a c t o r i a l ( n 1 ) r e s u l t=n*r e c u r s e r e t u r nr e s u l t
10/24/13
<IMGSRC="book009.png">
Leapoffaith
Followingtheflowofexecutionisonewaytoreadprograms,butitcanquicklybecomelabyrinthine.AnalternativeiswhatIcalltheleapoffaith.Whenyou cometoafunctioncall,insteadoffollowingtheflowofexecution,you assumethatthefunctionworkscorrectlyandreturnstherightresult. Infact,youarealreadypracticingthisleapoffaithwhenyouusebuiltinfunctions.Whenyoucall m a t h . c o s or m a t h . e x p ,youdontexaminethebodiesofthose functions.Youjustassumethattheyworkbecausethepeoplewhowrotethebuiltinfunctionsweregoodprogrammers. Thesameistruewhenyoucalloneofyourownfunctions.Forexample,inSection6.4,wewroteafunctioncalled i s _ d i v i s i b l e thatdetermineswhetherone numberisdivisiblebyanother.Oncewehaveconvincedourselvesthatthisfunctioniscorrectbyexaminingthecodeandtestingwecanusethefunction withoutlookingatthebodyagain. Thesameistrueofrecursiveprograms.Whenyougettotherecursivecall,insteadoffollowingtheflowofexecution,youshouldassumethattherecursive callworks(yieldsthecorrectresult)andthenaskyourself,AssumingthatIcanfindthefactorialof n1,canIcomputethefactorialof n?Inthiscase,itis clearthatyoucan,bymultiplyingby n. Ofcourse,it'sabitstrangetoassumethatthefunctionworkscorrectlywhenyouhaven'tfinishedwritingit,butthat'swhyit'scalledaleapoffaith!
Onemoreexample
After f a c t o r i a l ,themostcommonexampleofarecursivelydefinedmathematicalfunctionis f i b o n a c c i ,whichhasthefollowingdefinition[3]: fibonacci(0)=0
en.wikibooks.org/wiki/Think_Python/Print_version 66/282
10/24/13
Checkingtypes
Whathappensifwecall f a c t o r i a l andgiveit1.5asanargument?
> > >f a c t o r i a l ( 1 . 5 ) R u n t i m e E r r o r :M a x i m u mr e c u r s i o nd e p t he x c e e d e d
Itlookslikeaninfiniterecursion.Buthowcanthatbe?Thereisabasecasewhen n= =0 .Butif n isnotaninteger,wecan missthebasecaseandrecurse forever. Inthefirstrecursivecall,thevalueof n is0.5.Inthenext,itis0.5.Fromthere,itgetssmaller(morenegative),butitwillneverbe0. Wehavetwochoices.Wecantrytogeneralizethe f a c t o r i a l functiontoworkwithfloatingpointnumbers,orwecanmake f a c t o r i a l checkthetypeofits argument.Thefirstoptioniscalledthegammafunction[4]anditsalittlebeyondthescopeofthisbook.Sowellgoforthesecond. Wecanusethebuiltinfunction i s i n s t a n c e toverifythetypeoftheargument.Whilewereatit,wecanalsomakesuretheargumentispositive:
10/24/13
e l i fn= =0 : r e t u r n1 e l s e : r e t u r nn*f a c t o r i a l ( n 1 )
Debugging
Breakingalargeprogramintosmallerfunctionscreatesnaturalcheckpointsfordebugging.Ifafunctionisnotworking,therearethreepossibilitiestoconsider: Thereissomethingwrongwiththeargumentsthefunction isgettingapreconditionisviolated. Thereissomethingwrongwiththefunctionapostcondition isviolated. Thereissomethingwrongwiththereturnvalueorthe wayitisbeingused. Toruleoutthefirstpossibility,youcanadda p r i n t statementatthebeginningofthefunctionanddisplaythevaluesoftheparameters(andmaybetheir types).Oryoucanwritecodethatchecksthepreconditionsexplicitly. Iftheparameterslookgood,adda p r i n t statementbeforeeach r e t u r n statementthatdisplaysthereturnvalue.Ifpossible,checktheresultbyhand.Consider callingthefunctionwithvaluesthatmakeiteasytochecktheresult(asinSection6.2). Ifthefunctionseemstobeworking,lookatthefunctioncalltomakesurethereturnvalueisbeingusedcorrectly(orusedatall!). Addingprintstatementsatthebeginningandendofafunctioncanhelpmaketheflowofexecutionmorevisible.Forexample,hereisaversionof f a c t o r i a l68/282 en.wikibooks.org/wiki/Think_Python/Print_version
10/24/13
Addingprintstatementsatthebeginningandendofafunctioncanhelpmaketheflowofexecutionmorevisible.Forexample,hereisaversionof f a c t o r i a l withprintstatements:
d e ff a c t o r i a l ( n ) : s p a c e=''*( 4*n ) p r i n ts p a c e ,' f a c t o r i a l ' ,n i fn= =0 : p r i n ts p a c e ,' r e t u r n i n g1 ' r e t u r n1 e l s e : r e c u r s e=f a c t o r i a l ( n 1 ) r e s u l t=n*r e c u r s e p r i n ts p a c e ,' r e t u r n i n g ' ,r e s u l t r e t u r nr e s u l t
s p a c e isastringofspacecharactersthatcontrolstheindentationoftheoutput.Hereistheresultof f a c t o r i a l ( 5 ) :
f a c t o r i a l5 f a c t o r i a l4 f a c t o r i a l3 f a c t o r i a l2 f a c t o r i a l1 f a c t o r i a l0 r e t u r n i n g1 r e t u r n i n g1 r e t u r n i n g2 r e t u r n i n g6 r e t u r n i n g2 4 r e t u r n i n g1 2 0
Ifyouareconfusedabouttheflowofexecution,thiskindofoutputcanbehelpful.Ittakessometimetodevelopeffectivescaffolding,butalittlebitof scaffoldingcansavealotofdebugging.
Glossary
temporaryvariable: Avariableusedtostoreanintermediatevalueinacomplexcalculation. deadcode: Partofaprogramthatcanneverbeexecuted,oftenbecauseitappearsaftera r e t u r n statement. 'N o n e ': Aspecialvaluereturnedbyfunctionsthathavenoreturnstatementorareturnstatementwithoutanargument. incrementaldevelopment: Aprogramdevelopmentplanintendedtoavoiddebuggingbyaddingandtestingonlyasmallamountofcodeatatime.
en.wikibooks.org/wiki/Think_Python/Print_version 69/282
10/24/13
Exercises
Exercise4
Drawastackdiagramforthefollowingprogram.Whatdoestheprogramprint?
d e fb ( z ) : p r o d=a ( z ,z ) p r i n tz ,p r o d r e t u r np r o d d e fa ( x ,y ) : x=x+1 r e t u r nx*y d e fc ( x ,y ,z ) : s u m=x+y+z p o w=b ( s u m ) * * 2 r e t u r np o w x=1 y=x+1 p r i n tc ( x ,y + 3 ,x + y )
Exercise5
TheAckermannfunction,'A(m,n)'isdefined[5]:
1 See w i k i p e d i a . o r g / w i k i / C o l l a t z _ c o n j e c t u r e . 2 See w i k i p e d i a . o r g / w i k i / P i .
Strings
en.wikibooks.org/wiki/Think_Python/Print_version 70/282
10/24/13
Astringisasequence
Astringisa sequenceofcharacters.Youcanaccessthecharactersoneatatimewiththebracketoperator:
> > >f r u i t=' b a n a n a ' > > >l e t t e r=f r u i t [ 1 ]
l e n
l e n isabuiltinfunctionthatreturnsthenumberofcharactersinastring:
Togetthelastletterofastring,youmightbetemptedtotrysomethinglikethis:
en.wikibooks.org/wiki/Think_Python/Print_version 71/282
10/24/13
Traversalwithaf o r loop
Alotofcomputationsinvolveprocessingastringonecharacteratatime.Oftentheystartatthebeginning,selecteachcharacterinturn,dosomethingtoit, andcontinueuntiltheend.Thispatternofprocessingiscalleda traversal .Onewaytowriteatraversaliswitha w h i l e loop:
i n d e x=0 w h i l ei n d e x<l e n ( f r u i t ) : l e t t e r=f r u i t [ i n d e x ] p r i n tl e t t e r i n d e x=i n d e x+1
Thislooptraversesthestringanddisplayseachletteronalinebyitself.Theloopconditionis i n d e x<l e n ( f r u i t ) ,sowhen i n d e x isequaltothelengthofthe string,theconditionisfalse,andthebodyoftheloopisnotexecuted.Thelastcharacteraccessedistheonewiththeindex l e n ( f r u i t ) 1 ,whichisthelast characterinthestring. Exercise1 Writeafunctionthattakesastringasanargumentanddisplaysthelettersbackward,oneperline. Anotherwaytowriteatraversaliswitha f o r loop:
f o rc h a ri nf r u i t : p r i n tc h a r
Eachtimethroughtheloop,thenextcharacterinthestringisassignedtothevariable c h a r .Theloopcontinuesuntilnocharactersareleft.
en.wikibooks.org/wiki/Think_Python/Print_version 72/282
10/24/13
Theoutputis:
J a c k K a c k L a c k M a c k N a c k O a c k P a c k Q a c k
Ofcourse,thatsnotquiterightbecauseOuackandQuackaremisspelled.
Exercise2
Modifytheprogramtofixthiserror.
Stringslices
Asegmentofastringiscalleda slice.Selectingasliceissimilartoselectingacharacter:
> > >s=' M o n t yP y t h o n ' > > >p r i n ts [ 0 : 5 ] M o n t y > > >p r i n ts [ 6 : 1 3 ] P y t h o n
10/24/13
> > >f r u i t=' b a n a n a ' > > >f r u i t [ : 3 ] ' b a n ' > > >f r u i t [ 3 : ] ' a n a '
Ifthefirstindexisgreaterthanorequaltothesecondtheresultisan emptystring,representedbytwoquotationmarks:
> > >f r u i t=' b a n a n a ' > > >f r u i t [ 3 : 3 ] ' '
Anemptystringcontainsnocharactersandhaslength0,butotherthanthat,itisthesameasanyotherstring.
Exercise3
Giventhat'f r u i t 'isastring,whatdoes'f r u i t [ : ] 'mean?
Stringsareimmutable
Itistemptingtousethe [ ] operatorontheleftsideofanassignment,withtheintentionofchangingacharacterinastring.Forexample:
> > >g r e e t i n g=' H e l l o ,w o r l d ! ' > > >g r e e t i n g [ 0 ]=' J ' T y p e E r r o r :o b j e c td o e sn o ts u p p o r ti t e ma s s i g n m e n t
Thisexampleconcatenatesanewfirstletterontoasliceof g r e e t i n g .Ithasnoeffectontheoriginalstring.
Searching
en.wikibooks.org/wiki/Think_Python/Print_version 74/282
10/24/13
Whatdoesthefollowingfunctiondo?
d e ff i n d ( w o r d ,l e t t e r ) : i n d e x=0 w h i l ei n d e x<l e n ( w o r d ) : i fw o r d [ i n d e x ]= =l e t t e r : r e t u r ni n d e x i n d e x=i n d e x+1 r e t u r n1
Inasense, f i n d istheoppositeofthe [ ] operator.Insteadoftakinganindexandextractingthecorrespondingcharacter,ittakesacharacterandfindsthe indexwherethatcharacterappears.Ifthecharacterisnotfound,thefunctionreturns 1 . Thisisthefirstexamplewehaveseenofa r e t u r n statementinsidealoop.If w o r d [ i n d e x ]= =l e t t e r ,thefunctionbreaksoutoftheloopandreturnsimmediately. Ifthecharacterdoesntappearinthestring,theprogramexitstheloopnormallyandreturns 1 . Thispatternofcomputationtraversingasequenceandreturningwhenwefindwhatwearelookingforisacalleda search.
Exercise4
Modify'f i n d 'sothatithasathirdparameter,theindexin'w o r d 'whereitshouldstartlooking.
Loopingandcounting
Thefollowingprogramcountsthenumberoftimestheletter a appearsinastring:
w o r d=' b a n a n a ' c o u n t=0 f o rl e t t e ri nw o r d : i fl e t t e r= =' a ' : c o u n t=c o u n t+1 p r i n tc o u n t
en.wikibooks.org/wiki/Think_Python/Print_version
75/282
10/24/13
Rewritethisfunctionsothatinsteadoftraversingthestring,itusesthethreeparameterversionof'f i n d 'fromtheprevioussection.
s t r i n g methods
A methodissimilartoafunctionittakesargumentsandreturnsavaluebutthesyntaxisdifferent.Forexample,themethod u p p e r takesastringand returnsanewstringwithalluppercaseletters: Insteadofthefunctionsyntax u p p e r ( w o r d ) ,itusesthemethodsyntax w o r d . u p p e r ( ) .
> > >w o r d=' b a n a n a ' > > >n e w _ w o r d=w o r d . u p p e r ( ) > > >p r i n tn e w _ w o r d B A N A N A
Itcantakeasasecondargumenttheindexwhereitshouldstart:
10/24/13
Andasathirdargumenttheindexwhereitshouldstop:
> > >n a m e=' b o b ' > > >n a m e . f i n d ( ' b ' ,1 ,2 ) 1
Thei n operator
Theword i n isabooleanoperatorthattakestwostringsandreturns T r u e ifthefirstappearsasasubstringinthesecond:
> > >' a 'i n' b a n a n a ' T r u e > > >' s e e d 'i n' b a n a n a ' F a l s e
Forexample,thefollowingfunctionprintsallthelettersfrom w o r d 1 thatalsoappearin w o r d 2 :
d e fi n _ b o t h ( w o r d 1 ,w o r d 2 ) : f o rl e t t e ri nw o r d 1 : i fl e t t e ri nw o r d 2 : p r i n tl e t t e r
10/24/13
Stringcomparison
Thecomparisonoperatorsworkonstrings.Toseeiftwostringsareequal:
i fw o r d= =' b a n a n a ' : p r i n t ' A l lr i g h t ,b a n a n a s . '
Othercomparisonoperationsareusefulforputtingwordsinalphabeticalorder:
i fw o r d<' b a n a n a ' : p r i n t' Y o u rw o r d , '+w o r d+' ,c o m e sb e f o r eb a n a n a . ' e l i fw o r d>' b a n a n a ' : p r i n t' Y o u rw o r d , '+w o r d+' ,c o m e sa f t e rb a n a n a . ' e l s e : p r i n t' A l lr i g h t ,b a n a n a s . '
Pythondoesnothandleuppercaseandlowercaselettersthesamewaythatpeopledo.Alltheuppercaseletterscomebeforeallthelowercaseletters,so:
Y o u rw o r d ,P i n e a p p l e ,c o m e sb e f o r eb a n a n a .
Acommonwaytoaddressthisproblemistoconvertstringstoastandardformat,suchasalllowercase,beforeperformingthecomparison.Keepthatinmind incaseyouhavetodefendyourselfagainstamanarmedwithaPineapple.
Debugging
Whenyouuseindicestotraversethevaluesinasequence,itistrickytogetthebeginningandendofthetraversalright.Hereisafunctionthatissupposedto comparetwowordsandreturn T r u e ifoneofthewordsisthereverseoftheother,butitcontainstwoerrors:
d e fi s _ r e v e r s e ( w o r d 1 ,w o r d 2 ) : i fl e n ( w o r d 1 )! =l e n ( w o r d 2 ) : r e t u r nF a l s e i=0 j=l e n ( w o r d 2 ) w h i l ej>0 : i fw o r d 1 [ i ]! =w o r d 2 [ j ] : r e t u r nF a l s e i=i + 1 j=j 1
en.wikibooks.org/wiki/Think_Python/Print_version 78/282
10/24/13
r e t u r nT r u e
Fordebuggingthiskindoferror,myfirstmoveistoprintthevaluesoftheindicesimmediatelybeforethelinewheretheerrorappears.
w h i l ej>0 : p r i n ti ,j
#p r i n th e r e
i fw o r d 1 [ i ]! =w o r d 2 [ j ] : r e t u r nF a l s e i=i + 1 j=j 1
NowwhenIruntheprogramagain,Igetmoreinformation:
> > >i s _ r e v e r s e ( ' p o t s ' ,' s t o p ' ) 04 . . . I n d e x E r r o r :s t r i n gi n d e xo u to fr a n g e
IfIfixthaterrorandruntheprogramagain,Iget:
en.wikibooks.org/wiki/Think_Python/Print_version 79/282
10/24/13
Glossary
object: Somethingavariablecanreferto.Fornow,youcanuseobjectandvalueinterchangeably. sequence: Anorderedsetthatis,asetofvalueswhereeachvalueisidentifiedbyanintegerindex. item: Oneofthevaluesinasequence. index: Anintegervalueusedtoselectaniteminasequence,suchasacharacterinastring. slice: Apartofastringspecifiedbyarangeofindices. emptystring: Astringwithnocharactersandlength0,representedbytwoquotationmarks. immutable: Thepropertyofasequencewhoseitemscannotbeassigned. traverse: Toiteratethroughtheitemsinasequence,performingasimilaroperationoneach. search: Apatternoftraversalthatstopswhenitfindswhatitislookingfor.
en.wikibooks.org/wiki/Think_Python/Print_version 80/282
10/24/13
Exercises
Exercise9
Astringslicecantakeathirdindexthatspecifiesthestepsizethatis,thenumberofspacesbetweensuccessivecharacters.Astepsizeof2meansevery othercharacter3meanseverythird,etc.
' ' > > >f r u i t=' b a n a n a ' > > >f r u i t [ 0 : 5 : 2 ] ' b n n ' ' '
Exercise10
Readthedocumentationofthestringmethodsat'd o c s . p y t h o n . o r g / l i b / s t r i n g m e t h o d s . h t m l '.Youmightwanttoexperimentwithsomeofthemtomakesureyou understandhowtheywork.'s t r i p 'and'r e p l a c e 'areparticularlyuseful. Thedocumentationusesasyntaxthatmightbeconfusing. Forexample,in f i n d ( s u b [ ,s t a r t [ ,e n d ] ] ) ,thebracketsindicateoptionalarguments.So's u b 'is required,but's t a r t 'isoptional,andifyouinclude's t a r t ',then'e n d 'isoptional.
Exercise11
Thefollowingfunctionsareall intendedtocheckwhetherastringcontainsanylowercaseletters,butatleastsomeofthemare wrong.Foreachfunction,describewhatthefunctionactuallydoes.
' ' d e fa n y _ l o w e r c a s e 1 ( s ) : f o rci ns : i fc . i s l o w e r ( ) : r e t u r nT r u e
en.wikibooks.org/wiki/Think_Python/Print_version 81/282
10/24/13
e l s e : r e t u r nF a l s e d e fa n y _ l o w e r c a s e 2 ( s ) : f o rci ns : i f' c ' . i s l o w e r ( ) : r e t u r n' T r u e ' e l s e : r e t u r n' F a l s e ' d e fa n y _ l o w e r c a s e 3 ( s ) : f o rci ns : f l a g=c . i s l o w e r ( ) r e t u r nf l a g d e fa n y _ l o w e r c a s e 4 ( s ) : f l a g=F a l s e f o rci ns : f l a g=f l a go rc . i s l o w e r ( ) r e t u r nf l a g d e fa n y _ l o w e r c a s e 5 ( s ) : f o rci ns : i fn o tc . i s l o w e r ( ) : r e t u r nF a l s e r e t u r nT r u e ' '
Exercise12
ROT13isaweakformofencryptionthatinvolvesrotatingeachletterinawordby13places[7].Torotatealettermeanstoshiftitthroughthealphabet, wrappingaroundtothebeginningifnecessary,soAshiftedby3isDandZshiftedby1isA. Writeafunctioncalled r o t a t e _ w o r d thattakesastringandanintegerasparameters,andthatreturnsanewstringthatcontainsthelettersfromtheoriginal stringrotatedbythegivenamount. Forexample,cheerrotatedby7isjollyandmelonrotatedby10iscubed. Youmightwanttousethebuiltinfunctions'o r d ',whichconvertsacharactertoanumericcode,and'c h r ',whichconvertsnumericcodestocharacters. PotentiallyoffensivejokesontheInternetaresometimesencodedinROT13.Ifyouarenoteasilyoffended,findanddecodesomeofthem.
Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
en.wikibooks.org/wiki/Think_Python/Print_version 82/282
10/24/13
Casestudy:wordplay
Readingwordlists
FortheexercisesinthischapterweneedalistofEnglishwords.TherearelotsofwordlistsavailableontheWeb,buttheonemostsuitableforourpurposeis oneofthewordlistscollectedandcontributedtothepublicdomainbyGradyWardaspartoftheMobylexiconproject [8].Itisalistof113,809official crosswordsthatis,wordsthatareconsideredvalidincrosswordpuzzlesandotherwordgames.IntheMobycollection,thefilenameis 1 1 3 8 0 9 o f . f i c Iincludea copyofthisfile,withthesimplername w o r d s . t x t ,alongwithSwampy. Thisfileisinplaintext,soyoucanopenitwithatexteditor,butyoucanalsoreaditfromPython.(Youmayneedtomovethefilefromtheswampyfolder intothemainpythonfolder)Thebuiltinfunction o p e n takesthenameofthefileasaparameterandreturnsa fileobjectyoucanusetoreadthefile.
> > >f i n=o p e n ( ' w o r d s . t x t ' ) > > >p r i n tf i n < o p e nf i l e' w o r d s . t x t ' ,m o d e' r 'a t0 x b 7 f 4 b 3 8 0 >
f i n isacommonnameforafileobjectusedforinput.Mode ' r ' indicatesthatthisfileisopenforreading(asopposedto ' w ' forwriting).
Thenextwordisaah,whichisaperfectlylegitimateword,sostoplookingatmelikethat.Or,ifitsthewhitespacethatsbotheringyou,wecangetridofit withthestringmethod s t r i p :
> > >l i n e=f i n . r e a d l i n e ( ) > > >w o r d=l i n e . s t r i p ( ) > > >p r i n tw o r d a a h e d
en.wikibooks.org/wiki/Think_Python/Print_version
83/282
10/24/13
Exercises
Therearesolutionstotheseexercisesinthenextsection.Youshouldatleastattempteachonebeforeyoureadthesolutions. Exercise2 In1939ErnestVincentWrightpublisheda50,000wordnovelcalled Gadsbythatdoesnotcontainthelettere.Sinceeisthemostcommonletterin English,thatsnoteasytodo. Infact,itisdifficulttoconstructasolitarythoughtwithoutusingthatmostcommonsymbol.Itisslowgoingatfirst,butwith cautionandhoursoftrainingyoucangraduallygainfacility. Allright,Illstopnow. Writeafunctioncalled h a s _ n o _ e thatreturns'T r u e 'if thegivenworddoesnthavethelettereinit. Modifyyourprogramfromtheprevioussectiontoprintonlythewordsthathavenoeandcomputethepercentageofthewordsinthelisthavenoe. Exercise3 Writeafunctionnamed'a v o i d s 'thattakesawordandastringofforbiddenletters,andthatreturns'T r u e 'iftheworddoesntuseanyoftheforbiddenletters. Modifyyourprogramtoprompttheusertoenterastringofforbiddenlettersandthenprintthenumberofwordsthatdontcontainanyofthem.Canyoufinda combinationof5forbiddenlettersthatexcludesthesmallestnumberofwords? Exercise4 Writeafunctionnamed u s e s _ o n l y thattakesawordandastringofletters,andthatreturns'T r u e 'ifthewordcontainsonlylettersinthelist.Canyoumakea sentenceusingonlytheletters'a c e f h l o '?OtherthanHoealfalfa? Exercise5 Writeafunctionnamed u s e s _ a l l thattakesawordandastringofrequiredletters,andthatreturns'T r u e 'ifthewordusesalltherequiredlettersatleastonce. Howmanywordsaretherethatuseallthevowels'a e i o u '?Howabout'a e i o u y '? Exercise6
en.wikibooks.org/wiki/Think_Python/Print_version 84/282
10/24/13
Search
AlloftheexercisesintheprevioussectionhavesomethingincommontheycanbesolvedwiththesearchpatternwesawinSection8.6.Thesimplest exampleis:
d e fh a s _ n o _ e ( w o r d ) : f o rl e t t e ri nw o r d : i fl e t t e r= =' e ' : r e t u r nF a l s e r e t u r nT r u e
d e fa v o i d s ( w o r d ,f o r b i d d e n ) : f o rl e t t e ri nw o r d : i fl e t t e ri nf o r b i d d e n : r e t u r nF a l s e r e t u r nT r u e
Wecanreturn F a l s e assoonaswefindaforbiddenletterifwegettotheendoftheloop,wereturn T r u e .
u s e s _ o n l y issimilarexceptthatthesenseoftheconditionisreversed:
d e fu s e s _ o n l y ( w o r d ,a v a i l a b l e ) : f o rl e t t e ri nw o r d : i fl e t t e rn o ti na v a i l a b l e : r e t u r nF a l s e r e t u r nT r u e
en.wikibooks.org/wiki/Think_Python/Print_version
85/282
10/24/13
u s e s _ a l l issimilarexceptthatwereversetheroleofthewordandthestringofletters:
d e fu s e s _ a l l ( w o r d ,r e q u i r e d ) : f o rl e t t e ri nr e q u i r e d : i fl e t t e rn o ti nw o r d : r e t u r nF a l s e r e t u r nT r u e
Loopingwithindices
Iwrotethefunctionsintheprevioussectionwith f o r loopsbecauseIonlyneededthecharactersinthestringsIdidnthavetodoanythingwiththeindices. For i s _ a b e c e d a r i a n wehavetocompareadjacentletters,whichisalittletrickywitha f o r loop:
d e fi s _ a b e c e d a r i a n ( w o r d ) : p r e v i o u s=w o r d [ 0 ] f o rci nw o r d : i fc<p r e v i o u s : r e t u r nF a l s e p r e v i o u s=c r e t u r nT r u e
Analternativeistouserecursion:
d e fi s _ a b e c e d a r i a n ( w o r d ) : i fl e n ( w o r d )< =1 : r e t u r nT r u e i fw o r d [ 0 ]>w o r d [ 1 ] :
en.wikibooks.org/wiki/Think_Python/Print_version 86/282
10/24/13
r e t u r nF a l s e r e t u r ni s _ a b e c e d a r i a n ( w o r d [ 1 : ] )
Anotheroptionistousea w h i l e loop:
d e fi s _ a b e c e d a r i a n ( w o r d ) : i=0 w h i l ei<l e n ( w o r d ) 1 : i fw o r d [ i + 1 ]<w o r d [ i ] : r e t u r nF a l s e i=i + 1 r e t u r nT r u e
Theloopstartsat i = 0 andendswhen i = l e n ( w o r d ) 1 .Eachtimethroughtheloop,itcomparestheithcharacter(whichyoucanthinkofasthecurrentcharacter)to thei+1thcharacter(whichyoucanthinkofasthenext). Ifthenextcharacterislessthan(alphabeticallybefore)thecurrentone,thenwehavediscoveredabreakintheabecedariantrend,andwereturn F a l s e . Ifwegettotheendoftheloopwithoutfindingafault,thenthewordpassesthetest.Toconvinceyourselfthattheloopendscorrectly,consideranexample like ' f l o s s y ' .Thelengthofthewordis6,sothelasttimethelooprunsiswhen i is4,whichistheindexofthesecondtolastcharacter.Onthelastiteration,it comparesthesecondtolastcharactertothelast,whichiswhatwewant. Hereisaversionof i s _ p a l i n d r o m e (seeExercise6.6)thatusestwoindicesonestartsatthebeginningandgoesuptheotherstartsattheendandgoesdown.
d e fi s _ p a l i n d r o m e ( w o r d ) : i=0 j=l e n ( w o r d ) 1 w h i l ei < j : i fw o r d [ i ]! =w o r d [ j ] : r e t u r nF a l s e i=i + 1 j=j 1 r e t u r nT r u e
Or,ifyounoticedthatthisisaninstanceofapreviouslysolvedproblem,youmighthavewritten:
d e fi s _ p a l i n d r o m e ( w o r d ) : r e t u r ni s _ r e v e r s e ( w o r d ,w o r d )
en.wikibooks.org/wiki/Think_Python/Print_version
87/282
10/24/13
AssumingyoudidExercise8.8.
Debugging
Testingprogramsishard.Thefunctionsinthischapterarerelativelyeasytotestbecauseyoucanchecktheresultsbyhand.Evenso,itissomewhere betweendifficultandimpossibletochooseasetofwordsthattestforallpossibleerrors. Taking h a s _ n o _ e asanexample,therearetwoobviouscasestocheck:wordsthathaveaneshouldreturn F a l s e wordsthatdontshouldreturn T r u e .Youshould havenotroublecomingupwithoneofeach. Withineachcase,therearesomelessobvioussubcases.Amongthewordsthathaveane,youshouldtestwordswithaneatthebeginning,theend,and somewhereinthemiddle.Youshouldtestlongwords,shortwords,andveryshortwords,liketheemptystring.Theemptystringisanexampleofa special case,whichisoneofthenonobviouscaseswhereerrorsoftenlurk. Inadditiontothetestcasesyougenerate,youcanalsotestyourprogramwithawordlistlike w o r d s . t x t .Byscanningtheoutput,youmightbeabletocatch errors,butbecareful:youmightcatchonekindoferror(wordsthatshouldnotbeincluded,butare)andnotanother(wordsthatshouldbeincluded,but arent). Ingeneral,testingcanhelpyoufindbugs,butitisnoteasytogenerateagoodsetoftestcases,andevenifyoudo,youcantbesureyourprogramiscorrect. Accordingtoalegendarycomputerscientist: Programtestingcanbeusedtoshowthepresenceofbugs,butnevertoshowtheirabsence!EdsgerW.Dijkstra
Glossary
fileobject: Avaluethatrepresentsanopenfile. problemrecognition: Awayofsolvingaproblembyexpressingitasaninstanceofapreviouslysolvedproblem. specialcase: Atestcasethatisatypicalornonobvious(andlesslikelytobehandledcorrectly).
Exercises
Exercise7
ThisquestionisbasedonaPuzzlerthatwasbroadcastontheradioprogram CarTalk[9]: Givemeawordwiththreeconsecutivedoubleletters.I'llgiveyoua
coupleofwordsthatalmostqualify,butdon't.Forexample,thewordcommittee,committee.Itwouldbegreatexceptfortheithatsneaks en.wikibooks.org/wiki/Think_Python/Print_version
88/282
10/24/13
Exercise8
Heresanother CarTalkPuzzler[10]: IwasdrivingonthehighwaytheotherdayandIhappenedtonoticemyodometer.Likemostodometers,itshowssixdigits,inwholemilesonly. So,ifmycarhad300,000miles,forexample,Idsee300000. Now,whatIsawthatdaywasveryinteresting.Inoticedthatthelast4digits werepalindromicthatis,theyreadthesameforwardasbackward.Forexample,5445isapalindrome,somyodometercouldhaveread31 5445. Onemilelater,thelast5numberswerepalindromic.Forexample,it couldhaveread365456.Onemileafterthat,themiddle4outof6 numberswerepalindromic.Andyoureadyforthis?Onemilelater,all6werepalindromic! Thequestionis,whatwasontheodometerwhenIfirstlooked? WriteaPythonprogramthattestsallthesixdigitnumbersandprintsanynumbersthatsatisfytheserequirements.Youcanseemysolutionat 't h i n k p y t h o n . c o m / c o d e / c a r t a l k . p y '.
Exercise9
Heresanother CarTalkPuzzleryoucansolvewithasearch[11]: RecentlyIhadavisitwithmymomandwerealizedthatthetwodigitsthatmakeupmyagewhenreversedresultedinherage.Forexample,if shes73,Im37.Wewonderedhowoftenthishashappenedovertheyearsbutwegotsidetrackedwithothertopicsandwenevercameupwith ananswer. WhenIgothomeIfiguredoutthatthedigitsofourageshavebeenreversiblesixtimessofar.Ialsofiguredoutthatifwereluckyit wouldhappenagaininafewyears,andifwerereallyluckyitwouldhappenonemoretimeafterthat.Inotherwords,itwouldhavehappened8 timesoverall.Sothequestionis,howoldamInow? WriteaPythonprogramthatsearchesforsolutionstothisPuzzler. Hint:youmightfindthestringmethod'z f i l l 'useful. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / c a r t a l k . p y '.
Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
Lists
en.wikibooks.org/wiki/Think_Python/Print_version 89/282
10/24/13
Alistisasequence
Likeastring,a listisasequenceofvalues.Inastring,thevaluesarecharactersinalist,theycanbeanytype.Thevaluesinlistarecalled elementsor sometimes items. Thereareseveralwaystocreateanewlistthesimplestistoenclosetheelementsinsquarebrackets([ and ] ):
[ 1 0 ,2 0 ,3 0 ,4 0 ] [ ' c r u n c h yf r o g ' ,' r a mb l a d d e r ' ,' l a r kv o m i t ' ]
Thefirstexampleisalistoffourintegers.Thesecondisalistofthreestrings.Theelementsofalistdonthavetobethesametype.Thefollowinglist containsastring,afloat,aninteger,and(lo!)anotherlist:
[ ' s p a m ' ,2 . 0 ,5 ,[ 1 0 ,2 0 ] ]
Listsaremutable
Thesyntaxforaccessingtheelementsofalististhesameasforaccessingthecharactersofastringthebracketoperator.Theexpressioninsidethe bracketsspecifiestheindex.Rememberthattheindicesstartat0:
> > >p r i n tc h e e s e s [ 0 ] C h e d d a r
Unlikestrings,listsaremutable.Whenthebracketoperatorappearsontheleftsideofanassignment,itidentifiestheelementofthelistthatwillbeassigned.
> > >n u m b e r s=[ 1 7 ,1 2 3 ] > > >n u m b e r s [ 1 ]=5 > > >p r i n tn u m b e r s
en.wikibooks.org/wiki/Think_Python/Print_version 90/282
10/24/13
[ 1 7 ,5 ]
Theoneethelementof n u m b e r s ,whichusedtobe123,isnow5. Youcanthinkofalistasarelationshipbetweenindicesandelements.Thisrelationshipiscalleda mappingeachindexmapstooneoftheelements.Here isastatediagramshowing c h e e s e s , n u m b e r s and e m p t y : <IMGSRC="book013.png"> Listsarerepresentedbyboxeswiththewordlistoutsideandtheelementsofthelistinside. c h e e s e s referstoalistwiththreeelementsindexed0,1and2. n u m b e r s containstwoelementsthediagramshowsthatthevalueofthesecondelementhasbeenreassignedfrom123to5. e m p t y referstoalistwithno elements. Listindicesworkthesamewayasstringindices: Anyintegerexpressioncanbeusedasanindex. Ifyoutrytoreadorwriteanelementthatdoesnotexist,yougetan I n d e x E r r o r . Ifanindexhasanegativevalue,itcountsbackwardfromtheendofthelist. The i n operatoralsoworksonlists.
> > >c h e e s e s=[ ' C h e d d a r ' ,' E d a m ' ,' G o u d a ' ] > > >' E d a m 'i nc h e e s e s T r u e > > >' B r i e 'i nc h e e s e s F a l s e
Traversingalist
Themostcommonwaytotraversetheelementsofalistiswitha f o r loop.Thesyntaxisthesameasforstrings:
f o rc h e e s ei nc h e e s e s : p r i n tc h e e s e
10/24/13
Thislooptraversesthelistandupdateseachelement. l e n returnsthenumberofelementsinthelist. r a n g e returnsalistofindicesfrom0to n1,where nisthe lengthofthelist.Eachtimethroughtheloop i getstheindexofthenextelement.Theassignmentstatementinthebodyuses i toreadtheoldvalueofthe elementandtoassignthenewvalue. A f o r loopoveranemptylistneverexecutesthebody:
f o rxi ne m p t y : p r i n t' T h i sn e v e rh a p p e n s . '
Althoughalistcancontainanotherlist,thenestedliststillcountsasasingleelement.Thelengthofthislistisfour:
[ ' s p a m ' ,1 ,[ ' B r i e ' ,' R o q u e f o r t ' ,' P o ll eV e q ' ] ,[ 1 ,2 ,3 ] ]
Listoperations
The + operatorconcatenateslists:
> > >a=[ 1 ,2 ,3 ] > > >b=[ 4 ,5 ,6 ] > > >c=a+b > > >p r i n tc [ 1 ,2 ,3 ,4 ,5 ,6 ]
Similarly,the * operatorrepeatsalistagivennumberoftimes:
> > >[ 0 ]*4 [ 0 ,0 ,0 ,0 ] > > >[ 1 ,2 ,3 ]*3 [ 1 ,2 ,3 ,1 ,2 ,3 ,1 ,2 ,3 ]
Listslices
Thesliceoperatoralsoworksonlists:
> > >t=[ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ] > > >t [ 1 : 3 ] [ ' b ' ,' c ' ] > > >t [ : 4 ]
en.wikibooks.org/wiki/Think_Python/Print_version 92/282
10/24/13
[ ' a ' ,' b ' ,' c ' ,' d ' ] > > >t [ 3 : ] [ ' d ' ,' e ' ,' f ' ]
Ifyouomitthefirstindex,theslicestartsatthebeginning.Ifyouomitthesecond,theslicegoestotheend.Soifyouomitboth,thesliceisacopyofthe wholelist.
> > >t [ : ] [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ]
Sincelistsaremutable,itisoftenusefultomakeacopybeforeperformingoperationsthatfold,spindleormutilatelists. Asliceoperatorontheleftsideofanassignmentcanupdatemultipleelements:
> > >t=[ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ,' f ' ] > > >t [ 1 : 3 ]=[ ' x ' ,' y ' ] > > >p r i n tt [ ' a ' ,' x ' ,' y ' ,' d ' ,' e ' ,' f ' ]
Listmethods
Pythonprovidesmethodsthatoperateonlists.Forexample, a p p e n d addsanewelementtotheendofalist:
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >t . a p p e n d ( ' d ' ) > > >p r i n tt [ ' a ' ,' b ' ,' c ' ,' d ' ]
e x t e n d takesalistasanargumentandappendsalloftheelements:
> > >t 1=[ ' a ' ,' b ' ,' c ' ] > > >t 2=[ ' d ' ,' e ' ] > > >t 1 . e x t e n d ( t 2 ) > > >p r i n tt 1 [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ]
Thisexampleleaves t 2 unmodified.
s o r t arrangestheelementsofthelistfromlowtohigh:
> > >t=[ ' d ' ,' c ' ,' e ' ,' b ' ,' a ' ]
en.wikibooks.org/wiki/Think_Python/Print_version 93/282
10/24/13
> > >t . s o r t ( ) > > >p r i n tt [ ' a ' ,' b ' ,' c ' ,' d ' ,' e ' ]
Map,filterandreduce
Toaddupallthenumbersinalist,youcanusealooplikethis:
d e fa d d _ a l l ( t ) : t o t a l=0 f o rxi nt : t o t a l+ =x r e t u r nt o t a l
t o t a l isinitializedto0.Eachtimethroughtheloop, x getsoneelementfromthelist.The + = operatorprovidesashortwaytoupdateavariable:
t o t a l+ =x
isequivalentto:
t o t a l=t o t a l+x
10/24/13
r e t u r nr e s
r e s isinitializedwithanemptylisteachtimethroughtheloop,weappendthenextelement.So r e s isanotherkindofaccumulator.
Exercise1
Writeafunctionthattakesalistofnumbersandreturnsthecumulativesumthatis,anewlistwherethe'i 'thelementisthesumofthefirst'i +1'elements fromtheoriginallist.Forexample,thecumulativesumof'[ 1 ,2 ,3 ] 'is'[ 1 ,3 ,6 ] '.
Deletingelements
Thereareseveralwaystodeleteelementsfromalist.Ifyouknowtheindexoftheelementyouwant,youcanuse p o p :
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >x=t . p o p ( 1 ) > > >p r i n tt [ ' a ' ,' c ' ] > > >p r i n tx b
p o p modifiesthelistandreturnstheelementthatwasremoved.Ifyoudontprovideanindex,itdeletesandreturnsthelastelement.
Ifyoudontneedtheremovedvalue,youcanusethe d e l operator:
en.wikibooks.org/wiki/Think_Python/Print_version 95/282
10/24/13
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >d e lt [ 1 ] > > >p r i n tt [ ' a ' ,' c ' ]
Ifyouknowtheelementyouwanttoremove(butnottheindex),youcanuse r e m o v e :
> > >t=[ ' a ' ,' b ' ,' c ' ] > > >t . r e m o v e ( ' b ' ) > > >p r i n tt [ ' a ' ,' c ' ]
Asusual,thesliceselectsalltheelementsupto,butnotincluding,thesecondindex.
Listsandstrings
Astringisasequenceofcharactersandalistisasequenceofvalues,butalistofcharactersisnotthesameasastring.Toconvertfromastringtoalistof characters,youcanuse l i s t :
> > >s=' s p a m ' > > >t=l i s t ( s ) > > >p r i n tt [ ' s ' ,' p ' ,' a ' ,' m ' ]
10/24/13
Anoptionalargumentcalleda delimiterspecifieswhichcharacterstouseaswordboundaries.Thefollowingexampleusesahyphenasadelimiter:
> > >s=' s p a m s p a m s p a m ' > > >d e l i m i t e r=' ' > > >s . s p l i t ( d e l i m i t e r ) [ ' s p a m ' ,' s p a m ' ,' s p a m ' ]
j o i n istheinverseof s p l i t .Ittakesalistofstringsandconcatenatestheelements. j o i n isastringmethod,soyouhavetoinvokeitonthedelimiterandpass
thelistasaparameter:
> > >t=[ ' p i n i n g ' ,' f o r ' ,' t h e ' ,' f j o r d s ' ] > > >d e l i m i t e r='' > > >d e l i m i t e r . j o i n ( t ) ' p i n i n gf o rt h ef j o r d s '
Objectsandvalues
Ifweexecutetheseassignmentstatements:
a=' b a n a n a ' b=' b a n a n a '
Weknowthat a and b bothrefertoastring,butwedontknowwhethertheyrefertothe samestring.Therearetwopossiblestates: <IMGSRC="book014.png"> Inonecase, a and b refertotwodifferentobjectsthathavethesamevalue.Inthesecondcase,theyrefertothesameobject. Tocheckwhethertwovariablesrefertothesameobject,youcanusethe i s operator.
> > >a=' b a n a n a ' > > >b=' b a n a n a ' > > >ai sb T r u e
10/24/13
Butwhenyoucreatetwolists,yougettwoobjects:
> > >a=[ 1 ,2 ,3 ] > > >b=[ 1 ,2 ,3 ] > > >ai sb F a l s e
Sothestatediagramlookslikethis: <IMGSRC="book015.png"> Inthiscasewewouldsaythatthetwolistsare equivalent,becausetheyhavethesameelements,butnot identical ,becausetheyarenotthesameobject.If twoobjectsareidentical,theyarealsoequivalent,butiftheyareequivalent,theyarenotnecessarilyidentical. Untilnow,wehavebeenusingobjectandvalueinterchangeably,butitismoreprecisetosaythatanobjecthasavalue.Ifyouexecute a=[ 1 , 2 , 3 ] , a refers toalistobjectwhosevalueisaparticularsequenceofelements.Ifanotherlisthasthesameelements,wewouldsayithasthesamevalue.
Aliasing
If a referstoanobjectandyouassign b=a ,thenbothvariablesrefertothesameobject:
> > >a=[ 1 ,2 ,3 ] > > >b=a > > >bi sa T r u e
Althoughthisbehaviorcanbeuseful,itiserrorprone.Ingeneral,itissafertoavoidaliasingwhenyouareworkingwithmutableobjects. Forimmutableobjectslikestrings,aliasingisnotasmuchofaproblem.Inthisexample:
en.wikibooks.org/wiki/Think_Python/Print_version 98/282
10/24/13
Listarguments
Whenyoupassalisttoafunction,thefunctiongetsareferencetothelist.Ifthefunctionmodifiesalistparameter,thecallerseesthechange.Forexample, d e l e t e _ h e a d removesthefirstelementfromalist:
d e fd e l e t e _ h e a d ( t ) : d e lt [ 0 ]
Hereshowitisused:
> > >l e t t e r s=[ ' a ' ,' b ' ,' c ' ] > > >d e l e t e _ h e a d ( l e t t e r s ) > > >p r i n tl e t t e r s [ ' b ' ,' c ' ]
en.wikibooks.org/wiki/Think_Python/Print_version
99/282
10/24/13
#W R O N G !
Thisfunctionleavestheoriginallistunmodified.Hereshowitisused:
> > >l e t t e r s=[ ' a ' ,' b ' ,' c ' ] > > >r e s t=t a i l ( l e t t e r s ) > > >p r i n tr e s t [ ' b ' ,' c ' ]
Exercise2
Writeafunctioncalled'c h o p 'thattakesalistandmodifiesit,removingthefirstandlastelements,andreturns'N o n e '. Thenwriteafunctioncalled'm i d d l e 'thattakesalistandreturnsanewlistthatcontainsallbutthefirstandlastelements.
Debugging
Carelessuseoflists(andothermutableobjects)canleadtolonghoursofdebugging.Herearesomecommonpitfallsandwaystoavoidthem: Dontforgetthatmostlistmethodsmodifytheargumentand return N o n e .Thisistheoppositeofthestringmethods,whichreturnanewstringandleavetheoriginalalone.Ifyouareusedtowritingstringcodelikethis:
w o r d=w o r d . s t r i p ( )
Itistemptingtowritelistcodelikethis:
t=t . s o r t ( ) #W R O N G !
en.wikibooks.org/wiki/Think_Python/Print_version
100/282
10/24/13
Because s o r t returns N o n e ,thenextoperationyouperformwith t islikelytofail. Beforeusinglistmethodsandoperators,youshouldreadthedocumentationcarefullyandthentestthemininteractivemode.Themethodsandoperatorsthat listssharewithothersequences(likestrings)aredocumentedat d o c s . p y t h o n . o r g / l i b / t y p e s s e q . h t m l .Themethodsandoperatorsthatonlyapplytomutable sequencesaredocumentedat d o c s . p y t h o n . o r g / l i b / t y p e s s e q m u t a b l e . h t m l . Pickanidiomandstickwithit. Partoftheproblemwithlistsisthattherearetoomanywaystodothings.Forexample,toremoveanelementfromalist,youcanuse p o p , r e m o v e , d e l ,oreven asliceassignment. Toaddanelement,youcanusethe a p p e n d methodorthe + operator.Butdontforgetthattheseareright:
t . a p p e n d ( x ) t=t+[ x ]
Andthesearewrong:
t . a p p e n d ( [ x ] ) t=t . a p p e n d ( x ) t+[ x ] t=t+x #W R O N G ! #W R O N G ! #W R O N G ! #W R O N G !
Ifyouwanttouseamethodlike s o r t thatmodifiestheargument,butyouneedtokeeptheoriginallistaswell,youcanmakeacopy.
o r i g=t [ : ] t . s o r t ( )
Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 101/282
10/24/13
list: Asequenceofvalues. element: Oneofthevaluesinalist(orothersequence),alsocalleditems. index: Anintegervaluethatindicatesanelementinalist. nestedlist: Alistthatisanelementofanotherlist. listtraversal: Thesequentialaccessingofeachelementinalist. mapping: Arelationshipinwhicheachelementofonesetcorrespondstoanelementofanotherset.Forexample,alistisamappingfromindicestoelements. accumulator: Avariableusedinalooptoadduporaccumulatearesult. reduce: Aprocessingpatternthattraversesasequenceandaccumulatestheelementsintoasingleresult. map: Aprocessingpatternthattraversesasequenceandperformsanoperationoneachelement. filter: Aprocessingpatternthattraversesalistandselectstheelementsthatsatisfysomecriterion. object: Somethingavariablecanreferto.Anobjecthasatypeandavalue. equivalent: Havingthesamevalue. identical: Beingthesameobject(whichimpliesequivalence). reference: Theassociationbetweenavariableanditsvalue. aliasing: Acircumstancewheretwovariablesrefertothesameobject. delimiter: Acharacterorstringusedtoindicatewhereastringshouldbesplit.
Exercises
Exercise3
en.wikibooks.org/wiki/Think_Python/Print_version 102/282
10/24/13
Writeafunctioncalled i s _ s o r t e d thattakesalistasaparameterandreturns'T r u e 'ifthelistissortedinascendingorderand'F a l s e 'otherwise.Youcanassume (asaprecondition)thattheelementsofthelistcanbecomparedwiththecomparisonoperators'< ','> ',etc. Forexample, i s _ s o r t e d ( [ 1 , 2 , 2 ] ) shouldreturn'T r u e 'and i s _ s o r t e d ( [ ' b ' , ' a ' ] ) shouldreturn'F a l s e '.
Exercise4
Twowordsareanagramsifyoucanrearrangethelettersfromonetospelltheother.Writeafunctioncalled i s _ a n a g r a m thattakestwostringsandreturns'T r u e 'if theyareanagrams. Exercise5 The(socalled)BirthdayParadox: Writeafunctioncalled h a s _ d u p l i c a t e s thattakesalistandreturns'T r u e 'ifthereisanyelementthatappearsmorethanonce.Itshouldnotmodifytheoriginallist. Ifthereare23studentsinyourclass,whatarethechances thattwoofyouhavethesamebirthday?Youcanestimatethisprobabilitybygeneratingrandomsamplesof23birthdaysandcheckingformatches.Hint:you cangeneraterandombirthdayswiththe'r a n d i n t 'functioninthe'r a n d o m 'module. Youcanreadaboutthisproblemat 'w i k i p e d i a . o r g / w i k i / B i r t h d a y _ p a r a d o x ',andyoucanseemysolutionat't h i n k p y t h o n . c o m / c o d e / b i r t h d a y . p y '. Exercise6 Writeafunctioncalled r e m o v e _ d u p l i c a t e s thattakesalistandreturnsanewlistwithonlytheuniqueelementsfromtheoriginal.Hint:theydonthavetobeinthe sameorder.
Exercise7
Writeafunctionthatreadsthefile'w o r d s . t x t 'andbuildsalistwithoneelementperword.Writetwoversionsofthisfunction,oneusingthe'a p p e n d 'methodand theotherusingtheidiom't=t+[ x ] '.Whichonetakeslongertorun?Why? Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / w o r d l i s t . p y '.
Exercise8
Tocheckwhetherawordisinthewordlist,youcouldusethe'i n 'operator,butitwouldbeslowbecauseitsearchesthroughthewordsinorder. Becausethewordsareinalphabeticalorder,wecanspeedthingsupwithabisectionsearch,whichissimilartowhatyoudowhenyoulookawordupinthe dictionary.Youstartinthemiddleandchecktoseewhetherthewordyouarelookingforcomesbeforethewordinthemiddleofthelist.Ifso,thenyousearch thefirsthalfofthelistthesameway.Otherwiseyousearchthesecondhalf.
10/24/13
Exercise9
Twowordsareareversepairifeachisthereverseoftheother.Writeaprogramthatfindsallthereversepairsinthewordlist.
Exercise10
Twowordsinterlockiftakingalternatinglettersfromeachformsanewword1.Forexample,shoeandcoldinterlocktoformschooled. Writeaprogramthatfindsallpairsofwordsthatinterlock. Hint:dontenumerateallpairs! Canyoufindanywordsthatarethreewayinterlockedthatis, everythirdletterformsaword,startingfromthefirst,secondorthird?
1 Thisexerciseisinspiredbyanexampleat p u z z l e r s . o r g .
Dictionaries
A dictionaryislikealist,butmoregeneral.Inalist,theindiceshavetobeintegersinadictionarytheycanbe(almost)anytype. Youcanthinkofadictionaryasamappingbetweenasetofindices(whicharecalled keys)andasetofvalues.Eachkeymapstoavalue.Theassociationof akeyandavalueiscalleda keyvaluepairorsometimesan item. Asanexample,we'llbuildadictionarythatmapsfromEnglishtoSpanishwords,sothekeysandthevaluesareallstrings. Thefunction d i c t createsanewdictionarywithnoitems.Because d i c t isthenameofabuiltinfunction,youshouldavoidusingitasavariablename.
> > >e n g 2 s p=d i c t ( ) > > >p r i n te n g 2 s p { }
en.wikibooks.org/wiki/Think_Python/Print_version
104/282
10/24/13
Thesquigglybrackets, { } ,representanemptydictionary.Toadditemstothedictionary,youcanusesquarebrackets:
> > >e n g 2 s p [ ' o n e ' ]=' u n o '
Thisoutputformatisalsoaninputformat.Forexample,youcancreateanewdictionarywiththreeitems:
> > >e n g 2 s p={ ' o n e ' :' u n o ' ,' t w o ' :' d o s ' ,' t h r e e ' :' t r e s ' }
Butifyouprint e n g 2 s p ,youmightbesurprised:
> > >p r i n te n g 2 s p { ' o n e ' :' u n o ' ,' t h r e e ' :' t r e s ' ,' t w o ' :' d o s ' }
The l e n functionworksondictionariesitreturnsthenumberofkeyvaluepairs:
> > >l e n ( e n g 2 s p )
en.wikibooks.org/wiki/Think_Python/Print_version 105/282
10/24/13
Exercise1
Writeafunctionthatreadsthewordsin'w o r d s . t x t 'andstoresthemaskeysinadictionary.Itdoesntmatterwhatthevaluesare.Thenyoucanusethe'i n ' operatorasafastwaytocheckwhetherastringisinthedictionary. IfyoudidExercise'10.8',youcancomparethespeedofthisimplementationwiththelist'i n 'operatorandthebisectionsearch.
Dictionaryasasetofcounters
Supposeyouaregivenastringandyouwanttocounthowmanytimeseachletterappears.Thereareseveralwaysyoucoulddoit: Youcouldcreate26variables,oneforeachletterofthealphabet.Thenyoucouldtraversethestringand,foreachcharacter,incrementthe correspondingcounter,probablyusingachainedconditional. Youcouldcreatealistwith26elements.Thenyoucouldconverteachcharactertoanumber(usingthebuiltinfunction o r d ),usethenumberasan indexintothelist,andincrementtheappropriatecounter. Youcouldcreateadictionarywithcharactersaskeysandcountersasthecorrespondingvalues.Thefirsttimeyouseeacharacter,youwouldaddan itemtothedictionary.Afterthatyouwouldincrementthevalueofanexistingitem. Eachoftheseoptionsperformsthesamecomputation,buteachofthemimplementsthatcomputationinadifferentway. An implementationisawayofperformingacomputationsomeimplementationsarebetterthanothers.Forexample,anadvantageofthedictionary en.wikibooks.org/wiki/Think_Python/Print_version
106/282
10/24/13
Exercise2
Dictionarieshaveamethodcalled'g e t 'thattakesakeyandadefaultvalue.Ifthekeyappearsinthedictionary,'g e t 'returnsthecorrespondingvalueotherwise itreturnsthedefaultvalue.Forexample:
' ' > > >h=h i s t o g r a m ( ' a ' ) > > >p r i n th { ' a ' :1 } > > >h . g e t ( ' a ' ,0 ) 1 > > >h . g e t ( ' b ' ,0 ) 0 ' '
en.wikibooks.org/wiki/Think_Python/Print_version
107/282
10/24/13
Loopinganddictionaries
Ifyouuseadictionaryina f o r statement,ittraversesthekeysofthedictionary.Forexample, p r i n t _ h i s t printseachkeyandthecorrespondingvalue:
d e fp r i n t _ h i s t ( h ) : f o rci nh : p r i n tc ,h [ c ]
Hereswhattheoutputlookslike:
> > >h=h i s t o g r a m ( ' p a r r o t ' ) > > >p r i n t _ h i s t ( h ) a1 p1 r2 t1 o1
Again,thekeysareinnoparticularorder.
Exercise3
Dictionarieshaveamethodcalled'k e y s 'thatreturnsthekeysofthedictionary,innoparticularorder,asalist. Modify p r i n t _ h i s t toprintthekeysandtheirvaluesinalphabeticalorder.
Reverselookup
Givenadictionary d andakey k ,itiseasytofindthecorrespondingvalue v=d [ k ] .Thisoperationiscalleda lookup. Butwhatifyouhave v andyouwanttofind k ?Youhavetwoproblems:first,theremightbemorethanonekeythatmapstothevalue v .Dependingonthe application,youmightbeabletopickone,oryoumighthavetomakealistthatcontainsallofthem.Second,thereisnosimplesyntaxtodoa reverse lookupyouhavetosearch. Hereisafunctionthattakesavalueandreturnsthefirstkeythatmapstothatvalue:
d e fr e v e r s e _ l o o k u p ( d ,v ) : f o rki nd : i fd [ k ]= =v : r e t u r nk r a i s eV a l u e E r r o r
en.wikibooks.org/wiki/Think_Python/Print_version
108/282
10/24/13
Andanunsuccessfulone:
> > >k=r e v e r s e _ l o o k u p ( h ,3 ) T r a c e b a c k( m o s tr e c e n tc a l ll a s t ) : F i l e" < s t d i n > " ,l i n e1 ,i n? F i l e" < s t d i n > " ,l i n e5 ,i nr e v e r s e _ l o o k u p V a l u e E r r o r
Dictionariesandlists
Listscanappearasvaluesinadictionary.Forexample,ifyouweregivenadictionarythatmapsfromletterstofrequencies,youmightwanttoinvertitthatis, createadictionarythatmapsfromfrequenciestoletters.Sincetheremightbeseveralletterswiththesamefrequency,eachvalueintheinverteddictionary shouldbealistofletters. Hereisafunctionthatinvertsadictionary:
en.wikibooks.org/wiki/Think_Python/Print_version 109/282
10/24/13
Eachtimethroughtheloop, k e y getsakeyfrom d and v a l getsthecorrespondingvalue.If v a l isnotin i n v ,thatmeanswehaventseenitbefore,sowecreatea newitemandinitializeitwitha singleton(alistthatcontainsasingleelement).Otherwisewehaveseenthisvaluebefore,soweappendthecorresponding keytothelist. Hereisanexample:
> > >h i s t=h i s t o g r a m ( ' p a r r o t ' ) > > >p r i n th i s t { ' a ' :1 ,' p ' :1 ,' r ' :2 ,' t ' :1 ,' o ' :1 } > > >i n v=i n v e r t _ d i c t ( h i s t ) > > >p r i n ti n v { 1 :[ ' a ' ,' p ' ,' t ' ,' o ' ] ,2 :[ ' r ' ] }
Imentionedearlierthatadictionaryisimplementedusingahashtableandthatmeansthatthekeyshavetobe hashable.
en.wikibooks.org/wiki/Think_Python/Print_version 110/282
10/24/13
Exercise5
Readthedocumentationofthedictionarymethod's e t d e f a u l t 'anduseittowriteamoreconciseversionof i n v e r t _ d i c t .
Memos
Ifyouplayedwiththe f i b o n a c c i functionfromSection6.7,youmighthavenoticedthatthebiggertheargumentyouprovide,thelongerthefunctiontakesto run.Furthermore,theruntimeincreasesveryquickly. Tounderstandwhy,considerthis callgraphfor f i b o n a c c i with n = 4 : <IMGSRC="book019.png"> Acallgraphshowsasetoffunctionframes,withlinesconnectingeachframetotheframesofthefunctionsitcalls.Atthetopofthegraph, f i b o n a c c i with n = 4 calls f i b o n a c c i with n = 3 and n = 2 .Inturn, f i b o n a c c i with n = 3 calls f i b o n a c c i with n = 2 and n = 1 .Andsoon. Counthowmanytimes f i b o n a c c i ( 0 ) and f i b o n a c c i ( 1 ) arecalled.Thisisaninefficientsolutiontotheproblem,anditgetsworseastheargumentgetsbigger. Onesolutionistokeeptrackofvaluesthathavealreadybeencomputedbystoringtheminadictionary.Apreviouslycomputedvaluethatisstoredforlater useiscalleda memo[12].Hereisanimplementationof f i b o n a c c i usingmemos:
k n o w n={ 0 : 0 ,1 : 1 } d e ff i b o n a c c i ( n ) : i fni nk n o w n : r e t u r nk n o w n [ n ] r e s=f i b o n a c c i ( n 1 )+f i b o n a c c i ( n 2 ) k n o w n [ n ]=r e s r e t u r nr e s
k n o w n isadictionarythatkeepstrackoftheFibonaccinumberswealreadyknow.Itstartswithtwoitems:0mapsto0and1mapsto1.
en.wikibooks.org/wiki/Think_Python/Print_version 111/282
10/24/13
Exercise6
Runthisversionof'f i b o n a c c i 'andtheoriginalwitharangeofparametersandcomparetheirruntimes.
Globalvariables
Inthepreviousexample, k n o w n iscreatedoutsidethefunction,soitbelongstothespecialframecalled _ _ m a i n _ _ .Variablesin _ _ m a i n _ _ aresometimescalled global becausetheycanbeaccessedfromanyfunction.Unlikelocalvariables,whichdisappearwhentheirfunctionends,globalvariablespersistfromone functioncalltothenext. Itiscommontouseglobalvariablesfor flagsthatis,booleanvariablesthatindicate(flag)whetheraconditionistrue.Forexample,someprogramsusea flagnamed v e r b o s e tocontrolthelevelofdetailintheoutput:
v e r b o s e=T r u e d e fe x a m p l e 1 ( ) : i fv e r b o s e : p r i n t' R u n n i n ge x a m p l e 1 '
Ifyoutrytoreassignaglobalvariable,youmightbesurprised.Thefollowingexampleissupposedtokeeptrackofwhetherthefunctionhasbeencalled:
b e e n _ c a l l e d=F a l s e d e fe x a m p l e 2 ( ) : b e e n _ c a l l e d=T r u e
#W R O N G
en.wikibooks.org/wiki/Think_Python/Print_version
112/282
10/24/13
Heresanexamplethattriestoupdateaglobalvariable:
c o u n t=0 d e fe x a m p l e 3 ( ) : c o u n t=c o u n t+1
#W R O N G
Ifyourunityouget:
U n b o u n d L o c a l E r r o r :l o c a lv a r i a b l e' c o u n t 'r e f e r e n c e db e f o r ea s s i g n m e n t
Iftheglobalvalueismutable,youcanmodifyitwithoutdeclaringit:
k n o w n={ 0 : 0 ,1 : 1 } d e fe x a m p l e 4 ( ) : k n o w n [ 2 ]=1
Soyoucanadd,removeandreplaceelementsofagloballistordictionary,butifyouwanttoreassignthevariable,youhavetodeclareit:
d e fe x a m p l e 5 ( ) : g l o b a lk n o w n k n o w n=d i c t ( )
Longintegers
Ifyoucompute f i b o n a c c i ( 5 0 ) ,youget:
> > >f i b o n a c c i ( 5 0 ) 1 2 5 8 6 2 6 9 0 2 5 L
The L attheendindicatesthattheresultisalonginteger[13],ortype l o n g .
en.wikibooks.org/wiki/Think_Python/Print_version 113/282
10/24/13
Inthefirstcasetheresulthastype i n t inthesecondcaseitis l o n g .
Exercise7
Exponentiationoflargeintegersisthebasisofcommonalgorithmsforpublickeyencryption.ReadtheWikipediapageontheRSAalgorithm[14]andwrite functionstoencodeanddecodemessages.
Debugging
Asyouworkwithbiggerdatasetsitcanbecomeunwieldytodebugbyprintingandcheckingdatabyhand.Herearesomesuggestionsfordebugginglarge datasets: Scaledowntheinput: Ifpossible,reducethesizeofthedataset.Forexampleiftheprogramreadsatextfile,startwithjustthefirst10lines,orwiththesmallestexample youcanfind.Youcaneithereditthefilesthemselves,or(better)modifytheprogramsoitreadsonlythefirst n lines.Ifthereisanerror,youcanreduce
n tothesmallestvaluethatmanifeststheerror,andthenincreaseitgraduallyasyoufindandcorrecterrors.
Checksummariesandtypes: Insteadofprintingandcheckingtheentiredataset,considerprintingsummariesofthedata:forexample,thenumberofitemsinadictionaryorthe totalofalistofnumbers.Acommoncauseofruntimeerrorsisavaluethatisnottherighttype.Fordebuggingthiskindoferror,itisoftenenoughto printthetypeofavalue. Writeselfchecks: Sometimesyoucanwritecodetocheckforerrorsautomatically.Forexample,ifyouarecomputingtheaverageofalistofnumbers,youcouldcheck thattheresultisnotgreaterthanthelargestelementinthelistorlessthanthesmallest.Thisiscalledasanitycheckbecauseitdetectsresultsthat areinsane.Anotherkindofcheckcomparestheresultsoftwodifferentcomputationstoseeiftheyareconsistent.Thisiscalledaconsistencycheck. Prettyprinttheoutput: Formattingdebuggingoutputcanmakeiteasiertospotanerror.WesawanexampleinSection6.9.The p p r i n t moduleprovidesa p p r i n t functionthat displaysbuiltintypesinamorehumanreadableformat. Again,timeyouspendbuildingscaffoldingcanreducethetimeyouspenddebugging.
en.wikibooks.org/wiki/Think_Python/Print_version 114/282
10/24/13
Glossary
dictionary: Amappingfromasetofkeystotheircorrespondingvalues. keyvaluepair: Therepresentationofthemappingfromakeytoavalue. item: Anothernameforakeyvaluepair. key: Anobjectthatappearsinadictionaryasthefirstpartofakeyvaluepair. value: Anobjectthatappearsinadictionaryasthesecondpartofakeyvaluepair.Thisismorespecificthanourprevioususeofthewordvalue. implementation: Awayofperformingacomputation. hashtable: ThealgorithmusedtoimplementPythondictionaries. hashfunction: Afunctionusedbyahashtabletocomputethelocationforakey. hashable: Atypethathasahashfunction.Immutabletypeslikeintegers,floatsandstringsarehashablemutabletypeslikelistsanddictionariesarenot. lookup: Adictionaryoperationthattakesakeyandfindsthecorrespondingvalue. reverselookup: Adictionaryoperationthattakesavalueandfindsoneormorekeysthatmaptoit. singleton: Alist(orothersequence)withasingleelement. callgraph: Adiagramthatshowseveryframecreatedduringtheexecutionofaprogram,withanarrowfromeachcallertoeachcallee. histogram: Asetofcounters. memo: Acomputedvaluestoredtoavoidunnecessaryfuturecomputation. globalvariable: Avariabledefinedoutsideafunction.Globalvariablescanbeaccessedfromanyfunction. flag: Abooleanvariableusedtoindicatewhetheraconditionistrue.
en.wikibooks.org/wiki/Think_Python/Print_version 115/282
10/24/13
Exercise8
D i c t i o n a r i e sh a v eam e t h o dc a l l e d' k e y s 't h a tr e t u r n st h ek e y so ft h ed i c t i o n a r y ,i n
noparticularorder,asalist.Modifyprint_histtoprintthekeysandtheirvaluesinalphabeticalorder.
Exercise9
Twowordsarerotatepairsifyoucanrotateoneofthemandgettheother(see r o t a t e _ w o r d inExercise'8.12'). Writeaprogramthatreadsawordlistandfindsalltherotatepairs.
Exercise10
HeresanotherPuzzlerfromCarTalk[15]: ThiswassentinbyafellownamedDanOLeary.Hecameuponacommononesyllable,fiveletterwordrecentlythathasthefollowingunique property.Whenyouremovethefirstletter,theremaininglettersformahomophoneoftheoriginalword,thatisawordthatsoundsexactlythe same.Replacethefirstletter,thatis,putitbackandremovethesecondletterandtheresultisyetanotherhomophoneoftheoriginalword.And thequestionis,whatstheword? NowImgoingtogiveyouanexamplethatdoesntwork.Letslookat thefiveletterword,wrack.WRACK, youknowliketowrackwithpain.IfIremovethefirstletter,Iamleftwithafourletterword,RACK.Asin,Holycow,didyouseetherackon thatbuck!Itmusthavebeenaninepointer!Itsaperfecthomophone.Ifyouputthewback,andremovether,instead,youreleftwiththe word,wack,whichisarealword,itsjustnotahomophoneoftheothertwowords. Butthereis,however,atleastonewordthatDanandweknowof, whichwillyieldtwohomophonesifyouremoveeitherofthefirsttwolettersto maketwo,newfourletterwords.Thequestionis,whatstheword? ' YoucanusethedictionaryfromExercise'11.1'tocheckwhetherastringisinthewordlist. Tocheckwhethertwowordsarehomophones,youcanusetheCMUPronouncingDictionary.Youcandownloaditfrom'w w w . s p e e c h . c s . c m u . e d u / c g i b i n / c m u d i c t 'or from't h i n k p y t h o n . c o m / c o d e / c 0 6 d 'andyoucanalsodownload't h i n k p y t h o n . c o m / c o d e / p r o n o u n c e . p y ',whichprovidesafunctionnamed r e a d _ d i c t i o n a r y thatreadsthe pronouncingdictionaryandreturnsaPythondictionarythatmapsfromeachwordtoastringthatdescribesitsprimarypronunciation. WriteaprogramthatlistsallthewordsthatsolvethePuzzler. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / h o m o p h o n e . p y '.
Notes
en.wikibooks.org/wiki/Think_Python/Print_version 116/282
10/24/13
Tuples
Tuplesareimmutable
Atupleisasequenceofvalues.Thevaluescanbeanytype,andtheyareindexedbyintegers,sointhatrespecttuplesarealotlikelists.Theimportant differenceisthattuplesareimmutable. Syntactically,atupleisacommaseparatedlistofvalues:
> > >t=' a ' ,' b ' ,' c ' ,' d ' ,' e '
Althoughitisnotnecessary,itiscommontoenclosetuplesinparentheses:
> > >t=( ' a ' ,' b ' ,' c ' ,' d ' ,' e ' )
Tocreateatuplewithasingleelement,youhavetoincludethefinalcomma:
> > >t 1=( ' a ' , ) > > >t y p e ( t 1 ) < t y p e' t u p l e ' >
Anotherwaytocreateatupleisthebuiltinfunction t u p l e .Withnoargument,itcreatesanemptytuple:
> > >t=t u p l e ( ) > > >p r i n tt ( )
Iftheargumentisasequence(string,listortuple),theresultisatuplewiththeelementsofthesequence:
> > >t=t u p l e ( ' l u p i n s ' ) > > >p r i n tt
en.wikibooks.org/wiki/Think_Python/Print_version 117/282
10/24/13
( ' l ' ,' u ' ,' p ' ,' i ' ,' n ' ,' s ' )
Andthesliceoperatorselectsarangeofelements.
> > >p r i n tt [ 1 : 3 ] ( ' b ' ,' c ' )
Butifyoutrytomodifyoneoftheelementsofthetuple,yougetanerror:
> > >t [ 0 ]=' A ' T y p e E r r o r :o b j e c td o e s n ' ts u p p o r ti t e ma s s i g n m e n t
Youcantmodifytheelementsofatuple,butyoucanreplaceonetuplewithanother:
> > >t=( ' A ' , )+t [ 1 : ] > > >p r i n tt ( ' A ' ,' b ' ,' c ' ,' d ' ,' e ' )
Tupleassignment
Itisoftenusefultoswapthevaluesoftwovariables.Withconventionalassignments,youhavetouseatemporaryvariable.Forexample,toswap a and b :
> > >t e m p=a > > >a=b > > >b=t e m p
Thissolutioniscumbersome tupleassignmentismoreelegant:
> > >a ,b=b ,a
en.wikibooks.org/wiki/Think_Python/Print_version
118/282
10/24/13
Moregenerally,therightsidecanbeanykindofsequence(string,listortuple).Forexample,tosplitanemailaddressintoausernameandadomain,you couldwrite:
> > >a d d r=' m o n t y @ p y t h o n . o r g ' > > >u n a m e ,d o m a i n=a d d r . s p l i t ( ' @ ' )
Tuplesasreturnvalues
Strictlyspeaking,afunctioncanonlyreturnonevalue,butifthevalueisatuple,theeffectisthesameasreturningmultiplevalues.Forexample,ifyouwant todividetwointegersandcomputethequotientandremainder,itisinefficienttocompute x / y andthen x % y .Itisbettertocomputethembothatthesame time. Thebuiltinfunction d i v m o d takestwoargumentsandreturnsatupleoftwovalues,thequotientandremainder.Youcanstoretheresultasatuple:
> > >t=d i v m o d ( 7 ,3 ) > > >p r i n tt ( 2 ,1 )
Orusetupleassignmenttostoretheelementsseparately:
> > >q u o t ,r e m=d i v m o d ( 7 ,3 ) > > >p r i n tq u o t 2 > > >p r i n tr e m 1
en.wikibooks.org/wiki/Think_Python/Print_version
119/282
10/24/13
Hereisanexampleofafunctionthatreturnsatuple:
d e fm i n _ m a x ( t ) : r e t u r nm i n ( t ) ,m a x ( t )
m a x and m i n arebuiltinfunctionsthatfindthelargestandsmallestelementsofasequence. m i n _ m a x computesbothandreturnsatupleoftwovalues.
Variablelengthargumenttuples
Functionscantakeavariablenumberofarguments.Aparameternamethatbeginswith * gathersargumentsintoatuple.Forexample, p r i n t a l l takesany numberofargumentsandprintsthem:
d e fp r i n t a l l ( * a r g s ) : p r i n ta r g s
Thegatherparametercanhaveanynameyoulike,but a r g s isconventional.Hereshowthefunctionworks:
> > >p r i n t a l l ( 1 ,2 . 0 ,' 3 ' ) ( 1 ,2 . 0 ,' 3 ' )
Youcancombinethegatheroperatorwithrequiredandpositionalarguments:
d e fp o i n t l e s s ( r e q u i r e d ,o p t i o n a l = 0 ,* a r g s ) : p r i n tr e q u i r e d ,o p t i o n a l ,a r g s
Butifyouscatterthetuple,itworks:
> > >d i v m o d ( * t ) ( 2 ,1 )
en.wikibooks.org/wiki/Think_Python/Print_version
120/282
10/24/13
Exercise1
Manyofthebuiltinfunctionsusevariablelengthargumenttuples.Forexample,'m a x 'and'm i n 'cantakeanynumberofarguments:
' ' > > >m a x ( 1 , 2 , 3 ) 3 ' '
But's u m 'doesnot.
' ' > > >s u m ( 1 , 2 , 3 ) T y p e E r r o r :s u me x p e c t e da tm o s t2a r g u m e n t s ,g o t3 ' '
Writeafunctioncalled's u m a l l 'thattakesanynumberofargumentsandreturnstheirsum.
Listsandtuples
z i p isabuiltinfunctionthattakestwoormoresequencesandzipsthemintoalist 1oftupleswhereeachtuplecontainsoneelementfromeachsequence.
Thisexamplezipsastringandalist:
> > >s=' a b c ' > > >t=[ 0 ,1 ,2 ] > > >z i p ( s ,t ) [ ( ' a ' ,0 ) ,( ' b ' ,1 ) ,( ' c ' ,2 ) ]
Theresultisalistoftupleswhereeachtuplecontainsacharacterfromthestringandthecorrespondingelementfromthelist. Ifthesequencesarenotthesamelength,theresulthasthelengthoftheshorterone.
> > >z i p ( ' A n n e ' ,' E l k ' ) [ ( ' A ' ,' E ' ) ,( ' n ' ,' l ' ) ,( ' n ' ,' k ' ) ]
Youcanusetupleassignmentina f o r looptotraversealistoftuples:
t=[ ( ' a ' ,0 ) ,( ' b ' ,1 ) ,( ' c ' ,2 ) ] f o rl e t t e r ,n u m b e ri nt : p r i n tn u m b e r ,l e t t e r
en.wikibooks.org/wiki/Think_Python/Print_version
121/282
10/24/13
Ifyouneedtotraversetheelementsofasequenceandtheirindices,youcanusethebuiltinfunction e n u m e r a t e :
f o ri n d e x ,e l e m e n ti ne n u m e r a t e ( ' a b c ' ) : p r i n ti n d e x ,e l e m e n t
Theoutputofthisloopis:
0a 1b 2c
Again.
Dictionariesandtuples
Dictionarieshaveamethodcalled i t e m s thatreturnsalistoftuples,whereeachtupleisakeyvaluepair2.
> > >d={ ' a ' : 0 ,' b ' : 1 ,' c ' : 2 } > > >t=d . i t e m s ( ) > > >p r i n tt [ ( ' a ' ,0 ) ,( ' c ' ,2 ) ,( ' b ' ,1 ) ]
Asyoushouldexpectfromadictionary,theitemsareinnoparticularorder. Conversely,youcanusealistoftuplestoinitializeanewdictionary:
en.wikibooks.org/wiki/Think_Python/Print_version 122/282
10/24/13
> > >t=[ ( ' a ' ,0 ) ,( ' c ' ,2 ) ,( ' b ' ,1 ) ] > > >d=d i c t ( t ) > > >p r i n td { ' a ' :0 ,' c ' :2 ,' b ' :1 }
Theoutputofthisloopis:
0a 2c 1b
Theexpressioninbracketsisatuple.Wecouldusetupleassignmenttotraversethisdictionary.
f o rl a s t ,f i r s ti nd i r e c t o r y : p r i n tf i r s t ,l a s t ,d i r e c t o r y [ l a s t , f i r s t ]
en.wikibooks.org/wiki/Think_Python/Print_version
123/282
10/24/13
Therearetwowaystorepresenttuplesinastatediagram.Themoredetailedversionshowstheindicesandelementsjustastheyappearinalist.For example,thetuple ( ' C l e e s e ' ,' J o h n ' ) wouldappear: <IMGSRC="book020.png"> Butinalargerdiagramyoumightwanttoleaveoutthedetails.Forexample,adiagramofthetelephonedirectorymightappear: <IMGSRC="book021.png"> HerethetuplesareshownusingPythonsyntaxasagraphicalshorthand. ThetelephonenumberinthediagramisthecomplaintslinefortheBBC,sopleasedontcallit.
Comparingtuples
ThecomparisonoperatorsworkwithtuplesandothersequencesPythonstartsbycomparingthefirstelementfromeachsequence.Iftheyareequal,itgoes ontothenextelements,andsoon,untilitfindselementsthatdiffer.Subsequentelementsarenotconsidered(eveniftheyarereallybig).
> > >( 0 ,1 ,2 )<( 0 ,3 ,4 ) T r u e > > >( 0 ,1 ,2 0 0 0 0 0 0 )<( 0 ,3 ,4 ) T r u e
The s o r t functionworksthesameway.Itsortsprimarilybyfirstelement,butinthecaseofatie,itsortsbysecondelement,andsoon. Thisfeaturelendsitselftoapatterncalled DSUfor Decorate asequencebybuildingalistoftupleswithoneormoresortkeysprecedingtheelementsfromthesequence, Sort thelistoftuples,and Undecorate byextractingthesortedelementsofthesequence. Forexample,supposeyouhavealistofwordsandyouwanttosortthemfromlongesttoshortest:
d e fs o r t _ b y _ l e n g t h ( w o r d s ) : t=[ ] f o rw o r di nw o r d s : t . a p p e n d ( ( l e n ( w o r d ) ,w o r d ) ) t . s o r t ( r e v e r s e = T r u e )
en.wikibooks.org/wiki/Think_Python/Print_version
124/282
10/24/13
r e s=[ ] f o rl e n g t h ,w o r di nt : r e s . a p p e n d ( w o r d ) r e t u r nr e s
Thefirstloopbuildsalistoftuples,whereeachtupleisawordprecededbyitslength.
s o r t comparesthefirstelement,length,first,andonlyconsidersthesecondelementtobreakties.Thekeywordargument r e v e r s e = T r u e tells s o r t togoin
decreasingorder. Thesecondlooptraversesthelistoftuplesandbuildsalistofwordsindescendingorderoflength.
Exercise2
Inthisexample,tiesarebrokenbycomparingwords,sowordswiththesamelengthappearinalphabeticalorder.Forotherapplicationsyoumightwantto breaktiesatrandom.Modifythisexamplesothatwordswiththesamelengthappearinrandomorder.Hint:seethe'r a n d o m 'functioninthe'r a n d o m 'module.
Sequencesofsequences
Ihavefocusedonlistsoftuples,butalmostalloftheexamplesinthischapteralsoworkwithlistsoflists,tuplesoftuples,andtuplesoflists.Toavoid enumeratingthepossiblecombinations,itissometimeseasiertotalkaboutsequencesofsequences. Inmanycontexts,thedifferentkindsofsequences(strings,listsandtuples)canbeusedinterchangeably.Sohowandwhydoyouchooseoneovertheothers? Tostartwiththeobvious,stringsaremorelimitedthanothersequencesbecausetheelementshavetobecharacters.Theyarealsoimmutable.Ifyouneed theabilitytochangethecharactersinastring(asopposedtocreatinganewstring),youmightwanttousealistofcharactersinstead. Listsaremorecommonthantuples,mostlybecausetheyaremutable.Butthereareafewcaseswhereyoumightprefertuples: Insomecontexts,likea r e t u r n statement,itissyntacticallysimplertocreateatuplethanalist.Inothercontexts,youmightpreferalist. Ifyouwanttouseasequenceasadictionarykey,youhavetouseanimmutabletypelikeatupleorstring. Ifyouarepassingasequenceasanargumenttoafunction,usingtuplesreducesthepotentialforunexpectedbehaviorduetoaliasing. Becausetuplesareimmutable,theydontprovidemethodslike s o r t and r e v e r s e ,whichmodifyexistinglists.ButPythonprovidesthebuiltinfunctions s o r t e d and r e v e r s e d ,whichtakeanysequenceasaparameterandreturnanewlistwiththesameelementsinadifferentorder.
Debugging
Lists,dictionariesandtuplesareknowngenericallyas datastructuresinthischapterwearestartingtoseecompounddatastructures,likelistsoftuples, anddictionariesthatcontaintuplesaskeysandlistsasvalues.Compounddatastructuresareuseful,buttheyarepronetowhatIcall shapeerrorsthatis, errorscausedwhenadatastructurehasthewrongtype,sizeorcomposition.Forexample,ifyouareexpectingalistwithoneintegerandIgiveyouaplainold integer(notinalist),itwontwork.
125/282
10/24/13
Afancierprogrammightwritelistof3int s,butitwaseasiernottodealwithplurals.Heresalistoflists:
> > >t 2=[ [ 1 , 2 ] ,[ 3 , 4 ] ,[ 5 , 6 ] ] > > >p r i n ts t r u c t s h a p e ( t 2 ) l i s to f3l i s to f2i n t
Iftheelementsofthelistarenotthesametype, s t r u c t s h a p e groupsthem,inorder,bytype:
> > >t 3=[ 1 ,2 ,3 ,4 . 0 ,' 5 ' ,' 6 ' ,[ 7 ] ,[ 8 ] ,9 ] > > >p r i n ts t r u c t s h a p e ( t 3 ) l i s to f( 3i n t ,f l o a t ,2s t r ,2l i s to fi n t ,i n t )
Heresalistoftuples:
> > >s=' a b c ' > > >l t=z i p ( t ,s ) > > >p r i n ts t r u c t s h a p e ( l t ) l i s to f3t u p l eo f( i n t ,s t r )
Andheresadictionarywith3itemsthatmapintegerstostrings.
> > >d=d i c t ( l t ) > > >p r i n ts t r u c t s h a p e ( d ) d i c to f3i n t > s t r
Ifyouarehavingtroublekeepingtrackofyourdatastructures, s t r u c t s h a p e canhelp.
Glossary
tuple:
en.wikibooks.org/wiki/Think_Python/Print_version 126/282
10/24/13
Animmutablesequenceofelements. tupleassignment: Anassignmentwithasequenceontherightsideandatupleofvariablesontheleft.Therightsideisevaluatedandthenitselementsareassignedto thevariablesontheleft. gather: Theoperationofassemblingavariablelengthargumenttuple. scatter: Theoperationoftreatingasequenceasalistofarguments. DSU: Abbreviationofdecoratesortundecorate,apatternthatinvolvesbuildingalistoftuples,sorting,andextractingpartoftheresult. datastructure: Acollectionofrelatedvalues,oftenorganizedinlists,dictionaries,tuples,etc. shape(ofadatastructure): Asummaryofthetype,sizeandcompositionofadatastructure.
Exercises
Exercise3
Writeafunctioncalled m o s t _ f r e q u e n t thattakesastringandprintsthelettersindecreasingorderoffrequency.Findtextsamplesfromseveraldifferent languagesandseehowletterfrequencyvariesbetweenlanguages.Compareyourresultswiththetablesat'w i k i p e d i a . o r g / w i k i / L e t t e r _ f r e q u e n c i e s '.
Exercise4
Moreanagrams! Writeaprogram thatreadsawordlistfromafile(seeSection'9.1')andprintsallthesetsofwordsthatareanagrams. Hereisanexampleofwhattheoutputmightlooklike:
' ' [ ' d e l t a s ' ,' d e s a l t ' ,' l a s t e d ' ,' s a l t e d ' ,' s l a t e d ' ,' s t a l e d ' ] [ ' r e t a i n e r s ' ,' t e r n a r i e s ' ] [ ' g e n e r a t i n g ' ,' g r e a t e n i n g ' ] [ ' r e s m e l t s ' ,' s m e l t e r s ' ,' t e r m l e s s ' ] ' '
10/24/13
Exercise5
HeresanotherCarTalkPuzzler4: WhatisthelongestEnglishword,thatremainsavalidEnglishword,asyouremoveitslettersoneatatime? Now,letterscanberemovedfrom eitherend,orthemiddle,butyoucantrearrangeanyoftheletters.Everytimeyoudropaletter,youwindupwithanotherEnglishword.Ifyou dothat,youreeventuallygoingtowindupwithoneletterandthattooisgoingtobeanEnglishwordonethatsfoundinthedictionary.Iwant toknowwhatsthelongestwordandhowmanylettersdoesithave? Imgoingtogiveyoualittlemodestexample:Sprite.Ok?Youstart offwithsprite,youtakealetteroff,onefromtheinterioroftheword,take theraway,andwereleftwiththewordspite,thenwetaketheeofftheend,wereleftwithspit,wetakethesoff,wereleftwithpit,it,andI. Writeaprogramtofindallwordsthatcanbereducedinthisway, andthenfindthelongestone. Thisexerciseisalittlemorechallengingthanmost,soherearesomesuggestions: Youmightwanttowriteafunctionthattakesawordand computesalistofallthewordsthatcanbeformedbyremovingoneletter.Thesearethechildrenoftheword. Recursively,awordisreducibleifanyofitschildren arereducible.Asabasecase,youcanconsidertheemptystringreducible. ThewordlistIprovided,'w o r d s . t x t ',doesnt containsingleletterwords.SoyoumightwanttoaddI,a,andtheemptystring. Toimprovetheperformanceofyourprogram,youmightwant tomemoizethewordsthatareknowntobereducible. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / r e d u c i b l e . p y '.
en.wikibooks.org/wiki/Think_Python/Print_version 128/282
10/24/13
=Casestudy:datastructureselection}}
Wordfrequencyanalysis
Asusual,youshouldatleastattemptthefollowingexercisesbeforeyoureadmysolutions.
Exercise1
Writeaprogramthatreadsafile,breakseachlineintowords,stripswhitespaceandpunctuationfromthewords,andconvertsthemtolowercase. Hint:The's t r i n g 'moduleprovidesstringsnamed'w h i t e s p a c e ', whichcontainsspace,tab,newline,etc.,and'p u n c t u a t i o n 'whichcontainsthepunctuation characters.LetsseeifwecanmakePythonswear:
> > >i m p o r ts t r i n g > > >p r i n ts t r i n g . p u n c t u a t i o n ! " # $ % & ' ( ) * + , . / : ; < = > ? @ [ \ ] ^ _ ` { | } ~
Exercise2
GotoProjectGutenberg('g u t e n b e r g . o r g ')anddownloadyourfavoriteoutofcopyrightbookinplaintextformat. Modifyyourprogramfromthepreviousexercisetoreadthebookyoudownloaded,skipovertheheaderinformationatthebeginningofthefile,andprocess therestofthewordsasbefore. Thenmodifytheprogramtocountthetotalnumberofwordsinthebook,andthenumberoftimeseachwordisused. Printthenumberofdifferentwordsusedinthebook.Comparedifferentbooksbydifferentauthors,writtenindifferenteras.Whichauthorusesthemost extensivevocabulary?
en.wikibooks.org/wiki/Think_Python/Print_version
129/282
10/24/13
Exercise3
Modifytheprogramfromthepreviousexercisetoprintthe20mostfrequentlyusedwordsinthebook.
Exercise4
Modifythepreviousprogramtoreadawordlist(seeSection'9.1')andthenprintallthewordsinthebookthatarenotinthewordlist.Howmanyofthemare typos?Howmanyofthemarecommonwordsthat shouldbeinthewordlist,andhowmanyofthemarereallyobscure?
Randomnumbers
Giventhesameinputs,mostcomputerprogramsgeneratethesameoutputseverytime,sotheyaresaidtobe deterministic.Determinismisusuallyagood thing,sinceweexpectthesamecalculationtoyieldthesameresult.Forsomeapplications,though,wewantthecomputertobeunpredictable.Gamesarean obviousexample,buttherearemore. Makingaprogramtrulynondeterministicturnsouttobenotsoeasy,buttherearewaystomakeitatleastseemnondeterministic.Oneofthemistouse algorithmsthatgenerate pseudorandomnumbers.Pseudorandomnumbersarenottrulyrandombecausetheyaregeneratedbyadeterministiccomputation, butjustbylookingatthenumbersitisallbutimpossibletodistinguishthemfromrandom. The r a n d o m moduleprovidesfunctionsthatgeneratepseudorandomnumbers(whichIwillsimplycallrandomfromhereon). Thefunction r a n d o m returnsarandomfloatbetween0.0and1.0(including0.0butnot1.0).Eachtimeyoucall r a n d o m ,yougetthenextnumberinalongseries. Toseeasample,runthisloop:
i m p o r tr a n d o m f o rii nr a n g e ( 1 0 ) : x=r a n d o m . r a n d o m ( ) p r i n tx
Tochooseanelementfromasequenceatrandom,youcanuse c h o i c e :
> > >t=[ 1 ,2 ,3 ] > > >r a n d o m . c h o i c e ( t ) 2 > > >r a n d o m . c h o i c e ( t )
en.wikibooks.org/wiki/Think_Python/Print_version 130/282
10/24/13
The r a n d o m modulealsoprovidesfunctionstogeneraterandomvaluesfromcontinuousdistributionsincludingGaussian,exponential,gamma,andafewmore.
Exercise5
Writeafunctionnamed c h o o s e _ f r o m _ h i s t thattakesahistogramasdefinedinSection'11.1'andreturnsarandomvaluefromthehistogram,chosenwith probabilityinproportiontofrequency.Forexample,forthishistogram:
' ' > > >t=[ ' a ' ,' a ' ,' b ' ] > > >h=h i s t o g r a m ( t ) > > >p r i n th { ' a ' :2 ,' b ' :1 } ' '
Wordhistogram
Hereisaprogramthatreadsafileandbuildsahistogramofthewordsinthefile:
i m p o r ts t r i n g d e fp r o c e s s _ f i l e ( f i l e n a m e ) : h=d i c t ( ) f p=o p e n ( f i l e n a m e ) f o rl i n ei nf p : p r o c e s s _ l i n e ( l i n e ,h ) r e t u r nh d e fp r o c e s s _ l i n e ( l i n e ,h ) : l i n e=l i n e . r e p l a c e ( ' ' ,'' ) f o rw o r di nl i n e . s p l i t ( ) : w o r d=w o r d . s t r i p ( s t r i n g . p u n c t u a t i o n+s t r i n g . w h i t e s p a c e ) w o r d=w o r d . l o w e r ( ) h [ w o r d ]=h . g e t ( w o r d ,0 )+1 h i s t=p r o c e s s _ f i l e ( ' e m m a . t x t ' )
10/24/13
Thenumberofdifferentwordsisjustthenumberofitemsinthedictionary:
d e fd i f f e r e n t _ w o r d s ( h ) : r e t u r nl e n ( h )
Hereissomecodetoprinttheresults:
p r i n t' T o t a ln u m b e ro fw o r d s : ' ,t o t a l _ w o r d s ( h i s t ) p r i n t' N u m b e ro fd i f f e r e n tw o r d s : ' ,d i f f e r e n t _ w o r d s ( h i s t )
Andtheresults:
T o t a ln u m b e ro fw o r d s :1 6 1 0 7 3 N u m b e ro fd i f f e r e n tw o r d s :7 2 1 2
Mostcommonwords
Tofindthemostcommonwords,wecanapplytheDSUpattern m o s t _ c o m m o n takesahistogramandreturnsalistofwordfrequencytuples,sortedinreverse orderbyfrequency:
d e fm o s t _ c o m m o n ( h ) : t=[ ] f o rk e y ,v a l u ei nh . i t e m s ( ) : t . a p p e n d ( ( v a l u e ,k e y ) ) t . s o r t ( r e v e r s e = T r u e ) r e t u r nt
Hereisaloopthatprintsthetenmostcommonwords:
en.wikibooks.org/wiki/Think_Python/Print_version 132/282
10/24/13
Andherearetheresultsfrom Emma:
T h em o s tc o m m o nw o r d sa r e : t o 5 2 4 2 t h e 5 2 0 4 a n d 4 8 9 7 o f 4 2 9 3 i 3 1 9 1 a 3 1 3 0 i t 2 5 2 9 h e r 2 4 8 3 w a s 2 4 0 0 s h e 2 3 6 4
Optionalparameters
Wehaveseenbuiltinfunctionsandmethodsthattakeavariablenumberofarguments.Itispossibletowriteuserdefinedfunctionswithoptionalarguments, too.Forexample,hereisafunctionthatprintsthemostcommonwordsinahistogram
d e fp r i n t _ m o s t _ c o m m o n ( h i s t ,n u m = 1 0 ) t=m o s t _ c o m m o n ( h i s t ) p r i n t' T h em o s tc o m m o nw o r d sa r e : ' f o rf r e q ,w o r di nt [ 0 : n u m ] : p r i n tw o r d ,' \ t ' ,f r e q
p r i n t _ m o s t _ c o m m o n ( h i s t ,2 0 )
n u m getsthevalueoftheargumentinstead.Inotherwords,theoptionalargument overridesthedefaultvalue.
en.wikibooks.org/wiki/Think_Python/Print_version 133/282
10/24/13
Ifafunctionhasbothrequiredandoptionalparameters,alltherequiredparametershavetocomefirst,followedbytheoptionalones.
Dictionarysubtraction
Findingthewordsfromthebookthatarenotinthewordlistfrom w o r d s . t x t isaproblemyoumightrecognizeassetsubtractionthatis,wewanttofindallthe wordsfromoneset(thewordsinthebook)thatarenotinanotherset(thewordsinthelist).
s u b t r a c t takesdictionaries d 1 and d 2 andreturnsanewdictionarythatcontainsallthekeysfrom d 1 thatarenotin d 2 .Sincewedontreallycareaboutthevalues,
wesetthemalltoNone.
d e fs u b t r a c t ( d 1 ,d 2 ) : r e s=d i c t ( ) f o rk e yi nd 1 : i fk e yn o ti nd 2 : r e s [ k e y ]=N o n e r e t u r nr e s
Herearesomeoftheresultsfrom Emma:
T h ew o r d si nt h eb o o kt h a ta r e n ' ti nt h ew o r dl i s ta r e : r e n c o n t r ej a n e ' sb l a n c h ew o o d h o u s e sd i s i n g e n u o u s n e s s f r i e n d ' sv e n i c ea p a r t m e n t. . .
Someofthesewordsarenamesandpossessives.Others,likerencontre,arenolongerincommonuse.Butafewarecommonwordsthatshouldreallybein thelist!
Exercise6
Pythonprovidesadatastructurecalled's e t 'thatprovidesmanycommonsetoperations.Readthedocumentationat'd o c s . p y t h o n . o r g / l i b / t y p e s s e t . h t m l 'andwritea programthatusessetsubtractiontofindwordsinthebookthatarenotinthewordlist.
Randomwords
en.wikibooks.org/wiki/Think_Python/Print_version 134/282
10/24/13
Tochoosearandomwordfromthehistogram,thesimplestalgorithmistobuildalistwithmultiplecopiesofeachword,accordingtotheobservedfrequency, andthenchoosefromthelist:
d e fr a n d o m _ w o r d ( h ) : t=[ ] f o rw o r d ,f r e qi nh . i t e m s ( ) : t . e x t e n d ( [ w o r d ]*f r e q ) r e t u r nr a n d o m . c h o i c e ( t )
Exercise7
Thisalgorithmworks,butitisnotveryefficienteachtimeyouchoosearandomword,itrebuildsthelist,whichisasbigastheoriginalbook.Anobvious improvementistobuildthelistonceandthenmakemultipleselections,butthelistisstillbig. Analternativeis: Use'k e y s 'togetalistofthewordsinthebook. Buildalistthatcontainsthecumulativesumoftheword frequencies(seeExercise'10.1').Thelastiteminthislististhetotalnumberofwordsinthebook,'n'. Choosearandomnumberfrom1to'n'.Useabisectionsearch (SeeExercise'10.8')tofindtheindexwheretherandomnumberwouldbeinsertedinthecumulativesum. Usetheindextofindthecorrespondingwordinthewordlist. Writeaprogramthatusesthisalgorithmtochoosearandomwordfromthebook.
Markovanalysis
Ifyouchoosewordsfromthebookatrandom,youcangetasenseofthevocabulary,youprobablywontgetasentence:
t h i st h es m a l lr e g a r dh a r r i e tw h i c hk n i g h t l e y ' si tm o s tt h i n g s
Aseriesofrandomwordsseldommakessensebecausethereisnorelationshipbetweensuccessivewords.Forexample,inarealsentenceyouwouldexpect anarticlelikethetobefollowedbyanadjectiveoranoun,andprobablynotaverboradverb.
10/24/13
OnewaytomeasurethesekindsofrelationshipsisMarkovanalysis,whichcharacterizes,foragivensequenceofwords,theprobabilityofthewordthatcomes next.Forexample,thesong Eric,theHalfaBeebegins: Halfabee,philosophically, Must,ipsofacto,halfnotbe. Buthalfthebeehasgottobe Visavis,itsentity.Dyousee? Butcanabeebesaidtobe Ornottobeanentirebee Whenhalfthebeeisnotabee Duetosomeancientinjury? Inthistext,thephrasehalftheisalwaysfollowedbythewordbee,butthephrasethebeemightbefollowedbyeitherhasoris. TheresultofMarkovanalysisisamappingfromeachprefix(likehalftheandthebee)toallpossiblesuffixes(likehasandis). Giventhismapping,youcangeneratearandomtextbystartingwithanyprefixandchoosingatrandomfromthepossiblesuffixes.Next,youcancombinethe endoftheprefixandthenewsuffixtoformthenextprefix,andrepeat. Forexample,ifyoustartwiththeprefixHalfa,thenthenextwordhastobebee,becausetheprefixonlyappearsonceinthetext.Thenextprefixisa bee,sothenextsuffixmightbephilosophically,beordue. Inthisexamplethelengthoftheprefixisalwaystwo,butyoucandoMarkovanalysiswithanyprefixlength.Thelengthoftheprefixiscalledtheorderofthe analysis.
Exercise8
Markovanalysis: WriteaprogramtoreadatextfromafileandperformMarkovanalysis.Theresultshouldbeadictionarythatmapsfromprefixestoacollectionof possiblesuffixes.Thecollectionmightbealist,tuple,ordictionaryitisuptoyoutomakeanappropriatechoice.Youcantestyourprogramwithprefix lengthtwo,butyoushouldwritetheprograminawaythatmakesiteasytotryotherlengths. AddafunctiontothepreviousprogramtogeneraterandomtextbasedontheMarkovanalysis.HereisanexamplefromEmma withprefixlength2: Hewasveryclever,beitsweetnessorbeangry,ashamedoronly amused,atsuchastroke.ShehadneverthoughtofHannahtillyouwerenevermeantforme?""Icannotmakespeeches,Emma:"hesooncut itallhimself. Forthisexample,Ileftthepunctuationattachedtothewords.Theresultisalmostsyntacticallycorrect,butnotquite.Semantically,italmostmakessense, butnotquite. Whathappensifyouincreasetheprefixlength?Doestherandomtextmakemoresense? Onceyourprogramisworking,youmightwanttotryamashup:ifyouanalyzetextfromtwoormorebooks,therandomtextyougeneratewillblend
en.wikibooks.org/wiki/Think_Python/Print_version 136/282
10/24/13
thevocabularyandphrasesfromthesourcesininterestingways.
Datastructures
UsingMarkovanalysistogeneraterandomtextisfun,butthereisalsoapointtothisexercise:datastructureselection.Inyoursolutiontotheprevious exercises,youhadtochoose: Howtorepresenttheprefixes. Howtorepresentthecollectionofpossiblesuffixes. Howtorepresentthemappingfromeachprefixtothecollectionofpossiblesuffixes. Ok,thelastoneistheeasytheonlymappingtypewehaveseenisadictionary,soitisthenaturalchoice. Fortheprefixes,themostobviousoptionsarestring,listofstrings,ortupleofstrings.Forthesuffixes,oneoptionisalistanotherisahistogram(dictionary). Howshouldyouchoose?Thefirststepistothinkabouttheoperationsyouwillneedtoimplementforeachdatastructure.Fortheprefixes,weneedtobeable toremovewordsfromthebeginningandaddtotheend.Forexample,ifthecurrentprefixisHalfa,andthenextwordisbee,youneedtobeabletoform thenextprefix,abee. Yourfirstchoicemightbealist,sinceitiseasytoaddandremoveelements,butwealsoneedtobeabletousetheprefixesaskeysinadictionary,sothat rulesoutlists.Withtuples,youcantappendorremove,butyoucanusetheadditionoperatortoformanewtuple:
d e fs h i f t ( p r e f i x ,w o r d ) : r e t u r np r e f i x [ 1 : ]+( w o r d , )
s h i f t takesatupleofwords, p r e f i x ,andastring, w o r d ,andformsanewtuplethathasallthewordsin p r e f i x exceptthefirst,and w o r d addedtotheend.
Forthecollectionofsuffixes,theoperationsweneedtoperformincludeaddinganewsuffix(orincreasingthefrequencyofanexistingone),andchoosinga randomsuffix. Addinganewsuffixisequallyeasyforthelistimplementationorthehistogram.Choosingarandomelementfromalistiseasychoosingfromahistogramis hardertodoefficiently(seeExercise13.7). Sofarwehavebeentalkingmostlyabouteaseofimplementation,butthereareotherfactorstoconsiderinchoosingdatastructures.Oneisruntime. Sometimesthereisatheoreticalreasontoexpectonedatastructuretobefasterthanotherforexample,Imentionedthatthe i n operatorisfasterfor dictionariesthanforlists,atleastwhenthenumberofelementsislarge. Butoftenyoudontknowaheadoftimewhichimplementationwillbefaster.Oneoptionistoimplementbothofthemandseewhichisbetter.Thisapproach iscalled benchmarking.Apracticalalternativeistochoosethedatastructurethatiseasiesttoimplement,andthenseeifitisfastenoughfortheintended application.Ifso,thereisnoneedtogoon.Ifnot,therearetools,likethe p r o f i l e module,thatcanidentifytheplacesinaprogramthattakethemosttime.
10/24/13
Debugging
Whenyouaredebuggingaprogram,andespeciallyifyouareworkingonahardbug,therearefourthingstotry: reading: Examineyourcode,readitbacktoyourself,andcheckthatitsayswhatyoumeanttosay. running: Experimentbymakingchangesandrunningdifferentversions.Oftenifyoudisplaytherightthingattherightplaceintheprogram,theproblem becomesobvious,butsometimesyouhavetospendsometimetobuildscaffolding. ruminating: Takesometimetothink!Whatkindoferrorisit:syntax,runtime,semantic?Whatinformationcanyougetfromtheerrormessages,orfromtheoutput oftheprogram?Whatkindoferrorcouldcausetheproblemyoureseeing?Whatdidyouchangelast,beforetheproblemappeared? retreating: Atsomepoint,thebestthingtodoisbackoff,undoingrecentchanges,untilyougetbacktoaprogramthatworksandthatyouunderstand.Thenyou canstartingrebuilding. Beginningprogrammerssometimesgetstuckononeoftheseactivitiesandforgettheothers.Eachactivitycomeswithitsownfailuremode. Forexample,readingyourcodemighthelpiftheproblemisatypographicalerror,butnotiftheproblemisaconceptualmisunderstanding.Ifyoudont understandwhatyourprogramdoes,youcanreadit100timesandneverseetheerror,becausetheerrorisinyourhead. Runningexperimentscanhelp,especiallyifyourunsmall,simpletests.Butifyourunexperimentswithoutthinkingorreadingyourcode,youmightfallintoa patternIcallrandomwalkprogramming,whichistheprocessofmakingrandomchangesuntiltheprogramdoestherightthing.Needlesstosay,random walkprogrammingcantakealongtime. Youhavetotaketimetothink.Debuggingislikeanexperimentalscience.Youshouldhaveatleastonehypothesisaboutwhattheproblemis.Iftherearetwo ormorepossibilities,trytothinkofatestthatwouldeliminateoneofthem. Takingabreakhelpswiththethinking.Sodoestalking.Ifyouexplaintheproblemtosomeoneelse(orevenyourself),youwillsometimesfindtheanswer beforeyoufinishaskingthequestion. Buteventhebestdebuggingtechniqueswillfailiftherearetoomanyerrors,orifthecodeyouaretryingtofixistoobigandcomplicated.Sometimesthebest optionistoretreat,simplifyingtheprogramuntilyougettosomethingthatworksandthatyouunderstand.
10/24/13
Glossary
deterministic: Pertainingtoaprogramthatdoesthesamethingeachtimeitruns,giventhesameinputs. pseudorandom: Pertainingtoasequenceofnumbersthatappeartoberandom,butaregeneratedbyadeterministicprogram. defaultvalue: Thevaluegiventoanoptionalparameterifnoargumentisprovided. override: Toreplaceadefaultvaluewithanargument. benchmarking: Theprocessofchoosingbetweendatastructuresbyimplementingalternativesandtestingthemonasampleofthepossibleinputs.
Exercises
Exercise9
Therankofawordisitspositioninalistofwordssortedbyfrequency:themostcommonwordhasrank1,thesecondmostcommonhasrank2,etc. Zipfslawdescribesarelationshipbetweentheranksandfrequenciesofwordsinnaturallanguages1.Specifically,itpredictsthatthefrequency,'f',oftheword withrank'r'is:
Exercise6
Apalindromeisawordthatisspelledthesamebackwardandforward,likenoonandredivider.Recursively,awordisapalindromeifthefirstandlast lettersarethesameandthemiddleisapalindrome.
en.wikibooks.org/wiki/Think_Python/Print_version 139/282
10/24/13
Thefollowingarefunctionsthattakeastringargumentandreturnthefirst,last,andmiddleletters:
d e ff i r s t ( w o r d ) : r e t u r nw o r d [ 0 ] d e fl a s t ( w o r d ) : r e t u r nw o r d [ 1 ] d e fm i d d l e ( w o r d ) : r e t u r nw o r d [ 1 : 1 ]
WellseehowtheyworkinChapter'8'. Typethesefunctionsintoafilenamed'p a l i n d r o m e . p y ' andtestthemout.Whathappensifyoucall'm i d d l e 'withastringwithtwoletters?Oneletter?Whatabouttheemptystring,whichiswritten ' andcontains noletters? Writeafunctioncalled i s _ p a l i n d r o m e thattakes astringargumentandreturns'T r u e 'ifitisapalindromeand'F a l s e 'otherwise.Rememberthatyoucanusethebuiltinfunction'l e n 'tocheckthelengthofa string.
Exercise7
Anumber,'a',isapowerof'b'ifitisdivisibleby'b'and'a/ b'isapowerof'b'.Writeafunctioncalled i s _ p o w e r thattakesparameters'a 'and'b 'andreturns'T r u e ' if'a 'isapowerof'b '.
Exercise8
Thegreatestcommondivisor(GCD)of'a'and'b'isthelargestnumberthatdividesbothofthemwithnoremainder[6]. OnewaytofindtheGCDoftwonumbersisEuclidsalgorithm, whichisbasedontheobservationthatif'r'istheremainderwhen'a'isdividedby'b',then 'gcd(a, b)= gcd(b, r)'.Asabasecase,wecanconsider'gcd(a,0)= a'. Writeafunctioncalled g c d thattakesparameters'a 'and'b 'andreturnstheirgreatestcommondivisor.Ifyouneedhelp,see 'w i k i p e d i a . o r g / w i k i / E u c l i d e a n _ a l g o r i t h m '.
Notes
1. InPython3.0,theresultofthisdivisionisa f l o a t .Thenewoperator / / performsintegerdivision.
en.wikibooks.org/wiki/Think_Python/Print_version
140/282
10/24/13
Iteration
Multipleassignment
Asyoumayhavediscovered,itislegaltomakemorethanoneassignmenttothesamevariable.Anewassignmentmakesanexistingvariablerefertoanew value(andstopreferringtotheoldvalue).
b r u c e=5 p r i n tb r u c e , b r u c e=7 p r i n tb r u c e
Theoutputofthisprogramis 57 ,becausethefirsttime b r u c e isprinted,itsvalueis5,andthesecondtime,itsvalueis7.Thecommaattheendofthefirst p r i n t statementsuppressesthenewline,whichiswhybothoutputsappearonthesameline. Hereiswhat multipleassignmentlookslikeinastatediagram: <IMGSRC="book010.png"> Withmultipleassignmentitisespeciallyimportanttodistinguishbetweenanassignmentoperationandastatementofequality.BecausePythonusesthe equalsign(= )forassignment,itistemptingtointerpretastatementlike a=b asastatementofequality.Itisnot! First,equalityisasymmetricrelationandassignmentisnot.Forexample,inmathematics,if a=7then7= a.ButinPython,thestatement a=7 islegaland 7=a isnot. Furthermore,inmathematics,astatementofequalityiseithertrueorfalse,foralltime.If a= bnow,then awillalwaysequal b.InPython,anassignment statementcanmaketwovariablesequal,buttheydonthavetostaythatway:
a=5 b=a a=3
Updatingvariables
Oneofthemostcommonformsofmultipleassignmentisan update,wherethenewvalueofthevariabledependsontheold.
x=x + 1
en.wikibooks.org/wiki/Think_Python/Print_version 141/282
10/24/13
Beforeyoucanupdateavariable,youhaveto initializeit,usuallywithasimpleassignment:
> > >x=0 > > >x=x + 1
Thew h i l e statement
Computersareoftenusedtoautomaterepetitivetasks.Repeatingidenticalorsimilartaskswithoutmakingerrorsissomethingthatcomputersdowelland peopledopoorly. Wehaveseentwoprograms, c o u n t d o w n and p r i n t _ n ,thatuserecursiontoperformrepetition,whichisalsocalled iteration.Becauseiterationissocommon, Pythonprovidesseverallanguagefeaturestomakeiteasier.Oneisthe f o r statementwesawinSection4.2.Wellgetbacktothatlater. Anotheristhe w h i l e statement.Hereisaversionof c o u n t d o w n thatusesa w h i l e statement:
d e fc o u n t d o w n ( n ) : w h i l en>0 : p r i n tn n=n 1 p r i n t' B l a s t o f f ! '
Youcanalmostreadthe w h i l e statementasifitwereEnglish.Itmeans,While n isgreaterthan0,displaythevalueof n andthenreducethevalueof n by1. Whenyougetto0,displaytheword B l a s t o f f ! Moreformally,hereistheflowofexecutionfora w h i l e statement: Evaluatethecondition,yielding T r u e or F a l s e . Iftheconditionisfalse,exitthe w h i l e statementandcontinueexecutionatthenextstatement. Iftheconditionistrue,executethebodyandthengobacktostep1. Thistypeofflowiscalleda loopbecausethethirdsteploopsbackaroundtothetop.
en.wikibooks.org/wiki/Think_Python/Print_version 142/282
10/24/13
#ni se v e n #ni so d d
Theconditionforthisloopis n! =1 ,sotheloopwillcontinueuntil n is 1 ,whichmakestheconditionfalse. Eachtimethroughtheloop,theprogramoutputsthevalueof n andthencheckswhetheritisevenorodd.Ifitiseven, n isdividedby2.Ifitisodd,thevalue of n isreplacedwith n * 3 + 1 .Forexample,iftheargumentpassedto s e q u e n c e is3,theresultingsequenceis3,10,5,16,8,4,2,1. Since n sometimesincreasesandsometimesdecreases,thereisnoobviousproofthat n willeverreach1,orthattheprogramterminates.Forsomeparticular valuesof n ,wecanprovetermination.Forexample,ifthestartingvalueisapoweroftwo,thenthevalueof n willbeeveneachtimethroughtheloopuntilit reaches1.Thepreviousexampleendswithsuchasequence,startingwith16. Thehardquestioniswhetherwecanprovethatthisprogramterminatesfor allpositivevaluesof n .Sofar1,noonehasbeenabletoproveit ordisproveit! Exercise1 Rewritethefunction p r i n t _ n fromSection'5.8'usingiterationinsteadofrecursion.
b r e a k
Sometimesyoudontknowitstimetoendaloopuntilyougethalfwaythroughthebody.Inthatcaseyoucanusethe b r e a k statementtojumpoutofthe loop. Forexample,supposeyouwanttotakeinputfromtheuseruntiltheytype d o n e .Youcouldwrite:
w h i l eT r u e : l i n e=r a w _ i n p u t ( ' >' ) i fl i n e= =' d o n e ' : b r e a k p r i n tl i n e p r i n t' D o n e ! '
en.wikibooks.org/wiki/Think_Python/Print_version 143/282
10/24/13
Squareroots
Loopsareoftenusedinprogramsthatcomputenumericalresultsbystartingwithanapproximateansweranditerativelyimprovingit. Forexample,onewayofcomputingsquarerootsisNewtonsmethod.Supposethatyouwanttoknowthesquarerootof a.Ifyoustartwithalmostany estimate, x,youcancomputeabetterestimatewiththefollowingformula: x+ a/ x 2
y=
Whichisclosertothecorrectanswer(4=2).Ifwerepeattheprocesswiththenewestimate,itgetsevencloser:
> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 6 4 1 0 2 5 6 4 1
Afterafewmoreupdates,theestimateisalmostexact:
en.wikibooks.org/wiki/Think_Python/Print_version
144/282
10/24/13
> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 0 0 1 0 2 4 0 0 3 > > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 0 0 0 0 0 0 0 0 0 3
Ingeneralwedontknowaheadoftimehowmanystepsittakestogettotherightanswer,butweknowwhenwegettherebecausetheestimatestops changing:
> > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0 > > >x=y > > >y=( x+a / x )/2 > > >p r i n ty 2 . 0
10/24/13
Algorithms
Newtonsmethodisanexampleofan algorithm:itisamechanicalprocessforsolvingacategoryofproblems(inthiscase,computingsquareroots). Itisnoteasytodefineanalgorithm.Itmighthelptostartwithsomethingthatisnotanalgorithm.Whenyoulearnedtomultiplysingledigitnumbers,you probablymemorizedthemultiplicationtable.Ineffect,youmemorized100specificsolutions.Thatkindofknowledgeisnotalgorithmic. Butifyouwerelazy,youprobablycheatedbylearningafewtricks.Forexample,tofindtheproductof nand9,youcanwrite n1asthefirstdigitand10n astheseconddigit.Thistrickisageneralsolutionformultiplyinganysingledigitnumberby9.Thatsanalgorithm! Similarly,thetechniquesyoulearnedforadditionwithcarrying,subtractionwithborrowing,andlongdivisionareallalgorithms.Oneofthecharacteristicsof algorithmsisthattheydonotrequireanyintelligencetocarryout.Theyaremechanicalprocessesinwhicheachstepfollowsfromthelastaccordingtoa simplesetofrules. Inmyopinion,itisembarrassingthathumansspendsomuchtimeinschoollearningtoexecutealgorithmsthat,quiteliterally,requirenointelligence. Ontheotherhand,theprocessofdesigningalgorithmsisinteresting,intellectuallychallenging,andacentralpartofwhatwecallprogramming. Someofthethingsthatpeopledonaturally,withoutdifficultyorconsciousthought,arethehardesttoexpressalgorithmically.Understandingnatural languageisagoodexample.Wealldoit,butsofarnoonehasbeenabletoexplain howwedoit,atleastnotintheformofanalgorithm.
Debugging
Asyoustartwritingbiggerprograms,youmightfindyourselfspendingmoretimedebugging.Morecodemeansmorechancestomakeanerrorandmore placeforbugstohide. Onewaytocutyourdebuggingtimeisdebuggingbybisection.Forexample,ifthereare100linesinyourprogramandyoucheckthemoneatatime,it wouldtake100steps. Instead,trytobreaktheprobleminhalf.Lookatthemiddleoftheprogram,ornearit,foranintermediatevalueyoucancheck.Adda p r i n t statement(or somethingelsethathasaverifiableeffect)andruntheprogram. Ifthemidpointcheckisincorrect,theproblemmustbeinthefirsthalfoftheprogram.Ifitiscorrect,theproblemisinthesecondhalf. Everytimeyouperformachecklikethis,youhalvethenumberoflinesyouhavetosearch.Aftersixsteps(whichismuchlessthan100),youwouldbedown tooneortwolinesofcode,atleastintheory. Inpracticeitisnotalwaysclearwhatthemiddleoftheprogramisandnotalwayspossibletocheckit.Itdoesntmakesensetocountlinesandfindthe exactmidpoint.Instead,thinkaboutplacesintheprogramwheretheremightbeerrorsandplaceswhereitiseasytoputacheck.Thenchooseaspotwhere youthinkthechancesareaboutthesamethatthebugisbeforeorafterthecheck.
Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 146/282
10/24/13
multipleassignment: Makingmorethanoneassignmenttothesamevariableduringtheexecutionofaprogram. update: Anassignmentwherethenewvalueofthevariabledependsontheold. initialize: Anassignmentthatgivesaninitialvaluetoavariablethatwillbeupdated. increment: Anupdatethatincreasesthevalueofavariable(oftenbyone). decrement: Anupdatethatdecreasesthevalueofavariable. iteration: Repeatedexecutionofasetofstatementsusingeitherarecursivefunctioncalloraloop. infiniteloop: Aloopinwhichtheterminatingconditionisneversatisfied.
Exercises
Exercise3
Totestthesquarerootalgorithminthischapter,youcouldcompareitwith'm a t h . s q r t '.Writeafunctionnamed t e s t _ s q u a r e _ r o o t thatprintsatablelikethis:
' ' 1 . 01 . 0 1 . 0 0 . 0 2 . 01 . 4 1 4 2 1 3 5 6 2 3 71 . 4 1 4 2 1 3 5 6 2 3 72 . 2 2 0 4 4 6 0 4 9 2 5 e 1 6 3 . 01 . 7 3 2 0 5 0 8 0 7 5 71 . 7 3 2 0 5 0 8 0 7 5 70 . 0 4 . 02 . 0 2 . 0 0 . 0 5 . 02 . 2 3 6 0 6 7 9 7 7 5 2 . 2 3 6 0 6 7 9 7 7 5 0 . 0 6 . 02 . 4 4 9 4 8 9 7 4 2 7 82 . 4 4 9 4 8 9 7 4 2 7 80 . 0 7 . 02 . 6 4 5 7 5 1 3 1 1 0 62 . 6 4 5 7 5 1 3 1 1 0 60 . 0 8 . 02 . 8 2 8 4 2 7 1 2 4 7 52 . 8 2 8 4 2 7 1 2 4 7 54 . 4 4 0 8 9 2 0 9 8 5 e 1 6 9 . 03 . 0 3 . 0 0 . 0 ' '
Exercise4
Thebuiltinfunction'e v a l 'takesastringandevaluatesitusingthePythoninterpreter.Forexample:
en.wikibooks.org/wiki/Think_Python/Print_version
147/282
10/24/13
' ' > > >e v a l ( ' 1+2*3 ' ) 7 > > >i m p o r tm a t h > > >e v a l ( ' m a t h . s q r t ( 5 ) ' ) 2 . 2 3 6 0 6 7 9 7 7 4 9 9 7 8 9 8 > > >e v a l ( ' t y p e ( m a t h . p i ) ' ) < t y p e' f l o a t ' > ' '
Exercise5
ThebrilliantmathematicianSrinivasaRamanujanfoundaninfiniteseries2thatcanbeusedtogenerateanumericalapproximationof :
Writeafunctioncalled e s t i m a t e _ p i thatusesthisformulatocomputeandreturnanestimateof''.Itshouldusea'w h i l e 'looptocomputetermsofthe summationuntilthelasttermissmallerthan'1 e 1 5 '(whichisPythonnotationfor'1015). Youcanchecktheresultbycomparingitto'm a t h . p i '. Youcanseemysolutionat't h i n k p y t h o n . c o m / c o d e / p i . p y '. f=crs where's'and'c'areparametersthatdependonthelanguageandthetext.Ifyoutakethelogarithmofbothsidesofthisequation,youget: log'f='log'cs'log'r Soifyouplot'log'f ' versus'log'r',youshouldgetastraightlinewithslope''s' andintercept'log'c'. Writeaprogramthatreadsatextfromafile,countswordfrequencies,andprintsonelineforeachword,indescendingorderoffrequency,with'log'f ' and 'log'r'.Usethegraphingprogramofyourchoicetoplottheresultsandcheckwhethertheyformastraightline.Canyouestimatethevalueof's'?
Notes
1 See w i k i p e d i a . o r g / w i k i / Z i p f ' s _ l a w
en.wikibooks.org/wiki/Think_Python/Print_version 148/282
10/24/13
Files
Persistence
Mostoftheprogramswehaveseensofararetransientinthesensethattheyrunforashorttimeandproducesomeoutput,butwhentheyend,theirdata disappears.Ifyouruntheprogramagain,itstartswithacleanslate. Otherprogramsare persistent:theyrunforalongtime(orallthetime)theykeepatleastsomeoftheirdatainpermanentstorage(aharddrive,for example)andiftheyshutdownandrestart,theypickupwheretheyleftoff. Examplesofpersistentprogramsareoperatingsystems,whichrunprettymuchwheneveracomputerison,andwebservers,whichrunallthetime,waitingfor requeststocomeinonthenetwork. Oneofthesimplestwaysforprogramstomaintaintheirdataisbyreadingandwritingtextfiles.Wehavealreadyseenprogramsthatreadtextfilesinthis chapterswewillseeprogramsthatwritethem. Analternativeistostorethestateoftheprograminadatabase.InthischapterIwillpresentasimpledatabaseandamodule, p i c k l e ,thatmakesiteasyto storeprogramdata.
Readingandwriting
Atextfileisasequenceofcharactersstoredonapermanentmediumlikeaharddrive,flashmemory,orCDROM.Wesawhowtoopenandreadafilein Section9.1. Towriteafile,youhavetoopenitwithmode ' w ' asasecondparameter:
> > >f o u t=o p e n ( ' o u t p u t . t x t ' ,' w ' ) > > >p r i n tf o u t < o p e nf i l e' o u t p u t . t x t ' ,m o d e' w 'a t0 x b 7 e b 2 4 1 0 >
Again,thefileobjectkeepstrackofwhereitis,soifyoucall w r i t e again,itaddsthenewdatatotheend.
> > >l i n e 2=" t h ee m b l e mo fo u rl a n d . \ n " > > >f o u t . w r i t e ( l i n e 2 )
en.wikibooks.org/wiki/Think_Python/Print_version 149/282
10/24/13
Whenyouaredonewriting,youhavetoclosethefile.
> > >f o u t . c l o s e ( )
Formatoperator
Theargumentof w r i t e hastobeastring,soifwewanttoputothervaluesinafile,wehavetoconvertthemtostrings.Theeasiestwaytodothatiswith s t r :
> > >x=5 2 > > >f . w r i t e ( s t r ( x ) )
Analternativeistousethe formatoperator, % .Whenappliedtointegers, % isthemodulusoperator.Butwhenthefirstoperandisastring, % istheformat operator. Thefirstoperandisthe formatstring,andthesecondoperandisatupleofexpressions.Theresultisastringthatcontainsthevaluesoftheexpressions, formattedaccordingtotheformatstring. Asanexample,the formatsequence ' % d ' meansthatthefirstexpressioninthetupleshouldbeformattedasaninteger(d standsfordecimal):
> > >c a m e l s=4 2 > > >' % d '%c a m e l s ' 4 2 '
Thenumberofelementsinthetuplehastomatchthenumberofformatsequencesinthestring.Also,thetypesoftheelementshavetomatchtheformat sequences:
en.wikibooks.org/wiki/Think_Python/Print_version
150/282
10/24/13
Inthefirstexample,therearentenoughelementsinthesecond,theelementisthewrongtype. Theformatoperatorispowerfulbutdifficulttouse.Youcanreadmoreaboutitat d o c s . p y t h o n . o r g / l i b / t y p e s s e q s t r i n g s . h t m l .
Filenamesandpaths
Filesareorganizedinto directories(alsocalledfolders).Everyrunningprogramhasacurrentdirectory,whichisthedefaultdirectoryformostoperations. Forexample,whenyouopenafileforreading,Pythonlooksforitinthecurrentdirectory. The o s moduleprovidesfunctionsforworkingwithfilesanddirectories(osstandsforoperatingsystem). o s . g e t c w d returnsthenameofthecurrentdirectory:
> > >i m p o r to s > > >c w d=o s . g e t c w d ( ) > > >p r i n tc w d / h o m e / d i n s d a l e
c w d standsforcurrentworkingdirectory.Theresultinthisexampleis / h o m e / d i n s d a l e ,whichisthehomedirectoryofausernamed d i n s d a l e .
Ifitexists, o s . p a t h . i s d i r checkswhetheritsadirectory:
> > >o s . p a t h . i s d i r ( ' m e m o . t x t ' ) F a l s e > > >o s . p a t h . i s d i r ( ' m u s i c ' )
en.wikibooks.org/wiki/Think_Python/Print_version 151/282
10/24/13
T r u e
Similarly, o s . p a t h . i s f i l e checkswhetheritsafile.
o s . l i s t d i r returnsalistofthefiles(andotherdirectories)inthegivendirectory:
Todemonstratethesefunctions,thefollowingexamplewalksthroughadirectory,printsthenamesofallthefiles,andcallsitselfrecursivelyonallthe directories.
d e fw a l k ( d i r ) : f o rn a m ei no s . l i s t d i r ( d i r ) : p a t h=o s . p a t h . j o i n ( d i r ,n a m e ) i fo s . p a t h . i s f i l e ( p a t h ) : p r i n tp a t h e l s e : w a l k ( p a t h )
o s . p a t h . j o i n takesadirectoryandafilenameandjoinsthemintoacompletepath.
Exercise1
Modify'w a l k 'sothatinsteadofprintingthenamesofthefiles,itreturnsalistofnames. Exercise2 The'o s 'moduleprovidesafunctioncalled'w a l k 'thatissimilartothisonebutmoreversatile.Readthedocumentationanduseittoprintthenamesofthefiles inagivendirectoryanditssubdirectories.
Catchingexceptions
Alotofthingscangowrongwhenyoutrytoreadandwritefiles.Ifyoutrytoopenafilethatdoesntexist,yougetan I O E r r o r :
> > >f i n=o p e n ( ' b a d _ f i l e ' ) I O E r r o r :[ E r r n o2 ]N os u c hf i l eo rd i r e c t o r y :' b a d _ f i l e '
Ifyoudonthavepermissiontoaccessafile:
en.wikibooks.org/wiki/Think_Python/Print_version
152/282
10/24/13
> > >f o u t=o p e n ( ' / e t c / p a s s w d ' ,' w ' ) I O E r r o r :[ E r r n o1 3 ]P e r m i s s i o nd e n i e d :' / e t c / p a s s w d '
Andifyoutrytoopenadirectoryforreading,youget
> > >f i n=o p e n ( ' / h o m e ' ) I O E r r o r :[ E r r n o2 1 ]I sad i r e c t o r y
Pythonstartsbyexecutingthe t r y clause.Ifallgoeswell,itskipsthe e x c e p t clauseandproceeds.Ifanexceptionoccurs,itjumpsoutofthe t r y clauseand executesthe e x c e p t clause. Handlinganexceptionwitha t r y statementiscalled catchinganexception.Inthisexample,the e x c e p t clauseprintsanerrormessagethatisnotveryhelpful. Ingeneral,catchinganexceptiongivesyouachancetofixtheproblem,ortryagain,oratleastendtheprogramgracefully.
Databases
A databaseisafilethatisorganizedforstoringdata.Mostdatabasesareorganizedlikeadictionaryinthesensethattheymapfromkeystovalues.The biggestdifferenceisthatthedatabaseisondisk(orotherpermanentstorage),soitpersistsaftertheprogramends. Themodule a n y d b m providesaninterfaceforcreatingandupdatingdatabasefiles.Asanexample,Illcreateadatabasethatcontainscaptionsforimagefiles. Openingadatabaseissimilartoopeningotherfiles:
> > >i m p o r ta n y d b m > > >d b=a n y d b m . o p e n ( ' c a p t i o n s . d b ' ,' c ' )
10/24/13
Whenyouaccessoneoftheitems, a n y d b m readsthefile:
> > >p r i n td b [ ' c l e e s e . p n g ' ] P h o t oo fJ o h nC l e e s e .
Ifyoumakeanotherassignmenttoanexistingkey, a n y d b m replacestheoldvalue:
> > >d b [ ' c l e e s e . p n g ' ]=' P h o t oo fJ o h nC l e e s ed o i n gas i l l yw a l k . ' > > >p r i n td b [ ' c l e e s e . p n g ' ] P h o t oo fJ o h nC l e e s ed o i n gas i l l yw a l k .
Aswithotherfiles,youshouldclosethedatabasewhenyouaredone:
> > >d b . c l o s e ( )
Pickling
Alimitationof a n y d b m isthatthekeysandvalueshavetobestrings.Ifyoutrytouseanyothertype,yougetanerror. The p i c k l e modulecanhelp.Ittranslatesalmostanytypeofobjectintoastringsuitableforstorageinadatabase,andthentranslatesstringsbackintoobjects.
p i c k l e . d u m p s takesanobjectasaparameterandreturnsastringrepresentation(d u m p s isshortfordumpstring):
> > >i m p o r tp i c k l e > > >t=[ 1 ,2 ,3 ] > > >p i c k l e . d u m p s ( t ) ' ( l p 0 \ n I 1 \ n a I 2 \ n a I 3 \ n a . '
10/24/13
> > >s=p i c k l e . d u m p s ( t 1 ) > > >t 2=p i c k l e . l o a d s ( s ) > > >p r i n tt 2 [ 1 ,2 ,3 ]
Althoughthenewobjecthasthesamevalueastheold,itisnot(ingeneral)thesameobject:
> > >t= =t 2 T r u e > > >ti st 2 F a l s e
Pipes
Mostoperatingsystemsprovideacommandlineinterface,alsoknownasa shell .Shellsusuallyprovidecommandstonavigatethefilesystemandlaunch applications.Forexample,inUnix,youcanchangedirectorieswith c d ,displaythecontentsofadirectorywith l s ,andlaunchawebbrowserbytyping(for example) f i r e f o x . AnyprogramthatyoucanlaunchfromtheshellcanalsobelaunchedfromPythonusinga pipe.Apipeisanobjectthatrepresentsarunningprocess. Forexample,theUnixcommand l sl normallydisplaysthecontentsofthecurrentdirectory(inlongformat).Youcanlaunch l s with o s . p o p e n :
> > >c m d=' l sl ' > > >f p=o s . p o p e n ( c m d )
Whenyouaredone,youclosethepipelikeafile:
en.wikibooks.org/wiki/Think_Python/Print_version 155/282
10/24/13
Ifyoureadlinesfrom f p oneatatime,youneverhavetostoretheuncompressedfileinmemoryorondisk.
Writingmodules
AnyfilethatcontainsPythoncodecanbeimportedasamodule.Forexample,supposeyouhaveafilenamed w c . p y withthefollowingcode:
d e fl i n e c o u n t ( f i l e n a m e ) : c o u n t=0 f o rl i n ei no p e n ( f i l e n a m e ) : c o u n t+ =1 r e t u r nc o u n t p r i n tl i n e c o u n t ( ' w c . p y ' )
Ifyourunthisprogram,itreadsitselfandprintsthenumberoflinesinthefile,whichis7.Youcanalsoimportitlikethis:
> > >i m p o r tw c 7
Nowyouhaveamoduleobject w c :
> > >p r i n tw c < m o d u l e' w c 'f r o m' w c . p y ' >
Thatprovidesafunctioncalled l i n e c o u n t :
en.wikibooks.org/wiki/Think_Python/Print_version
156/282
10/24/13
isexecuted.Otherwise,ifthemoduleisbeingimported,thetestcodeisskipped. Exercise4 Typethisexampleintoafilenamed'w c . p y 'andrunitasascript.ThenrunthePythoninterpreterand'i m p o r tw c '.Whatisthevalueof _ _ n a m e _ _ whenthemodule isbeingimported? Warning:Ifyouimportamodulethathasalreadybeenimported, Pythondoesnothing.Itdoesnotrereadthefile,evenifithaschanged. Ifyouwanttoreloadamodule,youcanusethebuiltinfunction'r e l o a d ',butitcanbetricky,sothesafestthingtodoisrestarttheinterpreterandthenimport themoduleagain.
Debugging
Whenyouarereadingandwritingfiles,youmightrunintoproblemswithwhitespace.Theseerrorscanbehardtodebugbecausespaces,tabsandnewlines arenormallyinvisible:
> > >s=' 12 \ t3 \ n4 ' > > >p r i n ts 12 3 4
Thiscanbehelpfulfordebugging.
en.wikibooks.org/wiki/Think_Python/Print_version 157/282
10/24/13
Glossary
persistent: Pertainingtoaprogramthatrunsindefinitelyandkeepsatleastsomeofitsdatainpermanentstorage. formatoperator: Anoperator, % ,thattakesaformatstringandatupleandgeneratesastringthatincludestheelementsofthetupleformattedasspecifiedbytheformat string. formatstring: Astring,usedwiththeformatoperator,thatcontainsformatsequences. formatsequence: Asequenceofcharactersinaformatstring,like % d ,thatspecifieshowavalueshouldbeformatted. textfile: Asequenceofcharactersstoredinpermanentstoragelikeaharddrive. directory: Anamedcollectionoffiles,alsocalledafolder. path: Astringthatidentifiesafile. relativepath: Apaththatstartsfromthecurrentdirectory. absolutepath: Apaththatstartsfromthetopmostdirectoryinthefilesystem. catch: Topreventanexceptionfromterminatingaprogramusingthe t r y and e x c e p t statements. database: Afilewhosecontentsareorganizedlikeadictionarywithkeysthatcorrespondtovalues.
Exercises
Exercise5 The'u r l l i b 'moduleprovidesmethodsformanipulatingURLsanddownloadinginformationfromtheweb.Thefollowingexampledownloadsandprintsasecret messagefrom't h i n k p y t h o n . c o m ':
en.wikibooks.org/wiki/Think_Python/Print_version 158/282
10/24/13
Runthiscodeandfollowtheinstructionsyouseethere. Exercise6 InalargecollectionofMP3files,theremaybemorethanonecopyofthesamesong,storedindifferentdirectoriesorwithdifferentfilenames.Thegoalof thisexerciseistosearchfortheseduplicates. Writeaprogramthatsearchesadirectoryandallofits subdirectories,recursively,andreturnsalistofcompletepathsforallfileswithagivensuffix(like'. m p 3 ').Hint:'o s . p a t h 'providesseveralusefulfunctionsfor manipulatingfileandpathnames. Torecognizeduplicates,youcanuseahashfunctionthat readsthefileandgeneratesashortsummaryofthecontents.Forexample,MD5(MessageDigestalgorithm5)takesanarbitrarilylongmessageandreturns a128bitchecksum.Theprobabilityisverysmallthattwofileswithdifferentcontentswillreturnthesamechecksum. YoucanreadaboutMD5at 'w i k i p e d i a . o r g / w i k i / M d 5 '.OnaUnixsystemyoucanusetheprogram'm d 5 s u m 'andapipetocomputechecksumsfromPython. Exercise7 ' TheInternetMovieDatabase(IMDb)isanonlinecollectionof informationaboutmovies.Theirdatabaseisavailableinplaintextformat,soitisreasonably easytoreadfromPython.Forthisexercise,thefilesyouneedare'a c t o r s . l i s t . g z 'and'a c t r e s s e s . l i s t . g z 'youcandownloadthemfrom 'w w w . i m d b . c o m / i n t e r f a c e s # p l a i n '. ' Ihavewrittenaprogramthatparsesthesefilesandsplitsthemintoactornames,movietitles,etc.Youcandownloaditfrom't h i n k p y t h o n . c o m / c o d e / i m d b . p y '. Ifyourun'i m d b . p y 'asascript,itreads'a c t o r s . l i s t . g z 'andprintsoneactormoviepairperline.Or,ifyou'i m p o r t i m d b ' youcanusethefunction p r o c e s s _ f i l e to, well, processthefile.Theargumentsareafilename,afunctionobjectandanoptionalnumberoflinestoprocess.Hereisanexample:
' ' i m p o r ti m d b d e fp r i n t _ i n f o ( a c t o r ,d a t e ,t i t l e ,r o l e ) : p r i n ta c t o r ,d a t e ,t i t l e ,r o l e i m d b . p r o c e s s _ f i l e ( ' a c t o r s . l i s t . g z ' ,p r i n t _ i n f o )
en.wikibooks.org/wiki/Think_Python/Print_version 159/282
10/24/13
' '
Whenyoucall p r o c e s s _ f i l e ,itopens'f i l e n a m e ',readsthecontents,andcalls p r i n t _ i n f o onceforeachlineinthefile. p r i n t _ i n f o takesanactor,date,movietitleand roleasargumentsandprintsthem. Writeaprogramthatreads'a c t o r s . l i s t . g z 'and'a c t r e s s e s . l i s t . g z 'anduses's h e l v e 'tobuildadatabase thatmapsfromeachactortoalistofhisorherfilms. Twoactorsarecostarsiftheyhavebeeninatleastone movietogether.Processthedatabaseyoubuiltinthepreviousstepandbuildaseconddatabasethatmapsfromeachactortoalistofhisorhercostars. WriteaprogramthatcanplaytheSixDegreesofKevin Bacon,whichyoucanreadaboutat'w i k i p e d i a . o r g / w i k i / S i x _ D e g r e e s _ o f _ K e v i n _ B a c o n '.Thisproblemischallengingbecauseitrequiresyoutofindtheshortestpathin agraph.Youcanreadaboutshortestpathalgorithmsat'w i k i p e d i a . o r g / w i k i / S h o r t e s t _ p a t h _ p r o b l e m '.
Classesandobjects
Userdefinedtypes
WehaveusedmanyofPythonsbuiltintypesnowwearegoingtodefineanewtype.Asanexample,wewillcreateatypecalled P o i n t thatrepresentsapoint intwodimensionalspace. Inmathematicalnotation,pointsareoftenwritteninparentheseswithacommaseparatingthecoordinates.Forexample,(0,0)representstheorigin,and(x, y)representsthepoint xunitstotherightand yunitsupfromtheorigin. ThereareseveralwayswemightrepresentpointsinPython: Wecouldstorethecoordinatesseparatelyintwovariables, x and y . Wecouldstorethecoordinatesaselementsinalistortuple. Wecouldcreateanewtypetorepresentpointsasobjects. Creatinganewtypeis(alittle)morecomplicatedthantheotheroptions,butithasadvantagesthatwillbeapparentsoon. Auserdefinedtypeisalsocalleda class.Aclassdefinitionlookslikethis:
c l a s sP o i n t ( o b j e c t ) : " " " r e p r e s e n t sap o i n ti n2 Ds p a c e " " "
10/24/13
Attributes
Youcanassignvaluestoaninstanceusingdotnotation:
> > >b l a n k . x=3 . 0 > > >b l a n k . y=4 . 0
Thissyntaxissimilartothesyntaxforselectingavariablefromamodule,suchas m a t h . p i or s t r i n g . w h i t e s p a c e .Inthiscase,though,weareassigningvaluesto namedelementsofanobject.Theseelementsarecalled attributes. Asanoun,ATtributeispronouncedwithemphasisonthefirstsyllable,asopposedtoaTRIBute,whichisaverb. Thefollowingdiagramshowstheresultoftheseassignments.Astatediagramthatshowsanobjectanditsattributesiscalledan objectdiagram: <IMGSRC="book022.png"> Thevariable b l a n k referstoaPointobject,whichcontainstwoattributes.Eachattributereferstoafloatingpointnumber. Youcanreadthevalueofanattributeusingthesamesyntax:
> > >p r i n tb l a n k . y
en.wikibooks.org/wiki/Think_Python/Print_version 161/282
10/24/13
Youcanpassaninstanceasanargumentintheusualway.Forexample:
d e fp r i n t _ p o i n t ( p ) : p r i n t' ( % g ,% g ) '%( p . x ,p . y )
p r i n t _ p o i n t takesapointasanargumentanddisplaysitinmathematicalnotation.Toinvokeit,youcanpass b l a n k asanargument:
Exercise1
Writeafunctioncalled'd i s t a n c e 'thatittakestwoPointsasargumentsandreturnsthedistancebetweenthem.
Rectangles
Sometimesitisobviouswhattheattributesofanobjectshouldbe,butothertimesyouhavetomakedecisions.Forexample,imagineyouaredesigninga classtorepresentrectangles.Whatattributeswouldyouusetospecifythelocationandsizeofarectangle?Youcanignoreangletokeepthingssimple, assumethattherectangleiseitherverticalorhorizontal. Thereareatleasttwopossibilities: Youcouldspecifyonecorneroftherectangle(orthecenter),thewidth,andtheheight.
en.wikibooks.org/wiki/Think_Python/Print_version 162/282
10/24/13
Instancesasreturnvalues
Functionscanreturninstances.Forexample, f i n d _ c e n t e r takesa R e c t a n g l e asanargumentandreturnsa P o i n t thatcontainsthecoordinatesofthecenterofthe R e c t a n g l e :
d e ff i n d _ c e n t e r ( b o x ) : p=P o i n t ( ) p . x=b o x . c o r n e r . x+b o x . w i d t h / 2 . 0 p . y=b o x . c o r n e r . y+b o x . h e i g h t / 2 . 0 r e t u r np
Hereisanexamplethatpasses b o x asanargumentandassignstheresultingPointto c e n t e r :
en.wikibooks.org/wiki/Think_Python/Print_version 163/282
10/24/13
Objectsaremutable
Youcanchangethestateofanobjectbymakinganassignmenttooneofitsattributes.Forexample,tochangethesizeofarectanglewithoutchangingits position,youcanmodifythevaluesof w i d t h and h e i g h t :
b o x . w i d t h=b o x . w i d t h+5 0 b o x . h e i g h t=b o x . h e i g h t+1 0 0
Hereisanexamplethatdemonstratestheeffect:
> > >p r i n tb o x . w i d t h 1 0 0 . 0 > > >p r i n tb o x . h e i g h t 2 0 0 . 0 > > >g r o w _ r e c t a n g l e ( b o x ,5 0 ,1 0 0 ) > > >p r i n tb o x . w i d t h 1 5 0 . 0 > > >p r i n tb o x . h e i g h t 3 0 0 . 0
Exercise2
Writeafunctionnamed m o v e _ r e c t a n g l e thattakesaRectangleandtwonumbersnamed'd x 'and'd y '.Itshouldchangethelocationoftherectanglebyadding'd x ' tothe'x 'coordinateof'c o r n e r 'andadding'd y 'tothe'y 'coordinateof'c o r n e r '.
Copying
Aliasingcanmakeaprogramdifficulttoreadbecausechangesinoneplacemighthaveunexpectedeffectsinanotherplace.Itishardtokeeptrackofallthe en.wikibooks.org/wiki/Think_Python/Print_version 164/282
10/24/13
> > >p r i n t _ p o i n t ( p 1 ) ( 3 . 0 ,4 . 0 ) > > >p r i n t _ p o i n t ( p 2 ) ( 3 . 0 ,4 . 0 ) > > >p 1i sp 2 F a l s e > > >p 1= =p 2 F a l s e
The i s operatorindicatesthat p 1 and p 2 arenotthesameobject,whichiswhatweexpected.Butyoumighthaveexpected = = toyield T r u e becausethesepoints containthesamedata.Inthatcase,youwillbedisappointedtolearnthatforinstances,thedefaultbehaviorofthe = = operatoristhesameasthe i s operator itchecksobjectidentity,notobjectequivalence.Thisbehaviorcanbechangedwellseehowlater. Ifyouuse c o p y . c o p y toduplicateaRectangle,youwillfindthatitcopiestheRectangleobjectbutnottheembeddedPoint.
> > >b o x 2=c o p y . c o p y ( b o x ) > > >b o x 2i sb o x F a l s e > > >b o x 2 . c o r n e ri sb o x . c o r n e r T r u e
10/24/13
Exercise3
Writeaversionof m o v e _ r e c t a n g l e thatcreatesandreturnsanewRectangleinsteadofmodifyingtheoldone.
Debugging
Whenyoustartworkingwithobjects,youarelikelytoencountersomenewexceptions.Ifyoutrytoaccessanattributethatdoesntexist,yougetan A t t r i b u t e E r r o r :
> > >p=P o i n t ( ) > > >p r i n tp . z A t t r i b u t e E r r o r :P o i n ti n s t a n c eh a sn oa t t r i b u t e' z '
Ifyouarenotsurewhattypeanobjectis,youcanask:
> > >t y p e ( p ) < t y p e' _ _ m a i n _ _ . P o i n t ' >
Ifyouarenotsurewhetheranobjecthasaparticularattribute,youcanusethebuiltinfunction h a s a t t r :
> > >h a s a t t r ( p ,' x ' ) T r u e > > >h a s a t t r ( p ,' z ' ) F a l s e
Thefirstargumentcanbeanyobjectthesecondargumentisa stringthatcontainsthenameoftheattribute.
Glossary
en.wikibooks.org/wiki/Think_Python/Print_version 166/282
10/24/13
class: Auserdefinedtype.Aclassdefinitioncreatesanewclassobject. classobject: Anobjectthatcontainsinformationaboutauserdefinedtype.Theclassobjectcanbeusedtocreateinstancesofthetype. instance: Anobjectthatbelongstoaclass. attribute: Oneofthenamedvaluesassociatedwithanobject. embedded(object): Anobjectthatisstoredasanattributeofanotherobject. shallowcopy: Tocopythecontentsofanobject,includinganyreferencestoembeddedobjectsimplementedbythe c o p y functioninthe c o p y module. deepcopy: Tocopythecontentsofanobjectaswellasanyembeddedobjects,andanyobjectsembeddedinthem,andsoonimplementedbythe d e e p c o p y functioninthe c o p y module. objectdiagram: Adiagramthatshowsobjects,theirattributes,andthevaluesoftheattributes.
Exercises
Exercise4
W o r l d . p y '',whichispartofSwampy(seeChapter'4'),containsaclassdefinitionforauserdefinedtypecalled'W o r l d '.Ifyourunthiscode:
10/24/13
theupperrightcorner. Youcandrawacirclelikethis:
' ' c a n v a s . c i r c l e ( [ 2 5 , 0 ] ,7 0 ,o u t l i n e = N o n e ,f i l l = ' r e d ' ) ' '
Thefirstparameteristhecoordinatepairforthecenterofthecirclethesecondparameteristheradius. Ifyouaddthislinetotheprogram, theresultshouldresemblethenationalflagofBangladesh(see'w i k i p e d i a . o r g / w i k i / G a l l e r y _ o f _ s o v e r e i g n s t a t e _ f l a g s '). Writeafunctioncalled d r a w _ r e c t a n g l e thattakesa CanvasandaRectangleasargumentsanddrawsarepresentationoftheRectangleontheCanvas. Addanattributenamed'c o l o r 'toyourRectangleobjectsand modify d r a w _ r e c t a n g l e sothatitusesthecolorattributeasthefillcolor. Writeafunctioncalled d r a w _ p o i n t thattakesa CanvasandaPointasargumentsanddrawsarepresentationofthePointontheCanvas. DefineanewclasscalledCirclewithappropriateattributesand instantiateafewCircleobjects.Writeafunctioncalled d r a w _ c i r c l e thatdrawscirclesonthecanvas. WriteaprogramthatdrawsthenationalflagofoftheCzechRepublic(http://en.wikipedia.org/wiki/File:Flag_of_the_Czech_Republic.svg). Hint:youcandrawapolygonlikethis:
' ' p o i n t s=[ [ 1 5 0 , 1 0 0 ] ,[ 1 5 0 ,1 0 0 ] ,[ 1 5 0 ,1 0 0 ] ] c a n v a s . p o l y g o n ( p o i n t s ,f i l l = ' b l u e ' ) ' '
Classesandfunctions
en.wikibooks.org/wiki/Think_Python/Print_version 168/282
10/24/13
Time
Asanotherexampleofauserdefinedtype,we'lldefineaclasscalled T i m e thatrecordsthetimeofday.Theclassdefinitionlookslikethis:
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " "
Wecancreateanew T i m e objectandassignattributesforhours,minutes,andseconds:
t i m e=T i m e ( ) t i m e . h o u r=1 1 t i m e . m i n u t e=5 9 t i m e . s e c o n d=3 0
Thestatediagramforthe T i m e objectlookslikethis:
<IMGSRC="book025.png">
Exercise1
Writeafunctioncalled p r i n t _ t i m e thattakesaTimeobjectandprintsitintheform h o u r : m i n u t e : s e c o n d . Hint:theformatsequence % . 2 d printsanintegerusingatleasttwodigits,includingaleadingzeroifnecessary.
Exercise2
Writeabooleanfunctioncalled i s _ a f t e r thattakestwoTimeobjects, t 1 and t 2 ,andreturns T r u e if t 1 follows t 2 chronologicallyand F a l s e otherwise. Challenge:don'tusean i f statement.
Purefunctions
Inthenextfewsections,wellwritetwofunctionsthataddtimevalues.Theydemonstratetwokindsoffunctions:purefunctionsandmodifiers.Theyalso demonstrateadevelopmentplanIllcall prototypeandpatch,whichisawayoftacklingacomplexproblembystartingwithasimpleprototypeand incrementallydealingwiththecomplications. Hereisasimpleprototypeof a d d _ t i m e :
d e fa d d _ t i m e ( t 1 ,t 2 ) :
en.wikibooks.org/wiki/Think_Python/Print_version 169/282
10/24/13
Thefunctioncreatesanew T i m e object,initializesitsattributes,andreturnsareferencetothenewobject.Thisiscalleda purefunctionbecauseitdoesnot modifyanyoftheobjectspassedtoitasargumentsandithasnoeffect,likedisplayingavalueorgettinguserinput,otherthanreturningavalue. Totestthisfunction,IllcreatetwoTimeobjects: s t a r t containsthestarttimeofamovie,like MontyPythonandtheHolyGrail,and d u r a t i o n containstherun timeofthemovie, whichisonehour35minutes.
a d d _ t i m e figuresoutwhenthemoviewillbedone.
> > >s t a r t=T i m e ( ) > > >s t a r t . h o u r=9 > > >s t a r t . m i n u t e=4 5 > > >s t a r t . s e c o n d= 0 > > >d u r a t i o n=T i m e ( ) > > >d u r a t i o n . h o u r=1 > > >d u r a t i o n . m i n u t e=3 5 > > >d u r a t i o n . s e c o n d=0 > > >d o n e=a d d _ t i m e ( s t a r t ,d u r a t i o n ) > > >p r i n t _ t i m e ( d o n e ) 1 0 : 8 0 : 0 0
10/24/13
r e t u r ns u m
Althoughthisfunctioniscorrect,itisstartingtogetbig.Wewillseeashorteralternativelater.
Modifiers
Sometimesitisusefulforafunctiontomodifytheobjectsitgetsasparameters.Inthatcase,thechangesarevisibletothecaller.Functionsthatworkthis wayarecalled modifiers.
i n c r e m e n t ,whichaddsagivennumberofsecondstoa T i m e object,canbewrittennaturallyasamodifier.Hereisaroughdraft:
Thefirstlineperformsthebasicoperationtheremainderdealswiththespecialcaseswesawbefore. Isthisfunctioncorrect?Whathappensiftheparameter s e c o n d s ismuchgreaterthansixty? Inthatcase,itisnotenoughtocarryoncewehavetokeepdoingituntil t i m e . s e c o n d islessthansixty.Onesolutionistoreplacethe i f statementswith w h i l e statements.Thatwouldmakethefunctioncorrect,butnotveryefficient. Exercise3 Writeacorrectversionof'i n c r e m e n t 'thatdoesntcontainanyloops. Anythingthatcanbedonewithmodifierscanalsobedonewithpurefunctions.Infact,someprogramminglanguagesonlyallowpurefunctions.Thereissome evidencethatprogramsthatusepurefunctionsarefastertodevelopandlesserrorpronethanprogramsthatusemodifiers.Butmodifiersareconvenientat times,andfunctionalprogramstendtobelessefficient. Ingeneral,Irecommendthatyouwritepurefunctionswheneveritisreasonableandresorttomodifiersonlyifthereisacompellingadvantage.Thisapproach mightbecalleda functional programmingstyle. Exercise4 Writeapureversionof'i n c r e m e n t 'thatcreatesandreturnsanewTimeobjectratherthanmodifyingtheparameter.
en.wikibooks.org/wiki/Think_Python/Print_version
171/282
10/24/13
Prototypingversusplanning
ThedevelopmentplanIamdemonstratingiscalledprototypeandpatch.Foreachfunction,Iwroteaprototypethatperformedthebasiccalculationandthen testedit,patchingerrorsalongtheway. Thisapproachcanbeeffective,especiallyifyoudontyethaveadeepunderstandingoftheproblem.Butincrementalcorrectionscangeneratecodethatis unnecessarilycomplicatedsinceitdealswithmanyspecialcasesandunreliablesinceitishardtoknowifyouhavefoundalltheerrors. Analternativeis planneddevelopment,inwhichhighlevelinsightintotheproblemcanmaketheprogrammingmucheasier.Inthiscase,theinsightisthata Timeobjectisreallyathreedigitnumberinbase60(see w i k i p e d i a . o r g / w i k i / S e x a g e s i m a l )!The s e c o n d attributeistheonescolumn,the m i n u t e attributeisthe sixtiescolumn,andthe h o u r attributeisthethirtysixhundredscolumn. Whenwewrote a d d _ t i m e and i n c r e m e n t ,wewereeffectivelydoingadditioninbase60,whichiswhywehadtocarryfromonecolumntothenext. ThisobservationsuggestsanotherapproachtothewholeproblemwecanconvertTimeobjectstointegersandtakeadvantageofthefactthatthecomputer knowshowtodointegerarithmetic. HereisafunctionthatconvertsTimestointegers:
d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e s e c o n d s=m i n u t e s*6 0+t i m e . s e c o n d r e t u r ns e c o n d s
Thisversionisshorterthantheoriginal,andeasiertoverify.
en.wikibooks.org/wiki/Think_Python/Print_version 172/282
10/24/13
Exercise5 Rewrite'i n c r e m e n t 'using t i m e _ t o _ i n t and i n t _ t o _ t i m e . Insomeways,convertingfrombase60tobase10andbackisharderthanjustdealingwithtimes.Baseconversionismoreabstractourintuitionfordealing withtimevaluesisbetter. Butifwehavetheinsighttotreattimesasbase60numbersandmaketheinvestmentofwritingtheconversionfunctions(t i m e _ t o _ i n t and i n t _ t o _ t i m e ),wegeta programthatisshorter,easiertoreadanddebug,andmorereliable. Itisalsoeasiertoaddfeatureslater.Forexample,imaginesubtractingtwoTimestofindthedurationbetweenthem.Thenaveapproachwouldbeto implementsubtractionwithborrowing.Usingtheconversionfunctionswouldbeeasierandmorelikelytobecorrect. Ironically,sometimesmakingaproblemharder(ormoregeneral)makesiteasier(becausetherearefewerspecialcasesandfeweropportunitiesforerror).
Debugging
ATimeobjectiswellformedifthevaluesof m i n u t e s and s e c o n d s arebetween0and60(including0butnot60)andif h o u r s ispositive. h o u r s and m i n u t e s shouldbe integralvalues,butwemightallow s e c o n d s tohaveafractionpart. Thesekindofrequirementsarecalled invariantsbecausetheyshouldalwaysbetrue.Toputitadifferentway,iftheyarenottrue,thensomethinghasgone wrong. Writingcodetocheckyourinvariantscanhelpyoudetecterrorsandfindtheircauses.Forexample,youmighthaveafunctionlike v a l i d _ t i m e thattakesaTime objectandreturns F a l s e ifitviolatesaninvariant:
d e fv a l i d _ t i m e ( t i m e ) : i ft i m e . h o u r s<0o rt i m e . m i n u t e s<0o rt i m e . s e c o n d s<0 : r e t u r nF a l s e i ft i m e . m i n u t e s> =6 0o rt i m e . s e c o n d s> =6 0 : r e t u r nF a l s e r e t u r nT r u e
Thenatthebeginningofeachfunctionyoucouldchecktheargumentstomakesuretheyarevalid:
Oryoucouldusean a s s e r t statement,whichchecksagiveninvariantandraisesanexceptionifitfails:
en.wikibooks.org/wiki/Think_Python/Print_version 173/282
10/24/13
d e fa d d _ t i m e ( t 1 ,t 2 ) : a s s e r tv a l i d _ t i m e ( t 1 )a n dv a l i d _ t i m e ( t 2 ) s e c o n d s=t i m e _ t o _ i n t ( t 1 )+t i m e _ t o _ i n t ( t 2 ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )
a s s e r t statementsareusefulbecausetheydistinguishcodethatdealswithnormalconditionsfromcodethatchecksforerrors.
Glossary
prototypeandpatch: Adevelopmentplanthatinvolveswritingaroughdraftofaprogram,testing,andcorrectingerrorsastheyarefound. planneddevelopment: Adevelopmentplanthatinvolveshighlevelinsightintotheproblemandmoreplanningthanincrementaldevelopmentorprototypedevelopment. purefunction: Afunctionthatdoesnotmodifyanyoftheobjectsitreceivesasarguments.Mostpurefunctionsarefruitful. modifier: Afunctionthatchangesoneormoreoftheobjectsitreceivesasarguments.Mostmodifiersarefruitless. functionalprogrammingstyle: Astyleofprogramdesigninwhichthemajorityoffunctionsarepure. invariant: Aconditionthatshouldalwaysbetrueduringtheexecutionofaprogram.
Exercises
Exercise6
Writeafunctioncalled m u l _ t i m e thattakesaTimeobjectandanumberandreturnsanewTimeobjectthatcontainstheproductoftheoriginalTimeandthe number. Thenuse m u l _ t i m e towriteafunctionthattakesaTimeobjectthatrepresentsthefinishingtimeinarace,andanumberthatrepresentsthedistance, andreturnsaTimeobjectthatrepresentstheaveragepace(timepermile).
Exercise7
WriteaclassdefinitionforaDateobjectthathasattributes'd a y ','m o n t h 'and'y e a r '.Writeafunctioncalled i n c r e m e n t _ d a t e thattakesaDateobject,'d a t e 'andan integer,'n ',andreturnsanewDateobjectthatrepresentstheday'n 'daysafter'd a t e '.Hint:ThirtydayshathSeptember...Challenge:doesyourfunctiondeal withleapyearscorrectly?See''w i k i p e d i a . o r g / w i k i / L e a p _ y e a r
Exercise8
en.wikibooks.org/wiki/Think_Python/Print_version 174/282
10/24/13
Classesandmethods
Objectorientedfeatures
Pythonisan objectorientedprogramminglanguage,whichmeansthatitprovidesfeaturesthatsupportobjectorientedprogramming. Itisnoteasytodefineobjectorientedprogramming,butwehavealreadyseensomeofitscharacteristics: Programsaremadeupofobjectdefinitionsandfunction definitions,andmostofthecomputationisexpressedintermsofoperationsonobjects. Eachobjectdefinitioncorrespondstosomeobjectorconcept intherealworld,andthefunctionsthatoperateonthatobjectcorrespondtothewaysrealworldobjectsinteract. Forexample,the T i m e classdefinedinChapter16correspondstothewaypeoplerecordthetimeofday,andthefunctionswedefinedcorrespondtothekinds ofthingspeopledowithtimes.Similarly,the P o i n t and R e c t a n g l e classescorrespondtothemathematicalconceptsofapointandarectangle. Sofar,wehavenottakenadvantageofthefeaturesPythonprovidestosupportobjectorientedprogramming.Thesefeaturesarenotstrictlynecessarymost ofthemprovidealternativesyntaxforthingswehavealreadydone.Butinmanycases,thealternativeismoreconciseandmoreaccuratelyconveysthe structureoftheprogram. Forexample,inthe T i m e program,thereisnoobviousconnectionbetweentheclassdefinitionandthefunctiondefinitionsthatfollow.Withsomeexamination, itisapparentthateveryfunctiontakesatleastone T i m e objectasanargument. Thisobservationisthemotivationfor methodsamethodisafunctionthatisassociatedwithaparticularclass.Wehaveseenmethodsforstrings,lists, dictionariesandtuples.Inthischapter,wewilldefinemethodsforuserdefinedtypes. Methodsaresemanticallythesameasfunctions,buttherearetwosyntacticdifferences: Methodsaredefinedinsideaclassdefinitioninordertomaketherelationshipbetweentheclassandthemethodexplicit. Thesyntaxforinvokingamethodisdifferentfromthesyntaxforcallingafunction. Inthenextfewsections,wewilltakethefunctionsfromtheprevioustwochaptersandtransformthemintomethods.Thistransformationispurelymechanical youcandoitsimplybyfollowingasequenceofsteps.Ifyouarecomfortableconvertingfromoneformtoanother,youwillbeabletochoosethebestformfor whateveryouaredoing.
en.wikibooks.org/wiki/Think_Python/Print_version 175/282
10/24/13
Printingobjects
InChapter16,wedefinedaclassnamed T i m e andinExercise16.1,youwroteafunctionnamed p r i n t _ t i m e :
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " " d e fp r i n t _ t i m e ( t i m e ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t i m e . h o u r ,t i m e . m i n u t e ,t i m e . s e c o n d )
Tocallthisfunction,youhavetopassa T i m e objectasanargument:
> > >s t a r t=T i m e ( ) > > >s t a r t . h o u r=9 > > >s t a r t . m i n u t e=4 5 > > >s t a r t . s e c o n d=0 0 > > >p r i n t _ t i m e ( s t a r t ) 0 9 : 4 5 : 0 0
Tomake p r i n t _ t i m e amethod,allwehavetodoismovethefunctiondefinitioninsidetheclassdefinition.Noticethechangeinindentation.
c l a s sT i m e ( o b j e c t ) : d e fp r i n t _ t i m e ( t i m e ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t i m e . h o u r ,t i m e . m i n u t e ,t i m e . s e c o n d )
Nowtherearetwowaystocall p r i n t _ t i m e .Thefirst(andlesscommon)wayistousefunctionsyntax:
> > >T i m e . p r i n t _ t i m e ( s t a r t ) 0 9 : 4 5 : 0 0
10/24/13
Thereasonforthisconventionisanimplicitmetaphor: Thesyntaxforafunctioncall, p r i n t _ t i m e ( s t a r t ) , suggeststhatthefunctionistheactiveagent.Itsayssomethinglike,Hey p r i n t _ t i m e !Heresanobjectforyoutoprint. Inobjectorientedprogramming,theobjectsaretheactive agents.Amethodinvocationlike s t a r t . p r i n t _ t i m e ( ) saysHey s t a r t !Pleaseprintyourself. Thischangeinperspectivemightbemorepolite,butitisnotobviousthatitisuseful.Intheexampleswehaveseensofar,itmaynotbe.Butsometimes shiftingresponsibilityfromthefunctionsontotheobjectsmakesitpossibletowritemoreversatilefunctions,andmakesiteasiertomaintainandreusecode.
Exercise1
Rewrite t i m e _ t o _ i n t (fromSection'16.4')asamethod.Itisprobablynotappropriatetorewrite i n t _ t o _ t i m e asamethoditsnotclearwhatobjectyouwould invokeiton!
Anotherexample
Heresaversionof i n c r e m e n t (fromSection16.3)rewrittenasamethod:
#i n s i d ec l a s sT i m e : d e fi n c r e m e n t ( s e l f ,s e c o n d s ) : s e c o n d s+ =s e l f . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )
10/24/13
Theerrormessageisinitiallyconfusing,becausethereareonlytwoargumentsinparentheses.Butthesubjectisalsoconsideredanargument,soalltogether thatsthree.
Amorecomplicatedexample
i s _ a f t e r (fromExercise16.2)isslightlymorecomplicatedbecauseittakestwoTimeobjectsasparameters.Inthiscaseitisconventionaltonamethefirst
parameter s e l f andthesecondparameter o t h e r :
#i n s i d ec l a s sT i m e : d e fi s _ a f t e r ( s e l f ,o t h e r ) : r e t u r ns e l f . t i m e _ t o _ i n t ( )>o t h e r . t i m e _ t o _ i n t ( )
Tousethismethod,youhavetoinvokeitononeobjectandpasstheotherasanargument:
> > >e n d . i s _ a f t e r ( s t a r t ) T r u e
OnenicethingaboutthissyntaxisthatitalmostreadslikeEnglish:endisafterstart?
Theinitmethod
Theinitmethod(shortforinitialization)isaspecialmethodthatgetsinvokedwhenanobjectisinstantiated.Itsfullnameis _ _ i n i t _ _ (twounderscore characters,followedby i n i t ,andthentwomoreunderscores).Aninitmethodforthe T i m e classmightlooklikethis:
#i n s i d ec l a s sT i m e : d e f_ _ i n i t _ _ ( s e l f ,h o u r = 0 ,m i n u t e = 0 ,s e c o n d = 0 ) : s e l f . h o u r=h o u r s e l f . m i n u t e=m i n u t e
en.wikibooks.org/wiki/Think_Python/Print_version 178/282
10/24/13
s e l f . s e c o n d=s e c o n d
Itiscommonfortheparametersof _ _ i n i t _ _ tohavethesamenamesastheattributes.Thestatement
s e l f . h o u r=h o u r
Ifyouprovideoneargument,itoverrides h o u r :
> > >t i m e=T i m e( 9 ) > > >t i m e . p r i n t _ t i m e ( ) 0 9 : 0 0 : 0 0
Ifyouprovidetwoarguments,theyoverride h o u r and m i n u t e .
> > >t i m e=T i m e ( 9 ,4 5 ) > > >t i m e . p r i n t _ t i m e ( ) 0 9 : 4 5 : 0 0
Andifyouprovidethreearguments,theyoverrideallthreedefaultvalues.
Exercise2
Writeaninitmethodforthe'P o i n t 'classthattakes'x 'and'y 'asoptionalparametersandassignsthemtothecorrespondingattributes.
The_ _ s t r _ _ method
_ _ s t r _ _ isaspecialmethod,like _ _ i n i t _ _ ,thatissupposedtoreturnastringrepresentationofanobject.
Forexample,hereisa s t r methodforTimeobjects:
#i n s i d ec l a s sT i m e :
en.wikibooks.org/wiki/Think_Python/Print_version 179/282
10/24/13
d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % . 2 d : % . 2 d : % . 2 d '%( s e l f . h o u r ,s e l f . m i n u t e ,s e l f . s e c o n d )
Exercise3
Writea's t r 'methodforthe'P o i n t 'class.CreateaPointobjectandprintit.
Operatoroverloading
Bydefiningotherspecialmethods,youcanspecifythebehaviorofoperatorsonuserdefinedtypes.Forexample,ifyoudefineamethodnamed _ _ a d d _ _ forthe T i m e class,youcanusethe + operatoronTimeobjects. Hereiswhatthedefinitionmightlooklike:
#i n s i d ec l a s sT i m e : d e f_ _ a d d _ _ ( s e l f ,o t h e r ) : s e c o n d s=s e l f . t i m e _ t o _ i n t ( )+o t h e r . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )
Andhereishowyoucoulduseit:
> > >s t a r t=T i m e ( 9 ,4 5 ) > > >d u r a t i o n=T i m e ( 1 ,3 5 ) > > >p r i n ts t a r t+d u r a t i o n 1 1 : 2 0 : 0 0
10/24/13
Exercise4
Writean'a d d 'methodforthePointclass.
Typebaseddispatch
IntheprevioussectionweaddedtwoTimeobjects,butyoualsomightwanttoaddanintegertoaTimeobject.Thefollowingisaversionof _ _ a d d _ _ that checksthetypeof o t h e r andinvokeseither a d d _ t i m e or i n c r e m e n t :
#i n s i d ec l a s sT i m e : d e f_ _ a d d _ _ ( s e l f ,o t h e r ) : i fi s i n s t a n c e ( o t h e r ,T i m e ) : r e t u r ns e l f . a d d _ t i m e ( o t h e r ) e l s e : r e t u r ns e l f . i n c r e m e n t ( o t h e r ) d e fa d d _ t i m e ( s e l f ,o t h e r ) : s e c o n d s=s e l f . t i m e _ t o _ i n t ( )+o t h e r . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s ) d e fi n c r e m e n t ( s e l f ,s e c o n d s ) : s e c o n d s+ =s e l f . t i m e _ t o _ i n t ( ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s )
Thebuiltinfunction i s i n s t a n c e takesavalueandaclassobject,andreturns T r u e ifthevalueisaninstanceoftheclass. If o t h e r isaTimeobject, _ _ a d d _ _ invokes a d d _ t i m e .Otherwiseitassumesthattheparameterisanumberandinvokes i n c r e m e n t .Thisoperationiscalleda type baseddispatchbecauseitdispatchesthecomputationtodifferentmethodsbasedonthetypeofthearguments. Hereareexamplesthatusethe + operatorwithdifferenttypes:
> > >s t a r t=T i m e ( 9 ,4 5 ) > > >d u r a t i o n=T i m e ( 1 ,3 5 ) > > >p r i n ts t a r t+d u r a t i o n 1 1 : 2 0 : 0 0 > > >p r i n ts t a r t+1 3 3 7 1 0 : 0 7 : 1 7
Unfortunately,thisimplementationofadditionisnotcommutative.Iftheintegeristhefirstoperand,youget
> > >p r i n t1 3 3 7+s t a r t T y p e E r r o r :u n s u p p o r t e do p e r a n dt y p e ( s )f o r+ :' i n t 'a n d' i n s t a n c e '
en.wikibooks.org/wiki/Think_Python/Print_version
181/282
10/24/13
Andhereshowitsused:
> > >p r i n t1 3 3 7+s t a r t 1 0 : 0 7 : 1 7
Exercise5
Writean'a d d 'methodforPointsthatworkswitheitheraPointobjectoratuple: IfthesecondoperandisaPoint,themethodshouldreturnanewPointwhose'x'coordinateisthesumofthe'x'coordinatesoftheoperands,and likewiseforthe'y'coordinates. Ifthesecondoperandisatuple,themethodshouldaddthefirstelementofthetupletothe'x'coordinateandthesecondelementtothe'y'coordinate, andreturnanewPointwiththeresult.
Polymorphism
Typebaseddispatchisusefulwhenitisnecessary,but(fortunately)itisnotalwaysnecessary.Oftenyoucanavoiditbywritingfunctionsthatworkcorrectly forargumentswithdifferenttypes. Manyofthefunctionswewroteforstringswillactuallyworkforanykindofsequence.Forexample,inSection11.1weused h i s t o g r a m tocountthenumberof timeseachletterappearsinaword.
d e fh i s t o g r a m ( s ) : d=d i c t ( ) f o rci ns : i fcn o ti nd : d [ c ]=1 e l s e : d [ c ]=d [ c ] + 1 r e t u r nd
Thisfunctionalsoworksforlists,tuples,andevendictionaries,aslongastheelementsof s arehashable,sotheycanbeusedaskeysin d .
en.wikibooks.org/wiki/Think_Python/Print_version 182/282
10/24/13
> > >t=[ ' s p a m ' ,' e g g ' ,' s p a m ' ,' s p a m ' ,' b a c o n ' ,' s p a m ' ] > > >h i s t o g r a m ( t ) { ' b a c o n ' :1 ,' e g g ' :1 ,' s p a m ' :4 }
Ingeneral,ifalloftheoperationsinsideafunctionworkwithagiventype,thenthefunctionworkswiththattype. Thebestkindofpolymorphismistheunintentionalkind,whereyoudiscoverthatafunctionyoualreadywrotecanbeappliedtoatypeyouneverplannedfor.
Debugging
Itislegaltoaddattributestoobjectsatanypointintheexecutionofaprogram,butifyouareasticklerfortypetheory,itisadubiouspracticetohaveobjects ofthesametypewithdifferentattributesets.Itisusuallyagoodideatoinitializeallofanobjectsattributesintheinitmethod. Ifyouarenotsurewhetheranobjecthasaparticularattribute,youcanusethebuiltinfunction h a s a t t r (seeSection15.7). Anotherwaytoaccesstheattributesofanobjectisthroughthespecialattribute _ _ d i c t _ _ ,whichisadictionarythatmapsattributenames(asstrings)and values:
> > >p=P o i n t ( 3 ,4 ) > > >p r i n tp . _ _ d i c t _ _ { ' y ' :4 ,' x ' :3 }
Forpurposesofdebugging,youmightfinditusefultokeepthisfunctionhandy:
d e fp r i n t _ a t t r i b u t e s ( o b j ) : f o ra t t ri no b j . _ _ d i c t _ _ : p r i n ta t t r ,g e t a t t r ( o b j ,a t t r )
p r i n t _ a t t r i b u t e s traversestheitemsintheobjectsdictionaryandprintseachattributenameanditscorrespondingvalue.
en.wikibooks.org/wiki/Think_Python/Print_version 183/282
10/24/13
Thebuiltinfunction g e t a t t r takesanobjectandanattributename(asastring)andreturnstheattributesvalue.
Glossary
objectorientedlanguage: Alanguagethatprovidesfeatures,suchasuserdefinedclassesandmethodsyntax,thatfacilitateobjectorientedprogramming. objectorientedprogramming: Astyleofprogramminginwhichdataandtheoperationsthatmanipulateitareorganizedintoclassesandmethods. method: Afunctionthatisdefinedinsideaclassdefinitionandisinvokedoninstancesofthatclass. subject: Theobjectamethodisinvokedon. operatoroverloading: Changingthebehaviorofanoperatorlike + soitworkswithauserdefinedtype. typebaseddispatch: Aprogrammingpatternthatchecksthetypeofanoperandandinvokesdifferentfunctionsfordifferenttypes. polymorphic: Pertainingtoafunctionthatcanworkwithmorethanonetype.
Exercises
Exercise6
Thisexerciseisacautionarytaleaboutoneofthemost common,anddifficulttofind,errorsinPython. Writeadefinitionforaclassnamed'K a n g a r o o 'withthefollowing methods: An _ _ i n i t _ _ methodthatinitializesanattributenamed p o u c h _ c o n t e n t s toanemptylist. Amethodnamed p u t _ i n _ p o u c h thattakesanobjectofanytypeandaddsitto p o u c h _ c o n t e n t s . A_ _ s t r _ _ methodthatreturnsastringrepresentationoftheKangarooobjectandthecontentsofthepouch. Testyourcodebycreatingtwo'''K a n g a r o o '''objects,assigningthemtovariablesnamed'''k a n g a '''and'''r o o ''',andthenadding'''r o o '''tothecontentsof'''k a n g a '''s pouch.' 'Download'''t h i n k p y t h o n . c o m / c o d e / B a d K a n g a r o o . p y '''.Itcontains
en.wikibooks.org/wiki/Think_Python/Print_version 184/282
10/24/13
Exercise7
VisualisaPythonmodulethatprovides3Dgraphics.ItisnotalwaysincludedinaPythoninstallation,soyoumighthavetoinstallitfromyoursoftware repositoryor,ifitsnotthere,from'v p y t h o n . o r g '. Thefollowingexamplecreatesa3Dspacethatis256unitswide,longandhigh,andsetsthecentertobethepoint'(128,128,128)'.Thenitdrawsablue sphere.
' ' f r o mv i s u a li m p o r t* s c e n e . r a n g e=( 2 5 6 ,2 5 6 ,2 5 6 ) s c e n e . c e n t e r=( 1 2 8 ,1 2 8 ,1 2 8 ) c o l o r=( 0 . 1 ,0 . 1 ,0 . 9 ) #m o s t l yb l u e s p h e r e ( p o s = s c e n e . c e n t e r ,r a d i u s = 1 2 8 ,c o l o r = c o l o r ) ' '
c o l o r ''isanRGBtuplethatis,theelementsareRedGreenBluelevelsbetween0.0and1.0(see'w i k i p e d i a . o r g / w i k i / R G B _ c o l o r _ m o d e l ').
10/24/13
Furtherreading
Wikipedia:VPython Wikipedia:RGBcolormodel
Inheritance
Inthischapterwewilldevelopclassestorepresentplayingcards,decksofcards,andpokerhands.Ifyoudontplaypoker,youcanreadaboutitat w i k i p e d i a . o r g / w i k i / P o k e r (http://en.wikipedia.org/wiki/Poker),butyoudon'thavetoI'lltellyouwhatyouneedtoknowfortheexercises. IfyouarenotfamiliarwithAngloAmericanplayingcards,youcanreadaboutthemat w i k i p e d i a . o r g / w i k i / P l a y i n g _ c a r d s (http://en.wikipedia.org/wiki/Playing_cards).
Cardobjects
Therearefiftytwocardsinadeck,eachofwhichbelongstooneoffoursuitsandoneofthirteenranks.ThesuitsareSpades,Hearts,Diamonds,andClubs (indescendingorderinbridge).TheranksareAce,2,3,4,5,6,7,8,9,10,Jack,Queen,andKing.Dependingonthegamethatyouareplaying,anAcemay behigherthanKingorlowerthan2. Ifwewanttodefineanewobjecttorepresentaplayingcard,itisobviouswhattheattributesshouldbe: r a n k and s u i t .Itisnotasobviouswhattypethe attributesshouldbe.Onepossibilityistousestringscontainingwordslike ' S p a d e ' forsuitsand ' Q u e e n ' forranks.Oneproblemwiththisimplementationisthatit wouldnotbeeasytocomparecardstoseewhichhadahigherrankorsuit. Analternativeistouseintegersto encodetheranksandsuits.Inthiscontext,encodemeansthatwearegoingtodefineamappingbetweennumbersand suits,orbetweennumbersandranks.Thiskindofencodingisnotmeanttobeasecret(thatwouldbeencryption). Forexample,thistableshowsthesuitsandthecorrespondingintegercodes: Spades Hearts 3 2
Diamonds 1 Clubs 0
Thiscodemakesiteasytocomparecardsbecausehighersuitsmaptohighernumbers,wecancomparesuitsbycomparingtheircodes. Themappingforranksisfairlyobviouseachofthenumericalranksmapstothecorrespondinginteger,andforfacecards:
en.wikibooks.org/wiki/Think_Python/Print_version 186/282
10/24/13
Jack
11
Queen 12 King 13
Classattributes
InordertoprintCardobjectsinawaythatpeoplecaneasilyread,weneedamappingfromtheintegercodestothecorrespondingranksandsuits.Anatural waytodothatiswithlistsofstrings.Weassigntheseliststo classattributes:
#i n s i d ec l a s sC a r d : s u i t _ n a m e s=[ ' C l u b s ' ,' D i a m o n d s ' ,' H e a r t s ' ,' S p a d e s ' ] r a n k _ n a m e s=[ N o n e ,' A c e ' ,' 2 ' ,' 3 ' ,' 4 ' ,' 5 ' ,' 6 ' ,' 7 ' , ' 8 ' ,' 9 ' ,' 1 0 ' ,' J a c k ' ,' Q u e e n ' ,' K i n g ' ] d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % so f% s '%( C a r d . r a n k _ n a m e s [ s e l f . r a n k ] , C a r d . s u i t _ n a m e s [ s e l f . s u i t ] )
10/24/13
Bothkindsofattributeareaccessedusingdotnotation.Forexample,in _ _ s t r _ _ , s e l f isaCardobject,and s e l f . r a n k isitsrank.Similarly, C a r d isaclassobject, and C a r d . r a n k _ n a m e s isalistofstringsassociatedwiththeclass. Everycardhasitsown s u i t and r a n k ,butthereisonlyonecopyof s u i t _ n a m e s and r a n k _ n a m e s . Puttingitalltogether,theexpression C a r d . r a n k _ n a m e s [ s e l f . r a n k ] meansusetheattribute r a n k fromtheobject s e l f asanindexintothelist r a n k _ n a m e s fromtheclass C a r d ,andselecttheappropriatestring. Thefirstelementof r a n k _ n a m e s is N o n e becausethereisnocardwithrankzero.Byincluding N o n e asaplacekeeper,wegetamappingwiththenicepropertythat theindex2mapstothestring ' 2 ' ,andsoon.Toavoidthistweak,wecouldhaveusedadictionaryinsteadofalist. Withthemethodswehavesofar,wecancreateandprintcards:
> > >c a r d 1=C a r d ( 2 ,1 1 ) > > >p r i n tc a r d 1 J a c ko fH e a r t s
Comparingcards
Forbuiltintypes,thereareconditionaloperators(< , > , = = ,etc.)thatcomparevaluesanddeterminewhenoneisgreaterthan,lessthan,orequaltoanother. Foruserdefinedtypes,wecanoverridethebehaviorofthebuiltinoperatorsbyprovidingamethodnamed _ _ c m p _ _ .
_ _ c m p _ _ takestwoparameters, s e l f and o t h e r ,andreturnsapositivenumberifthefirstobjectisgreater,anegativenumberifthesecondobjectisgreater,and0
10/24/13
Youcanwritethismoreconciselyusingtuplecomparison:
#i n s i d ec l a s sC a r d : d e f_ _ c m p _ _ ( s e l f ,o t h e r ) : t 1=s e l f . s u i t ,s e l f . r a n k t 2=o t h e r . s u i t ,o t h e r . r a n k r e t u r nc m p ( t 1 ,t 2 )
Exercise1
Writea _ _ c m p _ _ methodforTimeobjects.Hint:youcanusetuplecomparison,butyoualsomightconsiderusingintegersubtraction.
Decks
NowthatwehaveCards,thenextstepistodefineDecks.Sinceadeckismadeupofcards,itisnaturalforeachDecktocontainalistofcardsasan attribute. Thefollowingisaclassdefinitionfor D e c k .Theinitmethodcreatestheattribute c a r d s andgeneratesthestandardsetoffiftytwocards:
c l a s sD e c k : d e f_ _ i n i t _ _ ( s e l f ) : s e l f . c a r d s=[ ] f o rs u i ti nr a n g e ( 4 ) : f o rr a n ki nr a n g e ( 1 ,1 4 ) : c a r d=C a r d ( s u i t ,r a n k ) s e l f . c a r d s . a p p e n d ( c a r d )
Theeasiestwaytopopulatethedeckiswithanestedloop.Theouterloopenumeratesthesuitsfrom0to3.Theinnerloopenumeratestheranksfrom1to 13.EachiterationcreatesanewCardwiththecurrentsuitandrank,andappendsitto s e l f . c a r d s .
en.wikibooks.org/wiki/Think_Python/Print_version 189/282
10/24/13
Printingthedeck
Hereisa _ _ s t r _ _ methodfor D e c k :
# i n s i d ec l a s sD e c k : d e f_ _ s t r _ _ ( s e l f ) : r e s=[ s t r ( c a r d )f o rc a r di ns e l f . c a r d s ] r e t u r n' \ n ' . j o i n ( r e s )
Eventhoughtheresultappearson52lines,itisonelongstringthatcontainsnewlines.
Add,remove,shuffleandsort
Todealcards,wewouldlikeamethodthatremovesacardfromthedeckandreturnsit.Thelistmethod p o p providesaconvenientwaytodothat:
# i n s i d ec l a s sD e c k : d e fp o p _ c a r d ( s e l f ) : r e t u r ns e l f . c a r d s . p o p ( )
10/24/13
d e fa d d _ c a r d ( s e l f ,c a r d ) : s e l f . c a r d s . a p p e n d ( c a r d )
Dontforgettoimport r a n d o m .
Exercise2
WriteaDeckmethodnamed's o r t 'thatusesthelistmethod's o r t 'tosortthecardsina'D e c k '.'s o r t 'usesthe _ _ c m p _ _ methodwedefinedtodeterminesortorder.
Inheritance
Thelanguagefeaturemostoftenassociatedwithobjectorientedprogrammingis inheritance.Inheritanceistheabilitytodefineanewclassthatisamodified versionofanexistingclass. Itiscalledinheritancebecausethenewclassinheritsthemethodsoftheexistingclass.Extendingthismetaphor,theexistingclassiscalledthe parentand thenewclassiscalledthe child. Asanexample,letssaywewantaclasstorepresentahand,thatis,thesetofcardsheldbyoneplayer.Ahandissimilartoadeck:botharemadeupofa setofcards,andbothrequireoperationslikeaddingandremovingcards. Ahandisalsodifferentfromadeckthereareoperationswewantforhandsthatdontmakesenseforadeck.Forexample,inpokerwemightcomparetwo handstoseewhichonewins.Inbridge,wemightcomputeascoreforahandinordertomakeabid. Thisrelationshipbetweenclassessimilar,butdifferentlendsitselftoinheritance. Thedefinitionofachildclassislikeotherclassdefinitions,butthenameoftheparentclassappearsinparentheses:
c l a s sH a n d ( D e c k ) : " " " r e p r e s e n t sah a n do fp l a y i n gc a r d s " " "
en.wikibooks.org/wiki/Think_Python/Print_version
191/282
10/24/13
SowhenyoucreateaHand,Pythoninvokesthisinitmethod:
> > >h a n d=H a n d ( ' n e wh a n d ' ) > > >p r i n th a n d . c a r d s [ ] > > >p r i n th a n d . l a b e l n e wh a n d
Anaturalnextstepistoencapsulatethiscodeinamethodcalled m o v e _ c a r d s :
# i n s i d ec l a s sD e c k : d e fm o v e _ c a r d s ( s e l f ,h a n d ,n u m ) : f o rii nr a n g e ( n u m ) : h a n d . a d d _ c a r d ( s e l f . p o p _ c a r d ( ) )
m o v e _ c a r d s takestwoarguments,aHandobjectandthenumberofcardstodeal.Itmodifiesboth s e l f and h a n d ,andreturns N o n e .
en.wikibooks.org/wiki/Think_Python/Print_version
192/282
10/24/13
Classdiagrams
Sofarwehaveseenstackdiagrams,whichshowthestateofaprogram,andobjectdiagrams,whichshowtheattributesofanobjectandtheirvalues.These diagramsrepresentasnapshotintheexecutionofaprogram,sotheychangeastheprogramruns. Theyarealsohighlydetailedforsomepurposes,toodetailed.Aclassdiagramsisamoreabstractrepresentationofthestructureofaprogram.Insteadof showingindividualobjects,itshowsclassesandtherelationshipsbetweenthem. Thereareseveralkindsofrelationshipbetweenclasses: Objectsinoneclassmightcontainreferencestoobjectsinanotherclass.Forexample,eachRectanglecontainsareferencetoaPoint,andeachDeck containsreferencestomanyCards.Thiskindofrelationshipiscalled HASA,asin,aRectanglehasaPoint. Oneclassmightinheritfromanother.Thisrelationshipiscalled ISA,asin,aHandisakindofaDeck. Oneclassmightdependonanotherinthesensethatchangesinoneclasswouldrequirechangesintheother. A classdiagramisagraphicalrepresentationoftheserelationships2.Forexample,thisdiagramshowstherelationshipsbetween C a r d , D e c k and H a n d . <IMGSRC="book027.png"> ThearrowwithahollowtriangleheadrepresentsanISArelationshipinthiscaseitindicatesthatHandinheritsfromDeck. ThestandardarrowheadrepresentsaHASArelationshipinthiscaseaDeckhasreferencestoCardobjects. Thestar(* )nearthearrowheadisa multiplicityitindicateshowmanyCardsaDeckhas.Amultiplicitycanbeasimplenumber,like 5 2 ,arange,like 5 . . 7 or astar,whichindicatesthataDeckcanhaveanynumberofCards. AmoredetaileddiagrammightshowthataDeckactuallycontainsa list ofCards,butbuiltintypeslikelistanddictareusuallynotincludedinclassdiagrams.
Exercise4
Read'T u r t l e W o r l d . p y ','W o r l d . p y 'and'G u i . p y 'anddrawaclassdiagramthatshowstherelationshipsamongtheclassesdefinedthere.
en.wikibooks.org/wiki/Think_Python/Print_version 193/282
10/24/13
Debugging
Inheritancecanmakedebuggingachallengebecausewhenyouinvokeamethodonanobject,youmightnotknowwhichmethodwillbeinvoked. SupposeyouarewritingafunctionthatworkswithHandobjects.YouwouldlikeittoworkwithallkindsofHands,likePokerHands,BridgeHands,etc.Ifyou invokeamethodlike s h u f f l e ,youmightgettheonedefinedin D e c k ,butifanyofthesubclassesoverridethismethod,youllgetthatversioninstead. Anytimeyouareunsureabouttheflowofexecutionthroughyourprogram,thesimplestsolutionistoaddprintstatementsatthebeginningoftherelevant methods.If D e c k . s h u f f l e printsamessagethatsayssomethinglike R u n n i n gD e c k . s h u f f l e ,thenastheprogramrunsittracestheflowofexecution. Asanalternative,youcouldusethisfunction,whichtakesanobjectandamethodname(asastring)andreturnstheclassthatprovidesthedefinitionofthe method:
d e ff i n d _ d e f i n i n g _ c l a s s ( o b j ,m e t h _ n a m e ) : f o rt yi nt y p e ( o b j ) . m r o ( ) : i fm e t h _ n a m ei nt y . _ _ d i c t _ _ : r e t u r nt y
Heresanexample:
> > >h a n d=H a n d ( ) > > >p r i n tf i n d _ d e f i n i n g _ c l a s s ( h a n d ,' s h u f f l e ' ) < c l a s s' C a r d . D e c k ' >
Sothe s h u f f l e methodforthisHandistheonein D e c k .
f i n d _ d e f i n i n g _ c l a s s usesthe m r o methodtogetthelistofclassobjects(types)thatwillbesearchedformethods.MROstandsformethodresolutionorder.
Glossary
encode: Torepresentonesetofvaluesusinganothersetofvaluesbyconstructingamappingbetweenthem. classattribute: Anattributeassociatedwithaclassobject.Classattributesaredefinedinsideaclassdefinitionbutoutsideanymethod. instanceattribute: Anattributeassociatedwithaninstanceofaclass.
en.wikibooks.org/wiki/Think_Python/Print_version 194/282
10/24/13
veneer: Amethodorfunctionthatprovidesadifferentinterfacetoanotherfunctionwithoutdoingmuchcomputation. inheritance: Theabilitytodefineanewclassthatisamodifiedversionofapreviouslydefinedclass. parentclass: Theclassfromwhichachildclassinherits. childclass: Anewclasscreatedbyinheritingfromanexistingclassalsocalledasubclass. ISArelationship: Therelationshipbetweenachildclassanditsparentclass. HASArelationship: Therelationshipbetweentwoclasseswhereinstancesofoneclasscontainreferencestoinstancesoftheother. classdiagram: Adiagramthatshowstheclassesinaprogramandtherelationshipsbetweenthem. multiplicity: Anotationinaclassdiagramthatshows,foraHASArelationship,howmanyreferencestherearetoinstancesofanotherclass.
Exercises
Exercise5
Thefollowingarethepossiblehandsinpoker,inincreasingorderofvalue(anddecreasingorderofprobability): pair: twocardswiththesamerank ''twopair:'' twopairsofcardswiththesamerank ''threeofakind:'' threecardswiththesamerank ''straight:'' fivecardswithranksinsequence(acescanbehighorlow,so'A c e 2 3 4 5 'isastraightandsois'1 0 J a c k Q u e e n K i n g A c e ',but'Q u e e n K i n g A c e 2 3 'isnot.) ''flush:'' fivecardswiththesamesuit ''fullhouse:'' threecardswithonerank,twocardswithanother ''fourofakind:''
en.wikibooks.org/wiki/Think_Python/Print_version 195/282
10/24/13
:Acompleteversionofthe'C a r d ','D e c k 'and'H a n d 'classesinthischapter. ''P o k e r H a n d . p y '' :Anincompleteimplementationofaclass thatrepresentsapokerhand,andsomecodethattestsit. 'Ifyourun'''P o k e r H a n d . p y ''',itdealssix7cardpokerhands andcheckstoseeifanyofthemcontainsaflush.Readthiscodecarefullybeforeyougoon.' 'Addmethodsto'''P o k e r H a n d . p y ''' named'' h a s _ p a i r ' ', '' h a s _ t w o p a i r ' ',etc.thatreturnTrueorFalseaccordingtowhetherornotthehandmeetstherelevantcriteria.Yourcodeshouldworkcorrectlyforhandsthat containanynumberofcards(although5and7arethemostcommonsizes).' 'Writeamethodnamed'''c l a s s i f y ''' thatfiguresout thehighestvalueclassificationforahandandsetsthe'''l a b e l '''attributeaccordingly.Forexample,a7cardhandmightcontainaflushandapairitshouldbe labeledflush.' 'Whenyouareconvincedthatyourclassificationmethodsare working,thenextstepistoestimatetheprobabilitiesofthevarioushands.Writeafunctionin'''P o k e r H a n d . p y '''thatshufflesadeckofcards,dividesitintohands, classifiesthehands,andcountsthenumberoftimesvariousclassificationsappear.' 'Printatableoftheclassificationsandtheirprobabilities. Runyourprogramwithlargerandlargernumbersofhandsuntiltheoutputvaluesconvergetoareasonabledegreeofaccuracy.Compareyourresultstothe valuesat'''w i k i p e d i a . o r g / w i k i / H a n d _ r a n k i n g s '''.'
Exercise6
196/282
10/24/13
ThisexerciseusesTurtleWorldfromChapter'4'. YouwillwritecodethatmakesTurtlesplaytag.Ifyouarenotfamiliarwiththerulesoftag,see 'w i k i p e d i a . o r g / w i k i / T a g _ ( g a m e ) '. Download't h i n k p y t h o n . c o m / c o d e / W o b b l e r . p y 'andrunit.You shouldseeaTurtleWorldwiththreeTurtles.Ifyoupressthe'Run'button,theTurtleswanderatrandom. Readthecodeandmakesureyouunderstandhowitworks. The'W o b b l e r 'classinheritsfrom'T u r t l e ',whichmeansthatthe'T u r t l e 'methods'l t ','r t ','f d 'and'b k 'workonWobblers. The's t e p 'methodgetsinvokedby TurtleWorld.Itinvokes's t e e r ',whichturnstheTurtleinthedesireddirection,'w o b b l e ',whichmakesarandomturninproportiontotheTurtlesclumsiness,and 'm o v e ',whichmovesforwardafewpixels,dependingontheTurtlesspeed. Createafilenamed'T a g g e r . p y '.Importeverythingfrom 'W o b b l e r ',thendefineaclassnamed'T a g g e r 'thatinheritsfrom'W o b b l e r '.Call m a k e _ w o r l d passingthe'T a g g e r 'classobjectasanargument. Adda's t e e r 'methodto'T a g g e r 'tooverridetheonein 'W o b b l e r '.Asastartingplace,writeaversionthatalwayspointstheTurtletowardtheorigin.Hint:usethemathfunction'a t a n 2 'andtheTurtleattributes'x ','y 'and 'h e a d i n g '. Modify's t e e r 'sothattheTurtlesstayinbounds. Fordebugging,youmightwanttousethe'Step'button,whichinvokes's t e p 'onceoneachTurtle. Modify's t e e r 'sothateachTurtlepointstowarditsnearest neighbor.Hint:Turtleshaveanattribute,'w o r l d ',thatisareferencetotheTurtleWorldtheylivein,andtheTurtleWorldhasanattribute,'a n i m a l s ',thatisalistof allTurtlesintheworld. Modify's t e e r 'sotheTurtlesplaytag.Youcanaddmethods to'T a g g e r 'andyoucanoverride's t e e r 'and _ _ i n i t _ _ ,butyoumaynotmodifyoroverride's t e p ','w o b b l e 'or'm o v e '.Also,'s t e e r 'isallowedtochangetheheadingofthe Turtlebutnottheposition. Adjusttherulesandyour's t e e r 'methodforgoodqualityplay forexample,itshouldbepossiblefortheslowTurtletotagthefaster Turtleseventually. Youcangetmysolutionfrom't h i n k p y t h o n . c o m / c o d e / T a g g e r . p y '.
1 See w i k i p e d i a . o r g / w i k i / B o t t o m _ d e a l i n g .
en.wikibooks.org/wiki/Think_Python/Print_version 197/282
10/24/13
2 ThediagramsIamusingherearesimilartoUML(see w i k i p e d i a . o r g / w i k i / U n i f i e d _ M o d e l i n g _ L a n g u a g e ),withafewsimplifications.
Debugging
Differentkindsoferrorscanoccurinaprogram,anditisusefultodistinguishamongtheminordertotrackthemdownmorequickly: SyntaxerrorsareproducedbyPythonwhenitistranslatingthesourcecodeintobytecode.Theyusuallyindicatethatthereissomethingwrongwiththe syntaxoftheprogram.Example:Omittingthecolonattheendofa d e f statementyieldsthesomewhatredundantmessage S y n t a x E r r o r :i n v a l i ds y n t a x . Runtimeerrorsareproducedbytheinterpreterifsomethinggoeswrongwhiletheprogramisrunning.Mostruntimeerrormessagesincludeinformation aboutwheretheerroroccurredandwhatfunctionswereexecuting.Example:Aninfiniterecursioneventuallycausestheruntimeerrormaximum recursiondepthexceeded. Semanticerrorsareproblemswithaprogramthatrunswithoutproducingerrormessagesbutdoesntdotherightthing.Example:Anexpressionmay notbeevaluatedintheorderyouexpect,yieldinganincorrectresult. Thefirststepindebuggingistofigureoutwhichkindoferroryouaredealingwith.Althoughthefollowingsectionsareorganizedbyerrortype,some techniquesareapplicableinmorethanonesituation.
Syntaxerrors
Syntaxerrorsareusuallyeasytofixonceyoufigureoutwhattheyare.Unfortunately,theerrormessagesareoftennothelpful.Themostcommonmessages are S y n t a x E r r o r :i n v a l i ds y n t a x and S y n t a x E r r o r :i n v a l i dt o k e n ,neitherofwhichisveryinformative. Ontheotherhand,themessagedoestellyouwhereintheprogramtheproblemoccurred.Actually,ittellsyouwherePythonnoticedaproblem,whichisnot necessarilywheretheerroris.Sometimestheerrorispriortothelocationoftheerrormessage,oftenontheprecedingline. Ifyouarebuildingtheprogramincrementally,youshouldhaveagoodideaaboutwheretheerroris.Itwillbeinthelastlineyouadded. Ifyouarecopyingcodefromabook,startbycomparingyourcodetothebookscodeverycarefully.Checkeverycharacter.Atthesametime,rememberthat thebookmightbewrong,soifyouseesomethingthatlookslikeasyntaxerror,itmightbe. Herearesomewaystoavoidthemostcommonsyntaxerrors: MakesureyouarenotusingaPythonkeywordforavariablename. Checkthatyouhaveacolonattheendoftheheaderofevery compoundstatement,including f o r , w h i l e , i f ,and d e f statements.
Makesurethatanystringsinthecodehavematching
en.wikibooks.org/wiki/Think_Python/Print_version 198/282
10/24/13
Anunclosedopeningoperator( , { ,or
[ makesPythoncontinuewiththenextlineaspartofthecurrentstatement.Generally,anerroroccursalmostimmediatelyinthenextline.
Ikeepmakingchangesanditmakesnodifference.
Iftheinterpretersaysthereisanerrorandyoudontseeit,thatmightbebecauseyouandtheinterpreterarenotlookingatthesamecode.Checkyour programmingenvironmenttomakesurethattheprogramyouareeditingistheonePythonistryingtorun. Ifyouarenotsure,tryputtinganobviousanddeliberatesyntaxerroratthebeginningoftheprogram.Nowrunitagain.Iftheinterpreterdoesntfindthenew error,youarenotrunningthenewcode. Thereareafewlikelyculprits: Youeditedthefileandforgottosavethechangesbefore runningitagain.Someprogrammingenvironmentsdothisforyou,butsomedont. Youchangedthenameofthefile,butyouarestillrunning theoldname. Somethinginyourdevelopmentenvironmentisconfigured incorrectly.
en.wikibooks.org/wiki/Think_Python/Print_version 199/282
10/24/13
Ifyouarewritingamoduleandusing i m p o r t , makesureyoudontgiveyourmodulethesamenameasoneofthestandardPythonmodules.
Runtimeerrors
Onceyourprogramissyntacticallycorrect,Pythoncancompileitandatleaststartrunningit.Whatcouldpossiblygowrong?
Myprogramdoesabsolutelynothing.
Thisproblemismostcommonwhenyourfileconsistsoffunctionsandclassesbutdoesnotactuallyinvokeanythingtostartexecution.Thismaybeintentional ifyouonlyplantoimportthismoduletosupplyclassesandfunctions. Ifitisnotintentional,makesurethatyouareinvokingafunctiontostartexecution,orexecuteonefromtheinteractiveprompt.AlsoseetheFlowof Executionsectionbelow.
Myprogramhangs.
Ifaprogramstopsandseemstobedoingnothing,itishanging.Oftenthatmeansthatitiscaughtinaninfinitelooporinfiniterecursion. Ifthereisaparticularloopthatyoususpectisthe problem,adda p r i n t statementimmediatelybeforetheloopthatsaysenteringtheloopandanotherimmediatelyafterthatsaysexitingtheloop.Runthe program.Ifyougetthefirstmessageandnotthesecond,youvegotaninfiniteloop.GototheInfiniteLoopsectionbelow. Mostofthetime,aninfiniterecursionwillcausetheprogram torunforawhileandthenproduceaRuntimeError:Maximumrecursiondepthexceedederror.Ifthathappens,gototheInfiniteRecursionsectionbelow.If youarenotgettingthiserrorbutyoususpectthereisaproblemwitharecursivemethodorfunction,youcanstillusethetechniquesintheInfiniteRecursion section. Ifneitherofthosestepsworks,starttestingother
en.wikibooks.org/wiki/Think_Python/Print_version
200/282
10/24/13
Nowwhenyouruntheprogram,youwillseethreelinesofoutputforeachtimethroughtheloop.Thelasttimethroughtheloop,theconditionshouldbe f a l s e . Iftheloopkeepsgoing,youwillbeabletoseethevaluesof x and y ,andyoumightfigureoutwhytheyarenotbeingupdatedcorrectly. InfiniteRecursion Mostofthetime,aninfiniterecursionwillcausetheprogramtorunforawhileandthenproducea M a x i m u mr e c u r s i o nd e p t he x c e e d e d error. Ifyoususpectthatafunctionormethodiscausinganinfiniterecursion,startbycheckingtomakesurethatthereisabasecase.Inotherwords,thereshould besomeconditionthatwillcausethefunctionormethodtoreturnwithoutmakingarecursiveinvocation.Ifnot,thenyouneedtorethinkthealgorithmand identifyabasecase. Ifthereisabasecasebuttheprogramdoesntseemtobereachingit,adda p r i n t statementatthebeginningofthefunctionormethodthatprintsthe parameters.Nowwhenyouruntheprogram,youwillseeafewlinesofoutputeverytimethefunctionormethodisinvoked,andyouwillseetheparameters. Iftheparametersarenotmovingtowardthebasecase,youwillgetsomeideasaboutwhynot. FlowofExecution Ifyouarenotsurehowtheflowofexecutionismovingthroughyourprogram,add p r i n t statementstothebeginningofeachfunctionwithamessagelike enteringfunction f o o ,where f o o isthenameofthefunction. Nowwhenyouruntheprogram,itwillprintatraceofeachfunctionasitisinvoked.
en.wikibooks.org/wiki/Think_Python/Print_version 201/282
10/24/13
WhenIruntheprogramIgetanexception.
Ifsomethinggoeswrongduringruntime,Pythonprintsamessagethatincludesthenameoftheexception,thelineoftheprogramwheretheproblem occurred,andatraceback. Thetracebackidentifiesthefunctionthatiscurrentlyrunning,andthenthefunctionthatinvokedit,andthenthefunctionthatinvoked that ,andsoon.Inother words,ittracesthesequenceoffunctioninvocationsthatgotyoutowhereyouare.Italsoincludesthelinenumberinyourfilewhereeachofthesecalls occurs. Thefirststepistoexaminetheplaceintheprogramwheretheerroroccurredandseeifyoucanfigureoutwhathappened.Thesearesomeofthemost commonruntimeerrors: NameError: Youaretryingtouseavariablethatdoesntexistinthecurrentenvironment.Rememberthatlocalvariablesarelocal.Youcannotrefertothemfrom outsidethefunctionwheretheyaredefined. TypeError: Thereareseveralpossiblecauses: Youaretryingtouseavalueimproperly.Example:indexing astring,list,ortuplewithsomethingotherthananinteger. Thereisamismatchbetweentheitemsinaformatstringand theitemspassedforconversion.Thiscanhappenifeitherthenumberofitemsdoesnotmatchoraninvalidconversioniscalledfor. Youarepassingthewrongnumberofargumentstoafunctionormethod. Formethods,lookatthemethoddefinitionandcheckthatthefirstparameteris s e l f .Thenlookatthemethodinvocationmakesureyouareinvoking themethodonanobjectwiththerighttypeandprovidingtheotherargumentscorrectly. KeyError: Youaretryingtoaccessanelementofadictionaryusingakeythatthedictionarydoesnotcontain. AttributeError: Youaretryingtoaccessanattributeormethodthatdoesnotexist.Checkthespelling!Youcanuse d i r tolisttheattributesthatdoexist.Ifan AttributeErrorindicatesthatanobjecthas N o n e T y p e ,thatmeansthatitis N o n e .Onecommoncauseisforgettingtoreturnavaluefromafunctionifyou gettotheendofafunctionwithouthittinga r e t u r n statement,itreturns N o n e .Anothercommoncauseisusingtheresultfromalistmethod,like s o r t ,that returns N o n e . IndexError: Theindexyouareusingtoaccessalist,string,ortupleisgreaterthanitslengthminusone.Immediatelybeforethesiteoftheerror,adda p r i n t statementtodisplaythevalueoftheindexandthelengthofthearray.Isthearraytherightsize?Istheindextherightvalue?
en.wikibooks.org/wiki/Think_Python/Print_version 202/282
10/24/13
ThePythondebugger(p d b )isusefulfortrackingdownExceptionsbecauseitallowsyoutoexaminethestateoftheprogramimmediatelybeforetheerror.You canreadabout p d b at d o c s . p y t h o n . o r g / l i b / m o d u l e p d b . h t m l . Iaddedsomany p r i n t statementsIgetinundatedwithoutput. Oneoftheproblemswithusing p r i n t statementsfordebuggingisthatyoucanendupburiedinoutput.Therearetwowaystoproceed:simplifytheoutputor simplifytheprogram. Tosimplifytheoutput,youcanremoveorcommentout p r i n t statementsthatarenthelping,orcombinethem,orformattheoutputsoitiseasierto understand. Tosimplifytheprogram,thereareseveralthingsyoucando.First,scaledowntheproblemtheprogramisworkingon.Forexample,ifyouaresearchingalist, searcha smalllist.Iftheprogramtakesinputfromtheuser,giveitthesimplestinputthatcausestheproblem. Second,cleanuptheprogram.Removedeadcodeandreorganizetheprogramtomakeitaseasytoreadaspossible.Forexample,ifyoususpectthatthe problemisinadeeplynestedpartoftheprogram,tryrewritingthatpartwithsimplerstructure.Ifyoususpectalargefunction,trysplittingitintosmaller functionsandtestingthemseparately.
Semanticerrors
Insomeways,semanticerrorsarethehardesttodebug,becausetheinterpreterprovidesnoinformationaboutwhatiswrong.Onlyyouknowwhatthe programissupposedtodo. Thefirststepistomakeaconnectionbetweentheprogramtextandthebehavioryouareseeing.Youneedahypothesisaboutwhattheprogramisactually doing.Oneofthethingsthatmakesthathardisthatcomputersrunsofast. Youwilloftenwishthatyoucouldslowtheprogramdowntohumanspeed,andwithsomedebuggersyoucan.Butthetimeittakestoinsertafewwellplaced p r i n t statementsisoftenshortcomparedtosettingupthedebugger,insertingandremovingbreakpoints,andsteppingtheprogramtowheretheerroris occurring.
Myprogramdoesntwork.
Youshouldaskyourselfthesequestions: Istheresomethingtheprogramwassupposedtodobut
en.wikibooks.org/wiki/Think_Python/Print_version 203/282
10/24/13
A.3.2IvegotabighairyexpressionanditdoesntdowhatIexpect.
Thiscanberewrittenas:
n e i g h b o r=s e l f . f i n d N e i g h b o r ( i ) p i c k e d C a r d=s e l f . h a n d s [ n e i g h b o r ] . p o p C a r d ( ) s e l f . h a n d s [ i ] . a d d C a r d ( p i c k e d C a r d )
Theexplicitversioniseasiertoreadbecausethevariablenamesprovideadditionaldocumentation,anditiseasiertodebugbecauseyoucancheckthetypes oftheintermediatevariablesanddisplaytheirvalues.
en.wikibooks.org/wiki/Think_Python/Print_version
204/282
10/24/13
Wheneveryouarenotsureoftheorderofevaluation,useparentheses.Notonlywilltheprogrambecorrect(inthesenseofdoingwhatyouintended),itwill alsobemorereadableforotherpeoplewhohaventmemorizedtherulesofprecedence.
A.3.3IvegotafunctionormethodthatdoesntreturnwhatIexpect.
youcouldwrite:
c o u n t=s e l f . h a n d s [ i ] . r e m o v e M a t c h e s ( ) r e t u r nc o u n t
Nowyouhavetheopportunitytodisplaythevalueof c o u n t beforereturning.
I'mreally,reallystuckandIneedhelp.
First,trygettingawayfromthecomputerforafewminutes.Computersemitwavesthataffectthebrain,causingthesesymptoms: Frustrationandrage.
en.wikibooks.org/wiki/Think_Python/Print_version 205/282
10/24/13
No,Ireallyneedhelp.
Ithappens.Eventhebestprogrammersoccasionallygetstuck.Sometimesyouworkonaprogramsolongthatyoucantseetheerror.Afreshpairofeyesis justthething. Beforeyoubringsomeoneelsein,makesureyouareprepared.Yourprogramshouldbeassimpleaspossible,andyoushouldbeworkingonthesmallest inputthatcausestheerror.Youshouldhave p r i n t statementsintheappropriateplaces(andtheoutputtheyproduceshouldbecomprehensible).Youshould understandtheproblemwellenoughtodescribeitconcisely. Whenyoubringsomeoneintohelp,besuretogivethemtheinformationtheyneed: Ifthereisanerrormessage,whatisit andwhatpartoftheprogramdoesitindicate? Whatwasthelastthingyoudidbeforethiserroroccurred? Whatwerethelastlinesofcodethatyouwrote,orwhatisthenewtestcasethatfails? Whathaveyoutriedsofar,andwhathaveyoulearned? Whenyoufindthebug,takeasecondtothinkaboutwhatyoucouldhavedonetofinditfaster.Nexttimeyouseesomethingsimilar,youwillbeabletofind thebugmorequickly. Remember,thegoalisnotjusttomaketheprogramwork.Thegoalistolearnhowtomaketheprogramwork.
Answers
Chapter1
SeebelowforChapter1exercises.
en.wikibooks.org/wiki/Think_Python/Print_version 206/282
10/24/13
Exercise1.4
Ifyouruna10kilometerracein43minutes30seconds,whatisyouraveragetimepermile?Whatisyouraveragespeedinmilesperhour?(Hint:thereare 1.61kilometersinamile).
> > >1 0 / 1 . 6 1#C o n v e r tk i l o m e t e r st om i l e s 6 . 2 1 1 1 8 0 1 2 4 2 2 3 6 0 1 8 > > >( 4 3 * 6 0 ) + 3 0#C o n v e r tt i m et os e c o n d s 2 6 1 0 > > >2 6 1 0 / 6 . 2 1 1 1 8 0 1 2 4 2 2 3 6 0 1 8#w h a ti sy o u ra v e r a g et i m e( s e c o n d s )p e rm i l e 4 2 0 . 2 1 0 0 0 0 0 0 0 0 0 0 0 4 > > >4 2 0 . 2 1 0 0 0 0 0 0 0 0 0 0 0 4 / 6 0#w h a ti sy o u ra v e r a g et i m e( m i n u t e s )p e rm i l e 7 . 0 0 3 5 0 0 0 0 0 0 0 0 0 0 0 7 > > >6 0 / 7 . 0 0 3 5 0 0 0 0 0 0 0 0 0 0 0 7#M i l e sp e rh o u r 8 . 5 6 7 1 4 4 9 9 8 9 2 9 1 0 5 5
Comment:Thisisnotvalid,it ONLY worksfor43minand30secondsto10km's.Pythonshouldhaveawaytodothistheproperway. Inordertodothistheproperway,apersonmustdosomethinglikethis. 43*60>converttheminutestoseconds. 2580+30>addtheseconds 2610/10>dividebydistance 261/60>changesecondsintominutes 4.35>istheanswer,nowyoumust .35*60>multiplythenumberafterthedecimalwith60 21seconds.. Endresult=4.21minutesperKM,thistechniqueworksforalldistancesandtimes.
Chapter2
Exercise2.1
Ifyoutypeanintegerwithaleadingzero,youmightgetaconfusingerror:
> > >z i p c o d e=0 2 4 9 2 ^ S y n t a x E r r o r :i n v a l i dt o k e n
Othernumberseemtowork,buttheresultsarebizarre:
> > >z i p c o d e=0 2 1 3 2 > > >p r i n tz i p c o d e 1 1 1 4
en.wikibooks.org/wiki/Think_Python/Print_version 207/282
10/24/13
Exercise2.4
Thevolumeofaspherewithradius ris 4/3 r3. Whatisthevolumeofaspherewithradius5?
> > >p i=3 . 1 4 1 5 9 2 6 5 3 5 8 9 7 9 3 1 > > >r=5 > > >4 / 3 * p i * r * * 3#T h i si st h ew r o n ga n s w e r 3 9 2 . 6 9 9 0 8 1 6 9 8 7 2 4 1 1 > > >r=5 . 0#R a d i u sc a nb eaf l o a th e r ea sw e l l ,b u ti sn o t_ n e c e s s a r y _ . > > >4 . 0 / 3 . 0 * p i * r * * 3#U s i n gf l o a t sg i v et h ec o r r e c ta n s w e r 5 2 3 . 5 9 8 7 7 5 5 9 8 2 9 8 8 6 > > >
Supposethecoverpriceofabookis$24.95,butbookstoresgeta40%discount.Shippingcosts$3forthefirstcopyand75centsforeachadditionalcopy. Whatisthetotalwholesalecostfor60copies?
$ 2 4 . 9 5 $ 9 . 9 8 $ 1 4 . 9 7 6 0 $ 8 9 8 . 2 0 C o s t D i s c o u n tp e rb o o k C o s tp e rb o o ka f t e rd i s c o u n t T o t a ln u m b e ro fb o o k s T o t a lc o s tn o ti n cd e l i v e r y
$ 3 . 0 0 F i r s tb o o kd e l i v e r y 5 9 R e m a i n i n gb o o k s
en.wikibooks.org/wiki/Think_Python/Print_version 208/282
10/24/13
Chapter3
Exercise3.3
Pythonprovidesabuiltinfunctioncalled lenthatreturnsthelengthofastring,sothevalueoflen('allen')is5.Writeafunctionnamedright_justifythattakesa stringnamed sasaparameterandprintsthestringwithenoughleadingspacessothatthelastletterofthestringisincolumn70ofthedisplay.
> > >d e fr i g h t _ j u s t i f y ( s ) : . . . p r i n t( '' * ( 7 0 l e n ( s ) ) + s ) . . . > > >r i g h t _ j u s t i f y ( ' a l l e n ' ) a l l e n > > >
Exercise3.5
en.wikibooks.org/wiki/Think_Python/Print_version 209/282
10/24/13
Youcanseemysolutionat[http://thinkpython.com/code/grid.py].
" " " S o l u t i o nt oE x e r c i s eX . Xo np a g eXo fT h i n kP y t h o n A l l e nB .D o w n e y " " " #h e r ei sam o s t l y s t r a i g h t f o r w a r ds o l u t i o nt ot h e #t w o b y t w ov e r s i o no ft h eg r i d . d e fd o _ t w i c e ( f ) : f ( ) f ( ) d e fd o _ f o u r ( f ) : d o _ t w i c e ( f ) d o _ t w i c e ( f ) d e fp r i n t _ b e a m ( ) : p r i n t' +---' , d e fp r i n t _ p o s t ( ) : p r i n t' | ' , d e fp r i n t _ b e a m s ( ) : d o _ t w i c e ( p r i n t _ b e a m ) p r i n t' + ' d e fp r i n t _ p o s t s ( ) : d o _ t w i c e ( p r i n t _ p o s t ) p r i n t' | ' d e fp r i n t _ r o w ( ) : p r i n t _ b e a m s ( ) d o _ f o u r ( p r i n t _ p o s t ) d e fp r i n t _ g r i d ( ) : d o _ t w i c e ( p r i n t _ r o w ) p r i n t _ b e a m s ( ) p r i n t _ g r i d ( ) _ _ _ _ _ _ _ _ _ _ _ _ # a n o t h e rs o l u t i o n d e fd o _ t w i c e ( f ) : f ( ) f ( ) d e fd o _ f o u r ( f ) : d o _ t w i c e ( f ) d o _ t w i c e ( f ) d e fp r i n t _ c o l u m n ( ) :
en.wikibooks.org/wiki/Think_Python/Print_version 210/282
10/24/13
d e fp r i n t _ r o w s ( ) : d o _ f o u r ( p r i n t _ r o w ) d e fd o _ b l o c k ( ) : p r i n t _ c o l u m n ( ) p r i n t _ r o w s ( ) d e fp r i n t _ b l o c k ( ) : d o _ t w i c e ( d o _ b l o c k ) p r i n t _ c o l u m n ( ) p r i n t _ b l o c k ( ) # n a t h a nm o s e s g o n z a l e s _ _ _ _ _ _ _ _ _ #h e r ei sal e s s s t r a i g h t f o r w a r ds o l u t i o nt ot h e #f o u r b y f o u rg r i d d e fo n e _ f o u r _ o n e ( f ,g ,h ) : f ( ) d o _ f o u r ( g ) h ( ) d e fp r i n t _ p l u s ( ) : p r i n t' + ' , d e fp r i n t _ d a s h ( ) : p r i n t' ' , d e fp r i n t _ b a r ( ) : p r i n t' | ' , d e fp r i n t _ s p a c e ( ) : p r i n t'' , d e fp r i n t _ e n d ( ) : p r i n t d e fn o t h i n g ( ) : " d on o t h i n g " d e fp r i n t 1 b e a m ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t _ d a s h ,p r i n t _ p l u s ) d e fp r i n t 1 p o s t ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t _ s p a c e ,p r i n t _ b a r ) d e fp r i n t 4 b e a m s ( ) : o n e _ f o u r _ o n e ( p r i n t _ p l u s ,p r i n t 1 b e a m ,p r i n t _ e n d )
en.wikibooks.org/wiki/Think_Python/Print_version 211/282
10/24/13
d e fp r i n t 4 p o s t s ( ) : o n e _ f o u r _ o n e ( p r i n t _ b a r ,p r i n t 1 p o s t ,p r i n t _ e n d ) d e fp r i n t _ r o w ( ) : o n e _ f o u r _ o n e ( n o t h i n g ,p r i n t 4 p o s t s ,p r i n t 4 b e a m s ) d e fp r i n t _ g r i d ( ) : o n e _ f o u r _ o n e ( p r i n t 4 b e a m s ,p r i n t _ r o w ,n o t h i n g ) p r i n t _ g r i d ( ) c o m m e n t=" " " A f t e rw r i t i n gad r a f to ft h e4 x 4g r i d ,In o t i c e dt h a tm a n yo ft h e f u n c t i o n sh a dt h es a m es t r u c t u r e :t h e yw o u l dd os o m e t h i n g ,d o s o m e t h i n ge l s ef o u rt i m e s ,a n dt h e nd os o m e t h i n ge l s eo n c e . S oIw r o t eo n e _ f o u r _ o n e ,w h i c ht a k e st h r e ef u n c t i o n sa sa r g u m e n t s ;i t c a l l st h ef i r s to n eo n c e ,t h e nu s e sd o _ f o u rt oc a l lt h es e c o n do n e f o u rt i m e s ,t h e nc a l l st h et h i r d . T h e nIr e w r o t ep r i n t 1 b e a m ,p r i n t 1 p o s t ,p r i n t 4 b e a m s ,p r i n t 4 p o s t s , p r i n t _ r o wa n dp r i n t _ g r i du s i n go n e _ f o u r _ o n e . P r o g r a m m i n gi sa ne x p l o r a t o r yp r o c e s s . W r i t i n gad r a f to fap r o g r a m o f t e ng i v e sy o ui n s i g h ti n t ot h ep r o b l e m ,w h i c hm i g h tl e a dy o ut o r e w r i t et h ec o d et or e f l e c tt h es t r u c t u r eo ft h es o l u t i o n . -A l l e n " " " p r i n tc o m m e n t
Chapter9
Exercise9.1
f i n=o p e n ( ' w o r d s . t x t ' ) f o rl i n ei nf i n : w o r d=l i n e . s t r i p ( ) i fl e n ( w o r d )> =2 0 : p r i n t( w o r d )
Chapter10
Exercise10.1
Writeafunctionthattakesalistofnumbersandreturnsthecumulativesumthatis,anewlistwheretheithelementisthesumofthefirsti+1elementsfrom theoriginallist.Forexample,thecumulativesumof[1,2,3]is[1,3,6].
en.wikibooks.org/wiki/Think_Python/Print_version 212/282
10/24/13
Exercise10.2
Writeafunctioncalledchopthattakesalistandmodifiesit,removingthefirstandlastelements,andreturnsNone.
> > >d e fc h o p ( x ) : d e lx [ : 1 ] d e lx [ 1 : ]
Thenwriteafunctioncalledmiddlethattakesalistandreturnsanewlistthatcontainsallbutthefirstandlastelements.
> > >d e fm i d d l e ( x ) : r e s=[ ] i=1 w h i l ei< =l e n ( x ) 2 : r e s . a p p e n d ( x [ i ] ) i+ =1 r e t u r nr e s
Thiscanalsobedonesimplywithaslice.
> > >d e fm i d d l e ( x ) : r e t u r nx [ 1 : 1 ]
Chapter11
Exercise11.1
Writeafunctionthatreadsthewordsinwords.txtandstoresthemaskeysinadictionary.Itdoesntmatterwhatthevaluesare.Thenyoucanusethein operatorasafastwaytocheckwhetherastringisinthedictionary.
e n g l i s h d i c t i o n a r y=d i c t ( )
en.wikibooks.org/wiki/Think_Python/Print_version 213/282
10/24/13
Exercise11.2
d e fh i s t o g r a m ( s ) : d=d i c t ( ) f o rci ns : d [ c ]=1+d . g e t ( c ,0 ) r e t u r nd
Exercise11.3
Dictionarieshaveamethodcalledkeysthatreturnsthekeysofthedictionary,innoparticularorder,asalist.Modifyprint_histtoprintthekeysandtheir valuesinalphabeticalorder.
v={ ' p ':1 ,' a ':1 ,' r ':2 ,' o ':1 ,' t ':1 } d e fp r i n t _ h i s t ( h ) : x=h . k e y s ( ) y=l i s t ( x ) y . s o r t ( ) f o rci ny : p r i n t ( c ,h [ c ] )
Exercise11.4
d e fr e v e r s e _ l o o k u p ( d , v ) : l=l i s t ( ) f o rci nd : i fd [ c ]= =v : l . a p p e n d ( c ) r e t u r nl
Chapter12
Exercise12.1
en.wikibooks.org/wiki/Think_Python/Print_version 214/282
10/24/13
or
d e fs u m a l l ( * t ) : x=0 f o rii nr a n g e ( l e n ( t ) ) : x+ =t [ i ] r e t u r nx
or
d e fs u m a l l ( * a r g s ) : t=l i s t ( a r g s ) r e t u r ns u m ( t )
Exercise12.2
i m p o r tr a n d o m d e fs o r t _ b y _ l e n g t h ( w o r d s ) : t=[ ] f o rw o r di nw o r d s : t . a p p e n d ( ( l e n ( w o r d ) , w o r d ) ) t . s o r t ( r e v e r s e = T r u e ) r e s=[ ] f o rl e n g t h ,w o r di nt : r e s . a p p e n d ( w o r d ) i = 0 f i n a l=[ ] w h i l ei< =l e n ( r e s ) 2 : i fl e n ( r e s [ i ] )= =l e n ( r e s [ i + 1 ] ) : y _ l i s t=[ r e s [ i ] ,r e s [ i + 1 ] ] r a n d o m . s h u f f l e ( y _ l i s t ) f i n a l=f i n a l+y _ l i s t i+ =2 e l s e : f i n a l . a p p e n d ( r e s [ i ] ) i+ =1 i fi= =l e n ( r e s ) 1 : f i n a l . a p p e n d ( r e s [ i ] ) r e t u r nf i n a l
en.wikibooks.org/wiki/Think_Python/Print_version 215/282
10/24/13
or
f r o mr a n d o mi m p o r ts h u f f l e d e fs o r t _ b y _ l e n g t h ( w o r d s ) : r=[ ] d=d i c t ( ) f o rw o r di nw o r d s : d . s e t d e f a u l t ( l e n ( w o r d ) ,[ ] ) . a p p e n d ( w o r d ) f o rk e yi ns o r t e d ( d ,r e v e r s e = T r u e ) : i fl e n ( d [ k e y ] )>1 : s h u f f l e ( d [ k e y ] ) r . e x t e n d ( d [ k e y ] ) r e t u r nr
Exercise12.3
i m p o r ts t r i n g d e fm o s t _ f r e q u e n t ( s ) : d=d i c t ( ) i n v=d i c t ( ) f o rc h a ri ns : i fc h a ri ns t r i n g . a s c i i _ l e t t e r s : l e t t e r=c h a r . l o w e r ( ) d [ l e t t e r ]=d . g e t ( l e t t e r ,0 )+1 f o rl e t t e r ,f r e qi nd . i t e m s ( ) : i n v . s e t d e f a u l t ( f r e q ,[ ] ) . a p p e n d ( l e t t e r ) f o rf r e qi ns o r t e d ( i n v ,r e v e r s e = T r u e ) : p r i n t ( ' { : . 2 % } : ' . f o r m a t ( f r e q / ( s u m ( l i s t ( i n v ) * l e n ( i n v [ f r e q ] ) ) ) ) ,' ,' . j o i n ( i n v [ f r e q ] ) )
Chapter13
Exercise13.7
f r o ms t r i n gi m p o r tp u n c t u a t i o n ,w h i t e s p a c e ,d i g i t s f r o mr a n d o mi m p o r tr a n d i n t f r o mb i s e c ti m p o r tb i s e c t _ l e f t d e fp r o c e s s _ f i l e ( f i l e n a m e ) : h=d i c t ( ) f p=o p e n ( f i l e n a m e ) f o rl i n ei nf p : p r o c e s s _ l i n e ( l i n e ,h )
en.wikibooks.org/wiki/Think_Python/Print_version 216/282
10/24/13
r e t u r nh d e fp r o c e s s _ l i n e ( l i n e ,h ) : l i n e=l i n e . r e p l a c e ( ' ' ,'' ) f o rw o r di nl i n e . s p l i t ( ) : w o r d=w o r d . s t r i p ( p u n c t u a t i o n+w h i t e s p a c e+d i g i t s ) w o r d=w o r d . l o w e r ( ) i fw o r d! =' ' : h [ w o r d ]=h . g e t ( w o r d ,0 )+1 h i s t=p r o c e s s _ f i l e ( ' e m m a . t x t ' ) d e fc u m _ s u m ( l i s t _ o f _ n u m b e r s ) : c u m _ l i s t=[ ] f o ri ,e l e mi ne n u m e r a t e ( l i s t _ o f _ n u m b e r s ) : i fi= =0 : c u m _ l i s t . a p p e n d ( e l e m ) e l s e : c u m _ l i s t . a p p e n d ( c u m _ l i s t [ i 1 ]+e l e m ) r e t u r nc u m _ l i s t d e fr a n d o m _ w o r d ( h ) : w o r d _ l i s t=l i s t ( h . k e y s ( ) ) n u m _ l i s t=[ ] f o rw o r di nw o r d _ l i s t : n u m _ l i s t . a p p e n d ( h [ w o r d ] ) c u m _ l i s t=c u m _ s u m ( n u m _ l i s t ) i=r a n d i n t ( 1 ,c u m _ l i s t [ 1 ] ) p o s=b i s e c t _ l e f t ( c u m _ l i s t ,i ) r e t u r nw o r d _ l i s t [ p o s ] p r i n t ( r a n d o m _ w o r d ( h i s t ) )
Chapter14
Exercise14.3
i m p o r ts h e l v e d e fd i c t _ o f _ s i g n a t u r e s _ a n d _ w o r d s ( f i l e n a m e = ' w o r d s . t x t ' ) : d=d i c t ( ) f o rl i n ei no p e n ( f i l e n a m e ) : w o r d=l i n e . l o w e r ( ) . s t r i p ( ) s i g n a t u r e=' ' . j o i n ( s o r t e d ( w o r d ) ) d . s e t d e f a u l t ( s i g n a t u r e ,[ ] ) . a p p e n d ( w o r d ) r e t u r nd d e fd b _ o f _ a n a g r a m s ( f i l e n a m e = ' a n a g r a m s ' ,d = d i c t _ o f _ s i g n a t u r e s _ a n d _ w o r d s ( ) ) : d b=s h e l v e . o p e n ( f i l e n a m e ) f o rk e y ,v a l u e si nd . i t e m s ( ) : i fl e n ( v a l u e s ) > 1 : f o ri n d e x ,v a l u ei ne n u m e r a t e ( v a l u e s ) :
en.wikibooks.org/wiki/Think_Python/Print_version 217/282
10/24/13
d b [ v a l u e ] = v a l u e s [ : i n d e x ] + v a l u e s [ i n d e x + 1 : ] d b . c l o s e ( ) d e fp r i n t _ c o n t e n t s _ o f _ d b ( f i l e n a m e = ' a n a g r a m s ' ) : d b=s h e l v e . o p e n ( f i l e n a m e ,f l a g = ' r ' ) f o rk e yi ns o r t e d ( d b ) : p r i n t ( k e y . r j u s t ( 1 2 ) ,' \ t < = = > \ t ' ,' ,' . j o i n ( d b [ k e y ] ) ) d b . c l o s e ( ) d b _ o f _ a n a g r a m s ( ) p r i n t _ c o n t e n t s _ o f _ d b ( )
Exercise14.5
#R e p l a c eu r l l i b . r e q u e s tw i t hu r l l i bi fy o uu s eP y t h o n2 . #Iw o u l dl o v et os e eam o r ee l e g a n ts o l u t i o nf o rt h i se x e r c i s e ,p o s s i b l yb ys o m e o n ew h ou n d e r s t a n d sh t m l . i m p o r tu r l l i b . r e q u e s t d e fc h e c k ( z i p _ c o d e ) : i fz i p _ c o d e= =' d o n e ' : r e t u r nb r e a k i fl e n ( z i p _ c o d e )! =5 : p r i n t ( ' \ n T h ez i pc o d em u s th a v ef i v ed i g i t s ! ' ) r e t u r nc o n t i n u e d e fg e t _ h t m l ( z i p _ c o d e ) : g i b b e r i s h=u r l l i b . r e q u e s t . u r l o p e n ( ' h t t p : / / w w w . u s z i p . c o m / z i p / '+z i p _ c o d e ) l e s s _ g i b=g i b b e r i s h . r e a d ( ) . d e c o d e ( ' u t f 8 ' ) r e t u r nl e s s _ g i b d e fe x t r a c t _ t r u t h ( c o d e ,k e y ,d e l i m i t e r ) : p o s=c o d e . f i n d ( k e y )+l e n ( k e y ) n e a r l y _ t r u e=c o d e [ p o s : p o s + 4 0 ] t r u t h=n e a r l y _ t r u e . s p l i t ( d e l i m i t e r ) [ 0 ] r e t u r nt r u t h w h i l eT r u e : z i p _ c o d e=i n p u t ( ' P l e a s et y p eaz i pc o d e( 5d i g i t s )o r" d o n e "i fw a n tt os t o p : \ n ' ) c h e c k ( z i p _ c o d e ) c o d e=g e t _ h t m l ( z i p _ c o d e ) i n v a l i d _ k e y=' ( 0r e s u l t s ) ' i fi n v a l i d _ k e yi nc o d e : p r i n t ( ' \ n N o tav a l i dz i pc o d e . ' ) c o n t i n u e n a m e _ k e y=' z i pc o d eo f< s t r o n g > ' n a m e _ d e l=' < ' n a m e=e x t r a c t _ t r u t h ( c o d e ,n a m e _ k e y ,n a m e _ d e l )
en.wikibooks.org/wiki/Think_Python/Print_version 218/282
10/24/13
p o p _ k e y=' P o p u l a t i o n : < / b > < / t d > < t d > ' p o p _ d e l='< ' n a m e=e x t r a c t _ t r u t h ( c o d e ,p o p _ k e y ,p o p _ d e l ) i fn o t1<l e n ( p o p )<9 : p o p=' n o ta v a i l a b l e ' p r i n t ( ' \ n '+n a m e ) p r i n t ( ' P o p u l a t i o n : ' ,p o p ,' \ n ' )
Chapter15
Exercise15.1
i m p o r tm a t h c l a s sP o i n t ( o b j e c t ) : " " " r e p r e s e n t sap o i n ti n2 Ds p a c e " " " d e fd i s t a n c e ( p 1 ,p 2 ) : d i s t a n c e=m a t h . s q r t ( ( p 2 . x-p 1 . x ) * * 2+( p 2 . y-p 1 . y ) * * 2 ) r e t u r nd i s t a n c e p 1=P o i n t ( ) p 2=P o i n t ( ) p 1 . x=3 p 1 . y=2 p 2 . x=4 p 2 . y=3 p r i n t ( d i s t a n c e ( p 1 ,p 2 ) )
Chapter16
Exercise16.1
d e fp r i n t _ t i m e ( t ) : p r i n t' % . 2 d : % . 2 d : % . 2 d '%( t . h o u r ,t . m i n u t e ,t . s e c o n d )
or
#S o l u t i o nf o rP y t h o n 3 #M o r eo ns t r i n gf o r m a t t i n g :h t t p : / / d o c s . p y t h o n . o r g / p y 3 k / l i b r a r y / s t r i n g . h t m l # f o r m a t s p e c
en.wikibooks.org/wiki/Think_Python/Print_version 219/282
10/24/13
Exercise16.2
d e fi s _ a f t e r ( t 1 ,t 2 ) : r e t u r n( t 1 . h o u r ,t 1 . m i n u t e ,t 1 . s e c o n d )>( t 2 . h o u r ,t 2 . m i n u t e ,t 2 . s e c o n d )
Exercise16.3
#C o m m e n tn o tb yt h ea u t h o r :T h i sw i l lg i v eaw r o n gr e s u l t ,i f( t i m e . s e c o n d+s e c o n d s%6 0 )>6 0 d e fi n c r e m e n t ( t i m e ,s e c o n d s ) : n=s e c o n d s / 6 0 t i m e . s e c o n d+ =s e c o n d s-6 0 . 0 * n t i m e . m i n u t e+ =n m=t i m e . m i n u t e / 6 0 t i m e . m i n u t e=m * 6 0 t i m e . h o u r+ =m
or
#S o l u t i o nf o rP y t h o n 3 #R e p l a c e' / / 'b y' / 'f o rP y t h o n 2 d e fi n c r e m e n t ( t i m e ,s e c o n d s ) : t i m e . s e c o n d+ =s e c o n d s t i m e . m i n u t e+ =t i m e . s e c o n d / / 6 0 t i m e . h o u r+ =t i m e . m i n u t e / / 6 0 t i m e . s e c o n d% =6 0 t i m e . m i n u t e% =6 0 t i m e . h o u r% =2 4
Exercise16.4
#S o l u t i o nf o rP y t h o n 3 #R e p l a c e' / / 'b y' / 'f o rP y t h o n 2 f r o mc o p yi m p o r td e e p c o p y d e fi n c r e m e n t ( t i m e ,s e c o n d s ) :
en.wikibooks.org/wiki/Think_Python/Print_version 220/282
10/24/13
r=d e e p c o p y ( t i m e ) r . s e c o n d+ =s e c o n d s r . m i n u t e+ =r . s e c o n d / / 6 0 r . h o u r+ =r . m i n u t e / / 6 0 r . s e c o n d% =6 0 r . m i n u t e% =6 0 r . h o u r% =2 4 r e t u r nr
Exercise16.5
c l a s sT i m e ( o b j e c t ) : " " " r e p r e s e n t st h et i m eo fd a y . a t t r i b u t e s :h o u r ,m i n u t e ,s e c o n d " " " t i m e=T i m e ( ) t i m e . h o u r=1 1 t i m e . m i n u t e=5 9 t i m e . s e c o n d=3 0 d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e s e c o n d s=m i n u t e s*6 0+t i m e . s e c o n d r e t u r ns e c o n d s d e fi n t _ t o _ t i m e ( s e c o n d s ) : t i m e=T i m e ( ) m i n u t e s ,t i m e . s e c o n d=d i v m o d ( s e c o n d s ,6 0 ) t i m e . h o u r ,t i m e . m i n u t e=d i v m o d ( m i n u t e s ,6 0 ) r e t u r nt i m e d e fi n c r e m e n t ( t i m e ,a d d t i m e ) : s e c o n d s=t i m e _ t o _ i n t ( t i m e ) r e t u r ni n t _ t o _ t i m e ( s e c o n d s+a d d t i m e ) d e fp r i n t _ t i m e( x ) : p r i n t' T h et i m ei s% . 2 d:% . 2 d:% . 2 d '%( x . h o u r ,x . m i n u t e ,x . s e c o n d ) p r i n t _ t i m e( t i m e ) n e w t i m e=i n c r e m e n t( t i m e ,7 0 ) p r i n t _ t i m e( n e w t i m e )
Exercise16.6
d e ft i m e _ t o _ i n t ( t i m e ) : m i n u t e s=t i m e . h o u r*6 0+t i m e . m i n u t e
en.wikibooks.org/wiki/Think_Python/Print_version 221/282
10/24/13
Exercise16.7
WriteaclassdefinitionforaDateobjectthathasattributes day, monthand year.Writeafunctioncalled increment_datethattakesaDateobject, date,andan integer, n,andreturnsanewDateobjectthatrepresentstheday ndaysafter date.Hint:ThirtydayshathSeptember...Challenge:doesyourfunctiondeal withleapyearscorrectly?See wikipedia.org/wiki/Leap_year.
c l a s sD a t e ( o b j e c t ) : " " " r e p r e s e n t sad a t e . a t t r i b u t e s :d a y ,m o n t h ,y e a r " " " d e fp r i n t _ d a t e ( d a t e ) : #G e r m a nd a t ef o r m a t p r i n t ( ' { } . { } . { } ' . f o r m a t ( d a t e . d a y ,d a t e . m o n t h ,d a t e . y e a r ) ) d e fi s _ l e a p _ y e a r ( y e a r ) : #h t t p : / / e n . w i k i p e d i a . o r g / w i k i / L e a p _ y e a r # A l g o r i t h m i fy e a r%4= =0 : i fy e a r%1 0 0= =0 : i fy e a r%4 0 0= =0 : r e t u r nT r u e r e t u r nF a l s e r e t u r nT r u e r e t u r nF a l s e d e fm o n t h _ l i s t ( y e a r ) : i fi s _ l e a p _ y e a r ( y e a r ) : r e t u r n[ 3 1 ,2 9 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ] r e t u r n[ 3 1 ,2 8 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ,3 1 ,3 0 ,3 1 ,3 0 ,3 1 ] d e fd a y s _ o f _ y e a r ( y e a r ) : i fi s _ l e a p _ y e a r ( y e a r ) : r e t u r n3 6 6
en.wikibooks.org/wiki/Think_Python/Print_version 222/282
10/24/13
r e t u r n3 6 5 d e fd a t e _ t o _ i n t ( d a t e ) : d a y s=0 f o ry e a ri nr a n g e ( 1 ,d a t e . y e a r ) : d a y s+ =d a y s _ o f _ y e a r ( y e a r ) m o n t h _ d a y s=m o n t h _ l i s t ( d a t e . y e a r ) f o rm o n t hi nr a n g e ( 1 ,d a t e . m o n t h ) : d a y s+ =m o n t h _ d a y s [ m o n t h-1 ] d a y s+ =d a t e . d a y-1 r e t u r nd a y s d e fi n t _ t o _ d a t e ( d a y s ) : d a t e=D a t e ( ) d a t e . y e a r=1 n e x t _ d a y s=3 6 5 w h i l ed a y s> =n e x t _ d a y s : d a t e . y e a r+ =1 d a y s=n e x t _ d a y s n e x t _ d a y s=d a y s _ o f _ y e a r ( d a t e . y e a r ) d a t e . m o n t h=1 n e x t _ d a y s=3 1 m o n t h _ d a y s=m o n t h _ l i s t ( d a t e . y e a r ) w h i l ed a y s> =n e x t _ d a y s : d a t e . m o n t h+ =1 d a y s=n e x t _ d a y s n e x t _ d a y s=m o n t h _ d a y s [ d a t e . m o n t h-1 ] d a t e . d a y=d a y s+1 r e t u r nd a t e d e fi n c r e m e n t _ d a t e ( d a t e ,n ) : d a y s=d a t e _ t o _ i n t ( d a t e ) r e t u r ni n t _ t o _ d a t e ( d a y s+n ) d 1=D a t e ( ) d 1 . d a y ,d 1 . m o n t h ,d 1 . y e a r=8 ,3 ,2 0 1 2 p r i n t _ d a t e ( d 1 ) d 2=i n c r e m e n t _ d a t e ( d 1 ,7 ) p r i n t _ d a t e ( d 2 )
Exercise16.8
1.Usethe datetimemoduletowriteaprogramthatgetsthecurrentdateandprintsthedayoftheweek.
f r o md a t e t i m ei m p o r td a t e d e fc u r r e n t _ w e e k d a y ( ) :
en.wikibooks.org/wiki/Think_Python/Print_version 223/282
10/24/13
i=d a t e . t o d a y ( ) . w e e k d a y ( ) p r i n t ( [ ' M o n d a y ' ,' T u e s d a y ' ,' W e d n e s d a y ' ,' T h u r s d a y ' ,' F r i d a y ' ,' S a t u r d a y ' ,' S u n d a y ' ] [ i ] ) c u r r e n t _ w e e k d a y ( )
2.Writeaprogramthattakesabirthdayasinputandprintstheusersageandthenumberofdays,hours,minutesandsecondsuntiltheirnextbirthday.
#P y t h o n 3s o l u t i o n .R e p l a c e" i n p u t "b y" r a w _ i n p u t "f o rP y t h o n 2 . f r o md a t e t i m ei m p o r td a t e t i m e d e ft i m e _ u n t i l _ b i r t h d a y ( ) : d o b _ i n p u t=i n p u t ( ( ' P l e a s ee n t e rt h ed a t eo fy o u rb i r t hi n' ' t h ef o r m a t" m m / d d / y y y y " :' ) ) d o b=d a t e t i m e . s t r p t i m e ( d o b _ i n p u t ,' % m / % d / % Y ' ) n o w=d a t e t i m e . n o w ( ) i fn o w>d a t e t i m e ( n o w . y e a r ,d o b . m o n t h ,d o b . d a y ) : a g e=n o w . y e a r-d o b . y e a r n e x t _ y e a r=T r u e e l s e : a g e=n o w . y e a r-d o b . y e a r-1 n e x t _ y e a r=F a l s e t i m e _ t o _ b i r t h d a y=d a t e t i m e ( n o w . y e a r+n e x t _ y e a r , d o b . m o n t h ,d o b . d a y )-n o w d a y s=t i m e _ t o _ b i r t h d a y . d a y s h o u r s ,r e m a i n d e r=d i v m o d ( t i m e _ t o _ b i r t h d a y . s e c o n d s ,3 6 0 0 ) m i n u t e s ,s e c o n d s=d i v m o d ( r e m a i n d e r ,6 0 ) p r i n t ( " \ n Y o ua r e{ }y e a r so l d . " . f o r m a t ( a g e ) ) p r i n t ( ( " Y o uh a v e{ 0 }d a y s ,{ 1 }h o u r s ,{ 2 }m i n u t e sa n d{ 3 }" " s e c o n d sl e f tu n t i ly o u rn e x tb i r t h d a y . " ) . f o r m a t ( d a y s ,h o u r s ,m i n u t e s ,s e c o n d s ) ) t i m e _ u n t i l _ b i r t h d a y ( )
Chapter17
Exercise17.8
2.
f r o mv i s u a li m p o r ts c e n e ,s p h e r e s c e n e . r a n g e=( 2 5 6 ,2 5 6 ,2 5 6 ) s c e n e . c e n t e r=( 1 2 8 ,1 2 8 ,1 2 8 ) t=r a n g e ( 0 ,2 5 6 ,5 1 ) f o rxi nt : f o ryi nt : f o rzi nt : p o s=x ,y ,z
en.wikibooks.org/wiki/Think_Python/Print_version 224/282
10/24/13
c o l o r=( x / 2 5 5 . ,y / 2 5 5 . ,z / 2 5 5 . ) s p h e r e ( p o s = p o s ,r a d i u s = 1 0 ,c o l o r = c o l o r )
Chapter3.5
calculator
# r e c u r s i o no rr e c u r s i v e p r i n t" \ n I N D E X \ n " " \ n C = 1f o ra d d i t i o n \ n " " \ n C = 2f o rs u b s t r a c t i o n \ n " " \ n C = 3f o rm u l t i p l i c a t i o n \ n " " \ n C = 4f o rd i v i s i o n \ n " " \ n C = 5f o rt of i n dm o d u l u s \ n " " \ n C = 6t of i n df a c t o r i a l \ n " C = i n p u t ( " E n t e ry o u rc h o i c eh e r e :" ) d e fa d d ( x , y ) : c = x + y
en.wikibooks.org/wiki/Think_Python/Print_version 225/282
10/24/13
p r i n tx , " + " , y , " = " , c d e fs u b ( x , y ) : c = x y p r i n tx , " " , y , " = " , c d e fm u l ( x , y ) : c = x * y p r i n tx , " * " , y , " = " , c d e fd i v ( x , y ) : c = x / y p r i n tx , " / " , y , " = " , c d e fm o d ( x , y ) : c = x % y p r i n tx , " % " , y , " = " , c i fC = = 6 : d e ff ( n ) : i fn = = 1 : p r i n tn r e t u r nn e l s e : p r i n tn , " * " , r e t u r nn * f ( n 1 ) n = i n p u t ( " e n t e ry o u rn oh e r e :" ) p r i n tf ( n ) i fC = = 1 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) a d d ( a , b ) e l i fC = = 2 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) s u b ( a , b ) e l i fC = = 3 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) m u l ( a , b ) e l i fC = = 4 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) d i v ( a , b ) e l i fC = = 5 : a = i n p u t ( " E n t e ry o u rf i r s tn oh e r e :" ) b = i n p u t ( " E n t e ry o u rs e c o n dn oh e r e :" ) m o d ( a , b )
palindrome
d e ff i r s t ( w o r d ) : r e t u r nw o r d [ 0 ] d e fl a s t ( w o r d ) : r e t u r nw o r d [ 1 ] d e fm i d d l e ( w o r d ) : r e t u r nw o r d [ 1 : 1 ] d e fp a l i n d r o m e ( w o r d ) :
en.wikibooks.org/wiki/Think_Python/Print_version 226/282
10/24/13
sumofalldigits
d e fs u m _ o f _ n _ n u m b e r s ( n u m b e r ) : i f ( n u m b e r = = 0 ) : r e t u r n0 e l s e : r e t u r nn u m b e r+s u m _ o f _ n _ n u m b e r s ( n u m b e r 1 ) n u m=r a w _ i n p u t ( " E n t e ran u m b e r : " ) n u m = i n t ( n u m ) s u m=s u m _ o f _ n _ n u m b e r s ( n u m ) p r i n ts u m # # # a n o t h e ra n s w e ri nc a s eo fw h i l el o o p s d e fs u m _ o f _ D i g i t s ( n u m b e r ) : s u m = 0 w h i l en u m b e r > 0 : d i g i t = n u m b e r % 1 0 s u m = s u m + d i g i t n u m b e r = n u m b e r / 1 0 r e t u r ns u m n u m = r a w _ i n p u t ( " e n t e rt h en u m b e r " ) n u m = i n t ( n u m ) s u m _ o f _ d i g i t s = s u m _ o f _ D i g i t s ( n u m ) p r i n ts u m _ o f _ d i g i t s
Exercise18.5
c l a s sC a r d ( o b j e c t ) : s u i t _ n a m e s=[ ' C l u b s ' ,' D i a m o n d s ' ,' H e a r t s ' ,' S p a d e s ' ] r a n k _ n a m e s=[ N o n e ,' A c e ' ,' 2 ' ,' 3 ' ,' 4 ' ,' 5 ' ,' 6 ' ,' 7 ' , ' 8 ' ,' 9 ' ,' 1 0 ' ,' J a c k ' ,' Q u e e n ' ,' K i n g ' ] d e f_ _ i n i t _ _ ( s e l f ,s u i t=0 ,r a n k=2 ) : s e l f . s u i t=s u i t s e l f . r a n k=r a n k
en.wikibooks.org/wiki/Think_Python/Print_version 227/282
10/24/13
d e f_ _ s t r _ _ ( s e l f ) : r e t u r n' % so f% s '%( C a r d . r a n k _ n a m e s [ s e l f . r a n k ] , C a r d . s u i t _ n a m e s [ s e l f . s u i t ] ) d e f_ _ c m p _ _ ( s e l f ,o t h e r ) : c 1=( s e l f . s u i t ,s e l f . r a n k ) c 2=( o t h e r . s u i t ,o t h e r . r a n k ) r e t u r nc m p ( c 1 ,c 2 ) d e fi s _ v a l i d ( s e l f ) : r e t u r ns e l f . r a n k>0 c l a s sD e c k ( o b j e c t ) : d e f_ _ i n i t _ _ ( s e l f ,l a b e l=' D e c k ' ) : s e l f . l a b e l=l a b e l s e l f . c a r d s=[ ] f o rii nr a n g e ( 4 ) : f o rki nr a n g e ( 1 ,1 4 ) : c a r d=C a r d ( i ,k ) s e l f . c a r d s . a p p e n d ( c a r d ) d e f_ _ s t r _ _ ( s e l f ) : r e s=[ ] f o rc a r di ns e l f . c a r d s : r e s . a p p e n d ( s t r ( c a r d ) ) p r i n ts e l f . l a b e l r e t u r n' \ n ' . j o i n ( r e s ) d e fd e a l _ c a r d ( s e l f ) : r e t u r ns e l f . c a r d s . p o p ( 0 ) d e fa d d _ c a r d ( s e l f ,c a r d ) : s e l f . c a r d s . a p p e n d ( c a r d ) d e fs h u f f l e ( s e l f ) : i m p o r tr a n d o m r a n d o m . s h u f f l e ( s e l f . c a r d s ) d e fs o r t ( s e l f ) : s e l f . c a r d s . s o r t ( ) d e fm o v e _ c a r d s ( s e l f ,o t h e r ,n u m ) : f o rii nr a n g e ( n u m ) : o t h e r . a d d _ c a r d ( s e l f . d e a l _ c a r d ( ) ) d e fd e a l _ h a n d s ( s e l f ,n u m _ h a n d s ,n u m _ c a r d s ) : i fn u m _ h a n d s * n u m _ c a r d s>5 2 : r e t u r n' N o te n o u g hc a r d s . ' l=[ ] f o rii nr a n g e ( 1 ,n u m _ h a n d s+1 ) : h a n d _ i=H a n d ( ' H a n d% d '%i ) s e l f . m o v e _ c a r d s ( h a n d _ i ,n u m _ c a r d s )
en.wikibooks.org/wiki/Think_Python/Print_version 228/282
10/24/13
l . a p p e n d ( h a n d _ i ) r e t u r nl c l a s sH a n d ( D e c k ) : d e f_ _ i n i t _ _ ( s e l f ,l a b e l=' ' ) : s e l f . c a r d s=[ ] s e l f . l a b e l=l a b e l #1 8 6 ,1 4 : c l a s sP o k e r H a n d ( H a n d ) : d e fs u i t _ h i s t ( s e l f ) : s e l f . s u i t s={ } f o rc a r di ns e l f . c a r d s : s e l f . s u i t s [ c a r d . s u i t ]=s e l f . s u i t s . g e t ( c a r d . s u i t ,0 )+1 r e t u r ns e l f . s u i t s d e fr a n k _ h i s t ( s e l f ) : s e l f . r a n k s={ } f o rc a r di ns e l f . c a r d s : s e l f . r a n k s [ c a r d . r a n k ]=s e l f . r a n k s . g e t ( c a r d . r a n k ,0 )+1 r e t u r ns e l f . r a n k s d e fP ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =2 : r e t u r nT r u e r e t u r nF a l s e d e fT P ( s e l f ) : s e l f . r a n k _ h i s t ( ) c o u n t=0 f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l= =4 : r e t u r nT r u e e l i fv a l> =2a n dv a l<4 : c o u n t+ =1 r e t u r nc o u n t> =2 d e fT O A K ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =3 : r e t u r nT r u e r e t u r nF a l s e d e fS T R s e q ( s e l f ) : s e q=[ ] l=S T R l i s t ( ) s e l f . r a n k _ h i s t ( ) h=s e l f . r a n k s . k e y s ( ) h . s o r t ( ) i fl e n ( h )<5 :
en.wikibooks.org/wiki/Think_Python/Print_version 229/282
10/24/13
r e t u r n[ ] #A c c o u n t sf o rh i g hA c e s : i f1i nh : h . a p p e n d ( 1 ) f o rii nr a n g e ( 5 ,l e n ( h ) + 1 ) : i fh [ i 5 : i ]i nl : s e q . a p p e n d ( h [ i 5 : i ] ) r e t u r ns e q d e fS T R ( s e l f ) : s e q=s e l f . S T R s e q ( ) r e t u r ns e q! =[ ] d e fF L ( s e l f ) : s e l f . s u i t _ h i s t ( ) f o rv a li ns e l f . s u i t s . v a l u e s ( ) : i fv a l> =5 : r e t u r nT r u e r e t u r nF a l s e d e fF H ( s e l f ) : d=s e l f . r a n k _ h i s t ( ) k e y s=d . k e y s ( ) f o rk e yi nk e y s : i fd [ k e y ]> =3 : k e y s . r e m o v e ( k e y ) f o rk e yi nk e y s : i fd [ k e y ]> =2 : r e t u r nT r u e r e t u r nF a l s e d e fF O A K ( s e l f ) : s e l f . r a n k _ h i s t ( ) f o rv a li ns e l f . r a n k s . v a l u e s ( ) : i fv a l> =4 : r e t u r nT r u e r e t u r nF a l s e d e fS F L ( s e l f ) : s e q=s e l f . S T R s e q ( ) i fs e q= =[ ] : r e t u r nF a l s e f o rl i s ti ns e q : l i s t _ s u i t s=[ ] f o ri n d e xi nl i s t : f o rc a r di ns e l f . c a r d s : i fc a r d . r a n k= =i n d e x : l i s t _ s u i t s . a p p e n d ( c a r d . s u i t ) l i s t _ h i s t=h i s t o g r a m ( l i s t _ s u i t s ) f o rk e yi nl i s t _ h i s t . k e y s ( ) : i fl i s t _ h i s t [ k e y ]> =5 : r e t u r nT r u e r e t u r nF a l s e
en.wikibooks.org/wiki/Think_Python/Print_version 230/282
10/24/13
d e fc l a s s i f y ( s e l f ) : s e l f . s c o r e s=[ ] h a n d s=[ ' P a i r ' ,' T w o P a i r ' , ' T h r e eo faK i n d ' ,' S t r a i g h t ' , ' F l u s h ' ,' F u l lH o u s e ' , ' F o u ro faK i n d ' ,' S t r a i g h tF l u s h ' ] i fs e l f . P ( ) : s e l f . s c o r e s . a p p e n d ( 1 ) i fs e l f . T P ( ) : s e l f . s c o r e s . a p p e n d ( 2 ) i fs e l f . T O A K ( ) : s e l f . s c o r e s . a p p e n d ( 3 ) i fs e l f . S T R ( ) : s e l f . s c o r e s . a p p e n d ( 4 ) i fs e l f . F L ( ) : s e l f . s c o r e s . a p p e n d ( 5 ) i fs e l f . F H ( ) : s e l f . s c o r e s . a p p e n d ( 6 ) i fs e l f . F O A K ( ) : s e l f . s c o r e s . a p p e n d ( 7 ) i fs e l f . S F L ( ) : s e l f . s c o r e s . a p p e n d ( 8 ) i fs e l f . s c o r e s! =[ ] : r e t u r nh a n d s [ m a x ( s e l f . s c o r e s ) 1 ] d e fS T R l i s t ( ) : s=[ ] f o rii nr a n g e ( 0 , 9 ) : s . a p p e n d ( r a n g e ( 1 , 1 4 ) [ i : i + 5 ] ) s . a p p e n d ( [ 1 0 , 1 1 , 1 2 , 1 3 , 1 ] ) r e t u r ns d e fh i s t o g r a m ( l ) : d=d i c t ( ) f o rki nr a n g e ( l e n ( l ) ) : d [ l [ k ] ]=1+d . g e t ( l [ k ] , 0 ) r e t u r nd #1 8 6 ,5 : d e fp ( c o n f i g=' ' ,t r i a l s=1 0 0 0 0 ,n=1 ) : " " " E s t i m a t e sp r o b a b i l i t yt h a tt h e n t hd e a l th a n dw i l lb ec o n f i g .Ah a n d c o n s i s t so fs e v e nc a r d s . " " " s u c c e s s e s=0 f o rii nr a n g e ( 1 ,t r i a l s+1 ) : d e c k=D e c k ( ' D e c k% d '%i ) d e c k . s h u f f l e ( ) b o x=H a n d ( ) d e c k . m o v e _ c a r d s ( b o x ,( n 1 ) * 7 ) h a n d=P o k e r H a n d ( ' P o k e rH a n d% d '%i ) d e c k . m o v e _ c a r d s ( h a n d ,7 )
en.wikibooks.org/wiki/Think_Python/Print_version 231/282
10/24/13
AppendixB
ExerciseB.3
Writeafunctioncalled bisectionthattakesasortedlistandatargetvalueandreturnstheindexofthevalueinthelist,ifitsthere,or Noneifitsnot.
f r o mb i s e c ti m p o r tb i s e c t _ l e f t d e fb i s e c t i o n ( s o r t e d _ l i s t ,i t e m ) : i=b i s e c t _ l e f t ( s o r t e d _ l i s t ,i t e m ) i fi<l e n ( s o r t e d _ l i s t )a n ds o r t e d _ l i s t [ i ]= =i t e m : r e t u r ni e l s e : r e t u r nN o n e i f_ _ n a m e _ _= =' _ _ m a i n _ _ ' : a=[ 1 ,2 ,3 ] p r i n t ( b i s e c t i o n ( a ,2 ) ) #e x p e c t1 b=[ 1 ,3 ] p r i n t ( b i s e c t i o n ( b ,2 ) ) #e x p e c tN o n e c=[ 1 ,2 ] p r i n t ( b i s e c t i o n ( c ,3 ) ) #e x p e c tN o n e
Index
en.wikibooks.org/wiki/Think_Python/Print_version 232/282
10/24/13
Index
Ackermanfunction,6.11 literalness,1.4
AttributeError,15.7,A.2.3
localvariable,3.9,3.14
Austin,Jane,13.3
logfunction,3.3
abecedarian,8.3,9.2
logarithm,13.12
absfunction,6.1
logicaloperator,5.2,5.3
absolutepath,14.4,14.11
longinteger,11.7
access,10.2
lookup,11.9
accumulator,10.14
lookup,dictionary,11.3
histogram,13.3
loop,4.2,4.11,7.3,12.5
list,10.7
condition,A.2.2
string,18.5
en.wikibooks.org/wiki/Think_Python/Print_version
event,19.1
233/282
10/24/13
sum,10.7
for,4.2,8.3,10.3
MD5,14.12
looping withdictionaries,11.2
10/24/13
alphabet,4.12
lowlevellanguage,1.1,1.7
alternativeexecution,5.5
ls(Unixcommand),14.8
ambiguity,1.4 Markovanalysis,13.8 anagram,10.15 McCloskey,Robert,8.3 anagramset,12.11,14.7 MD5algorithm,14.12 andoperator,5.3 Menubuttonwidget,19.7 anydbmmodule,14.6 MontyPythonandtheHolyGrail,16.2 appendmethod,10.6,10.12,10.15,18.4,18.6 MP3,14.12 arcfunction,4.3 mappattern,10.7,10.14 argument,3.1,3.5,3.8,3.8,3.14,10.12 mapto,18.1 gather,12.4
en.wikibooks.org/wiki/Think_Python/Print_version
235/282
10/24/13
keyword,4.5,4.11,12.7,19.2
mapping,10.2,10.14,13.8
list,10.12
mashup,13.8
optional,8.8,10.9,11.3
mathfunction,3.3
variablelengthtuple,12.4
maxfunction,12.3,12.4
arithmeticoperator,2.5
dictionary,11
assertstatement,16.5
list,10.2
assignment,2.11,7.1,10.1
set,11
10/24/13
assignmentstatement,2.2
metathesis,12.11
attribute __dict__,17.10
method,8.8,8.12,17.1,17.11
availablecolors,15.9,17.12
close,14.2,14.6,14.8
10/24/13
init,17.5,18.1,18.4,18.7 benchmarking,13.9,13.11 items,12.6 big,hairyexpression,A.3.2 join,10.9,18.5 binding,19.8,19.10 keys,11.2 bingo,12.11 mro,18.9 birthday,16.7 pop,10.8,18.6 birthdayparadox,10.15 radd,17.8 bisectmodule,10.15 read,14.8 bisectionsearch,10.15 readline,9.1,14.8 bisection,debuggingby,7.7 remove,10.8 bitwiseoperator,2.5 replace,13.1 body,3.5,3.14,5.13,7.3 setdefault,11.4
en.wikibooks.org/wiki/Think_Python/Print_version 238/282
10/24/13
booltype,5.2 sort,10.6,10.13,12.7,18.6 booleanexpression,5.2,5.13 split,10.9,12.2 booleanfunction,6.4,16.1 string,8.13 booleanoperator,8.9 strip,9.1,13.1 borrowing,subtractionwith,7.6,16.4 translate,13.1 boundmethod,19.6,19.10 update,12.6 boundingbox,15.9,19.4,19.10 values,11 bracket squiggly,11 void,10.6
bracketoperator,8.1,10.2,12.1
methodappend,10.15
branch,5.5,5.13
methodresolutionorder,18.9
breakstatement,7.4
en.wikibooks.org/wiki/Think_Python/Print_version
methodsyntax,17.2
239/282
10/24/13
bug,1.3,1.3,1.7
method,bound,19.6
worst,17.12
method,list,10.6
worstever,19.11
minfunction,12.3,12.4
model,mental,A.3.1
Callableobject,19.7
modifier,16.3,16.6
Canvascoordinate,19.3,19.8
module,3.3,3.14,3.14
Canvasitem,19.3
anydbm,14.6
Canvasobject,15.9
bisect,10.15
Canvaswidget,19.3
copy,15.6
CarTalk,9.7,9.7,9.7,11.10,12.11
datetime,16.7
Cardclass,18.1
Gui,19.1
en.wikibooks.org/wiki/Think_Python/Print_version
240/282
10/24/13
Collatzconjecture,7.3
HTMLParser,19.11
CzechRepublic,nationalflag,15.9
Image,19.11
calculator,1.8,2.12
os,14.4
callgraph,11.5,11.9
pickle,14.1,14.7
callback,19.2,19.6,19.7,19.8,19.9,19.10
pprint,11.8
card,playing,18
profile,13.9
carrying,additionwith,7.6,16.2,16.4
random,10.15,12.7,13.2,18.6
casesensitivity,variablenames,2.10
reload,14.9,A.1.1
catch,14.11
shelve,14.7,14.12
chainedconditional,5.6,5.13
string,13.1
character,8.1
structshape,12.9
checksum,14.12
en.wikibooks.org/wiki/Think_Python/Print_version
urllib,14.12,19.11
241/282
10/24/13
childclass,18.7,18.10
Visual,17.12
choicefunction,13.2
vpython,17.12
circlefunction,4.3
World,15.9
circulardefinition,6.5 moduleobject,3.3,14.9 class,15.1,15.8 module,writing,14.9 Card,18.1 modulusoperator,5.1,5.13 Date,16.7 mromethod,18.9 Deck,18.4 multilinestring,4.9,A.1 Hand,18.7 multipleassignment,7.1,7.8,11.6 Kangaroo,17.12 multiplicity(inclassdiagram),18.8,18.10 Point,15.1,17.5 mutability,8.5,10.2,10.5,10.11,11.6,12.1,12.8,15.5
en.wikibooks.org/wiki/Think_Python/Print_version 242/282
10/24/13
SimpleTurtleWorld,19.6
NameError,3.9,A.2.3
Time,16.1
Newtonsmethod,7.5
Nonespecialvalue,3.11,6.1,6.10,10.6,10.8 classattribute,18.2,18.10 naturallanguage,1.4,1.7 classdefinition,15.1 negativeindex,8.2 classdiagram,18.8,18.10 nestedconditional,5.7,5.13 classobject,15.1,15.8 nestedlist,10.1,10.3,10.14 closemethod,14.2,14.6,14.8 newline,5.11,7.1,18.5 cmpfunction,18.3 notoperator,5.3 __cmp__method,18.3
en.wikibooks.org/wiki/Think_Python/Print_version
243/282
10/24/13
colon,3.5,A.1
number,random,13.2
colorlist,15.9,17.12 OverflowError,5.12 comment,2.9,2.11 object,8.5,8.12,10.10,10.10,10.14,15.1 commutativity,2.8,17.8 Callable,19.7 comparefunction,6.1 Canvas,15.9 comparison string,8.10 class,15.1
tuple,12.7,18.3
copying,15.6
10/24/13
printing,17.2 concatenation,2.8,2.11,3.9,8.3,8.5,10.9
list,10.4,10.12,10.15
objectcode,1.1,1.7
objectdiagram,15.2,15.3,15.6,15.8,16.1,18.2 condition,5.4,5.13,7.3,A.2.2 objectorientedlanguage,17.11 conditional,A.1 objectorientedprogramming,17.1,17.11,18.7 chained,5.6,5.13 octal,2.2 nested,5.7,5.13 odometer,9.7 conditionalexecution,5.4 openfunction,9.1,9.1,14.2,14.5,14.6 conditionaloperator,18.3 operand,2.5,2.11
en.wikibooks.org/wiki/Think_Python/Print_version
245/282
10/24/13
conditionalstatement,5.4,5.13,6.4
operator,2.11
configmethod,19.3
and,5.3
consistencycheck,11.8,16.4
bitwise,2.5
contributors,0
boolean,8.9
conversion type,3.2
bracket,8.1,10.2,12.1
comparison,5.2
coordinate Canvas,19.3,19.8
conditional,18.3
coordinatesequence,19.4
in,8.9,9.3,10.2,11
copy deep,15.6
is,10.10,15.6
logical,5.2,5.3
en.wikibooks.org/wiki/Think_Python/Print_version 246/282
10/24/13
copymodule,15.6
overloading,17.11
copyingobjects,15.6
slice,8.4,8.13,10.5,10.12,12.1
countmethod,8.8
string,2.8
counter,8.7,8.12,11.1,11.6
update,10.7
10/24/13
optionalparameter,13.5,17.5 Dateclass,16.7 oroperator,5.3 Deckclass,18.4 orderofoperations,2.7,2.10,A.3.2 Dijkstra,Edsger,9.5 osmodule,14.4 Doyle,ArthurConan,1.3.4 other(parametername),17.4 DSUpattern,12.7,12.10,13.4 overloading,17.11 datastructure,12.9,12.10,13.9 override,13.5,13.11,17.5,18.3,18.7,18.9 database,14.6,14.11,14.12
datetimemodule,16.7
PEMDAS,2.7
deadcode,6.1,6.10,A.2.4
PIL(PythonImagingLibrary),19.11
debugger(pdb),A.2.3
Pointclass,15.1,17.5
en.wikibooks.org/wiki/Think_Python/Print_version
248/282
10/24/13
debugging,1.3,1.3,1.6,1.7,2.10,3.13,4.10,5.12,6.9,8.11,9.5,10.13,11.8, 12.9,13.10,14.10,15.7,16.5,17.10,18.9,19.9,A
ProjectGutenberg,13.1
Puzzler,9.7,9.7,9.7,11.10,12.11 bybisection,7.7 Pythagoreantheorem,6.2 emotionalresponse,1.6,A.3.4 Python3.0,1.5,2.5,5.11,11.7,12.5 experimental,1.3.4 Pythondebugger(pdb),A.2.3 superstition,A.3.4 PythonImagingLibrary(PIL),19.11 deck,playingcards,18.4 packingwidgets,19.6,19.10 declaration,11.6,11.9 palindrome,6.11,8.13,9.4,9.7,9.7 decoratesortundecoratepattern,12.7 parameter,3.8,3.9,3.14,10.12 decrement,7.2,7.8
gather,12.4
deepcopy,15.6,15.8
optional,13.5,17.5
deepcopyfunction,15.6
en.wikibooks.org/wiki/Think_Python/Print_version
other,17.4
249/282
10/24/13
defkeyword,3.5
self,17.2
class,15.1
matching,1.3.1
function,3.5
overridingprecedence,2.7
recursive,12.11
parametersin,3.8,3.9
delimiter,10.9,10.14
en.wikibooks.org/wiki/Think_Python/Print_version
parse,1.4,1.7,14.12
250/282
10/24/13
deterministic,13.2,13.11
passstatement,5.4
developmentplan,4.11
path,14.4,14.11
encapsulationandgeneralization,4.8
absolute,14.4
incremental,6.2,A.1
relative,14.4
prototypeandpatch,16.2,16.4
decoratesortundecorate,12.7
randomwalkprogramming,13.10,A.3.4
filter,10.7,10.14
class,18.8,18.10
reduce,10.7,10.14
en.wikibooks.org/wiki/Think_Python/Print_version
251/282
10/24/13
object,15.2,15.3,15.6,15.8,16.1,18.2
search,8.6,8.12,9.3,11.3
stack,3.10,10.12
swap,12.2
state,2.2,7.1,8.11,10.2,10.10,10.11,11.4,12.6,15.2,15.3,15.6,16.1,18.2 pdb(Pythondebugger),A.2.3
__dict__attribute,17.10
permission,file,14.5
dictfunction,11
persistence,14.1,14.11
dictionary,11,11,11.9,12.6,A.2.3
pi,3.3,7.9
initialize,12.6
picklemodule,14.1,14.7
invert,11.4
pickling,14.7
lookup,11.3
pie,4.12
loopingwith,11.2
pipe,14.8,14.12
reverselookup,11.3
pixelcoordinate,19.8
en.wikibooks.org/wiki/Think_Python/Print_version
252/282
10/24/13
subtraction,13.6
plaintext,9.1,13.1,14.12,19.11
traversal,12.6,17.10
planneddevelopment,16.4,16.6
dispatch typebased,17.9
popmethod,10.8,18.6
10/24/13
division floatingpoint,2.5
pprintmodule,11.8
divmod,12.3,16.4
prefix,13.8
docstring,4.9,4.11,15.1
prettyprint,11.8
documentation,1.8
printstatement,1.5,1.7,17.6,A.2.4
dotnotation,3.3,3.14,8.8,15.2,17.2,18.2
problemrecognition,9.3,9.4,9.6
doubleletters,9.7
problemsolving,1,1.7
draganddrop,19.8
profilemodule,13.9
duplicate,10.15,10.15,11.10,14.12
program,1.2,1.7
programtesting,9.5 Einstein,Albert,4.6
en.wikibooks.org/wiki/Think_Python/Print_version 254/282
10/24/13
programminglanguage,1.1 Entrywidget,19.5 prompt,1.1,1.7,5.11 Euclidsalgorithm,6.11 prose,1.4 Eventobject,19.8 prototypeandpatch,16.2,16.4,16.6 element,10.1,10.14 pseudorandom,13.2,13.11 elementdeletion,10.8 purefunction,16.2,16.6 elifkeyword,5.6 python.org,1.8 ellipses,3.5
elsekeyword,5.5
quotationmark,1.5,2.1,2.1,4.9,8.4,A.1
emailaddress,12.2
embeddedobject,15.3,15.8,17.12
Ramanujan,Srinivasa,7.9
copying,15.6
Rectangleclass,15.3
en.wikibooks.org/wiki/Think_Python/Print_version
255/282
10/24/13
RSAalgorithm,11.7 emotionaldebugging,1.6,A.3.4 RuntimeError,5.10,6.8 emptylist,10.1 raddmethod,17.8 emptystring,8.12,10.9 radian,3.3 encapsulation,4.4,4.11,6.3,7.5,8.7,18.7 rage,A.3.4 encode,18.1,18.10 raisestatement,11.3,16.5 encrypt,18.1 randintfunction,10.15,13.2 encryption,11.7 randomfunction,12.7,13.2 endoflinecharacter,14.10 randommodule,10.15,12.7,13.2,18.6 enumeratefunction,12.5 randomnumber,13.2 epsilon,7.5 randomtext,13.8 equalityandassignment,7.1 randomwalkprogramming,13.10,A.3.4
en.wikibooks.org/wiki/Think_Python/Print_version 256/282
10/24/13
runtime,1.3.2,2.10,5.10,5.12,A
readlinemethod,9.1,14.8
semantic,1.3.3,2.1,2.10,8.11,A,A.3
recursion,5.8,5.8,5.13,6.5,6.6
shape,12.9
basecase,5.9
syntax,1.3.1,2.10,A
infinite,5.10,6.8,A.2.2
errorchecking,6.8
recursivedefinition,6.5,12.11
errormessage,1.3.1,1.3.3,1.6,2.1,2.10,A.1
reducepattern,10.7,10.14
evalfunction,7.9
reducibleword,11.10,12.11
evaluate,2.6
en.wikibooks.org/wiki/Think_Python/Print_version
redundancy,1.4
257/282
10/24/13
event,19.10
refactoring,4.7,4.7
eventhandler,19.8
reference,10.11,10.12,10.14
eventloop,19.1,19.10
aliasing,10.11
eventstring,19.8 relativepath,14.4,14.11 eventdrivenprogramming,19.2,19.9,19.10 reloadfunction,14.9,A.1.1 exception,1.3.2,1.7,2.10,A,A.2.3 removemethod,10.8 AttributeError,15.7,A.2.3 repetition,4.2 IndexError,8.2,8.11,10.2,A.2.3 list,10.4 IOError,14.5
KeyError,11,A.2.3
replacemethod,13.1
NameError,3.9,A.2.3
reprfunction,14.10
en.wikibooks.org/wiki/Think_Python/Print_version
258/282
10/24/13
OverflowError,5.12
representation,15.1,15.3,18.1
RuntimeError,5.10
returnstatement,5.8,6.1,A.3.3
SyntaxError,3.4
returnvalue,3.1,3.14,6.1,15.4
TypeError,8.1,8.5,11.4,12.1,12.4,14.3,17.3,A.2.3
tuple,12.3
exception,catching,14.5
reversedfunction,12.8
executable,1.1,1.7
rotation letters,11.10
exercise,secret,14.12
existsfunction,14.4
rotation,letter,8.13
experimentaldebugging,1.3.4,13.10
rulesofprecedence,2.7,2.11
en.wikibooks.org/wiki/Think_Python/Print_version
259/282
10/24/13
expression,2.5,2.6,2.11
runningpace,1.8,2.12,16.7
bigandhairy,A.3.2
runtimeerror,1.3.2,2.10,5.10,5.12,A,A.2.3
boolean,5.2,5.13
SVG,19.11 Falsespecialvalue,5.2 Swampy,4.1,9.1,15.9,18.11,19.1 FermatsLastTheorem,5.14 SyntaxError,3.4 Framewidget,19.6 safelanguage,1.3.2 FreeDocumentationLicense,GNU,0,0 sanitycheck,11.8 factorialfunction,6.5,6.8 scaffolding,6.2,6.10,11.8 fibonaccifunction,6.7,11.5 scatter,12.4,12.10 file,14
en.wikibooks.org/wiki/Think_Python/Print_version 260/282
10/24/13
compression,14.8
script,1.1,1.7
permission,14.5
scriptmode,1.1,1.7,2.4,3.11
readingandwriting,14.2
search,11.3
searchpattern,8.6,8.12,9.3 fileobject,9.1,9.6 search,bisection,10.15 filename,14.4 secretexercise,14.12 filterpattern,10.7,10.14 self(parametername),17.2 findfunction,8.6 semanticerror,1.3.3,1.7,2.1,2.10,8.11,A,A.3 flag,11.6,11.9 semantics,1.3.3,1.7,17.1 floatfunction,3.2 sequence,8.1,8.12,10.1,10.9,12.1,12.8 floattype,2.1 coordinate,19.4 floatingpoint,2.11,7.5
en.wikibooks.org/wiki/Think_Python/Print_version 261/282
10/24/13
floatingpointdivision,2.5
set,13.6
floordivision,2.5,2.11,5.12
anagram,12.11,14.7
flowofexecution,3.7,3.14,6.7,6.9,7.3,18.9,19.9,A.2.2 setmembership,11 flower,4.12 setdefaultmethod,11.4 folder,14.4 sexagesimal,16.4 forloop,4.2,8.3,10.3,12.5 shallowcopy,15.6,15.8 formallanguage,1.4,1.7 shape,12.10 formatoperator,14.3,14.11,A.2.3 shapeerror,12.9 formatsequence,14.3,14.11 shell,14.8 formatstring,14.3,14.11 shelvemodule,14.7,14.12 frabjuous,6.5 shufflefunction,18.6
en.wikibooks.org/wiki/Think_Python/Print_version 262/282
10/24/13
fruitfulfunction,3.11,3.14
list,10.5
frustration,A.3.4
string,8.4
function,3.5,3.14,17.1
tuple,12.1
abs,6.1
update,10.5
10/24/13
dict,11
None,3.11,6.1,6.10,10.6,10.8
enumerate,12.5
True,5.2
eval,7.9 splitmethod,10.9,12.2 exists,14.4 sqrt,6.2 factorial,6.5 sqrtfunction,3.3 fibonacci,6.7,11.5 squareroot,7.5 find,8.6 squigglybracket,11 float,3.2
en.wikibooks.org/wiki/Think_Python/Print_version 264/282
10/24/13
getattr,17.10
stackdiagram,3.10,3.10,3.14,4.12,5.9,6.5,6.11, 10.12
getcwd,14.4
statediagram,2.2,2.11,7.1,8.11,10.2,10.10,10.11, 11.4,12.6,15.2,15.3,15.6,16.1,18.2
hasattr,15.7,17.10
statement,2.4,2.11
int,3.2
assert,16.5
isinstance,6.8,17.8
assignment,2.2,7.1
len,3.15,8.2,11
break,7.4
list,10.9
compound,5.4
log,3.3
conditional,5.4,5.13,6.4
max,12.3,12.4
for,4.2,8.3,10.3
min,12.3,12.4
global,11.6
open,9.1,9.1,14.2,14.5,14.6
if,5.4
en.wikibooks.org/wiki/Think_Python/Print_version
265/282
10/24/13
polygon,4.3
import,3.14,4.1,14.9
popen,14.8
pass,5.4
randint,10.15,13.2
print,1.5,1.7,17.6,A.2.4
random,12.7,13.2
raise,11.3,16.5
raw_input,5.11
return,5.8,6.1,A.3.3
recursive,5.8
try,14.5
reload,14.9,A.1.1
while,7.3
10/24/13
accumulator,18.5 str,3.2 comparison,8.10 sum,12.4 empty,10.9 tuple,12.1 immutable,8.5 type,15.7 method,8.8 zip,12.5 multiline,4.9,A.1
functionargument,3.8
operation,2.8
functioncall,3.1,3.14
slice,8.4
functioncomposition,6.3
triplequoted,4.9
10/24/13
pure,16.2
structure,1.4
function,trigonometric,3.3
withborrowing,7.6
10/24/13
functionalprogrammingstyle,16.3,16.6 suit,18.1
GCD(greatestcommondivisor),6.11
sumfunction,12.4
GNUFreeDocumentationLicense,0,0
superclass,18.7
GUI,19.1,19.10
superstitiousdebugging,A.3.4
Guimodule,19.1
swappattern,12.2
gammafunction,6.8
syntax,1.3.1,1.3.1,1.7,17.1,A.1
gather,12.4,12.10
syntaxerror,1.3.1,1.7,2.10,A
10/24/13
graphicaluserinterface,19.1
TurtleWorld,4.1,5.14,18.11
greatestcommondivisor(GCD),6.11
TypeError,8.1,8.5,11.4,12.1,12.4,14.3,17.3,A.2.3
grid,3.15
temporaryvariable,6.1,6.10,A.3.2
guardianpattern,6.8,6.10,8.11
testcase,minimal,A.2.4
gzip(Unixcommand),14.8
testing andabsenceofbugs,9.5
HASArelationship,18.8,18.10
incrementaldevelopment,6.2
en.wikibooks.org/wiki/Think_Python/Print_version
270/282
10/24/13
Handclass,18.7
interactivemode,1.1
Hello,World,1.5
ishard,9.5
Holmes,Sherlock,1.3.4
knowingtheanswer,6.2
HTMLParsermodule,19.11
leapoffaith,6.6
hanging,A.2.2
minimaltestcase,A.2.4
hashable,11.4,11.9,12.6
random,13.8
10/24/13
histogram,11.1,11.1,11.9
randomchoice,13.2,13.7
dictionary,17.10
wordfrequencies,13.3
list,10.3
homophone,11.10
traverse dictionary,12.6
hyperlink,19.11 triangle,5.14
hypotenuse,6.2
trigonometricfunction,3.3
IMDb(InternetMovieDatabase),14.12
triplequotedstring,4.9
Imagemodule,19.11
trystatement,14.5
IndexError,8.2,8.11,10.2,A.2.3
tuple,12.1,12.3,12.8,12.10
en.wikibooks.org/wiki/Think_Python/Print_version
272/282
10/24/13
InternetMovieDatabase(IMDb),14.12
askeyindictionary,12.6,13.9
IOError,14.5
assignment,12.2
ISArelationship,18.8,18.10
comparison,12.7,18.3
identical,10.14
inbrackets,12.6
identity,10.10
singleton,12.1
ifstatement,5.4
slice,12.1
imageviewer,19.11 tupleassignment,12.3,12.5,12.10 immutability,8.5,8.5,8.12,10.11,11.4,12.1,12.8 tuplefunction,12.1 implementation,11.1,11.9,13.9 turtletypewriter,4.12 importstatement,3.14,4.1,14.9 type,2.1,2.1,2.11 inoperator,8.9,9.3,10.2,11 bool,5.2 increment,7.2,7.8,16.3,17.3
en.wikibooks.org/wiki/Think_Python/Print_version 273/282
10/24/13
dict,11 incrementaldevelopment,6.10,A.1 file,14 indentation,3.5,17.2,A.1 float,2.1 index,8.1,8.1,8.11,8.12,10.2,10.14,11,A.2.3 int,2.1 loopingwith,9.4,10.3 list,10 negative,8.2 long,11.7 slice,8.4,10.5 set,13.6 startingatzero,8.1,10.2 str,2.1
infiniteloop,7.3,7.8,19.1,A.2.2,A.2.2
tuple,12.1
infiniterecursion,5.10,5.13,6.8,A.2.2,A.2.2
userdefined,15.1,16.1
10/24/13
instanceattribute,15.2,15.8,18.2,18.10
instantiation,15.1
UML,18.8
intfunction,3.2
UnboundLocalError,11.6
inttype,2.1
Unixcommand gzip,14.8
URL,14.12,19.11
en.wikibooks.org/wiki/Think_Python/Print_version
275/282
10/24/13
interactivemode,1.1,1.7,2.4,3.11
underscorecharacter,2.3
interface,4.6,4.10,4.11,18.9
uniqueness,10.15
interlockingwords,10.15
update,7.2,7.5,7.8
interpret,1.1,1.7
coordinate,19.8
invariant,16.5,16.6,19.9
database,14.6
invertdictionary,11.4
globalvariable,11.6
invocation,8.8,8.12
histogram,13.3
isoperator,10.10,15.6
item,10.3
isinstancefunction,6.8,17.8
slice,10.5
10/24/13
urllibmodule,14.12,19.11
itemassignment,8.5,10.2,12.1
usebeforedef,2.10,3.6
itemupdate,10.3
userdefinedtype,15.1,16.1
itemsmethod,12.6 ValueError,5.11,11.3,12.2
iteration,7,7.3,7.8
Visualmodule,17.12
joinmethod,10.9,18.5
value,2.1,2.11,10.10,10.10,11.9
10/24/13
keyword,2.3,2.3,2.11,A.1
variablelengthargumenttuple,12.4
def,3.5
vectorgraphics,19.11
elif,5.6
veneer,18.6,18.10
else,5.5
voidfunction,3.11,3.14
10/24/13
highlevel,1.1
whitespace,3.13,5.12,9.1,14.10,A.1
lowlevel,1.1
widget,19.1,19.10
natural,1.4
Button,19.2
programming,1.1
Canvas,19.3
safe,1.3.2
Entry,19.5
Turingcomplete,6.5
Frame,19.6
en.wikibooks.org/wiki/Think_Python/Print_version
279/282
10/24/13
letterrotation,8.13,11.10
widget,packing,19.6
lipogram,9.2
wordcount,14.9
list,10,10.9,10.14,12.8
wordfrequency,13.1,13.12
asargument,10.12
word,reducible,11.10,12.11
comprehension,10.7
workingdirectory,14.4
concatenation,10.4,10.12,10.15
worstbug,17.12
copy,10.5
ever,19.11
element,10.2
empty,10.1
Zipfslaw,13.12
function,10.9
zero,indexstartingat,8.1,10.2
index,10.2
zipfunction,12.5
membership,10.2
en.wikibooks.org/wiki/Think_Python/Print_version
usewithdict,12.6
280/282
10/24/13
method,10.6
nested,10.1,10.3
ofobjects,18.4
oftuples,12.5
operation,10.4
repetition,10.4
slice,10.5
traversal,10.3,10.14
<IMGSRC="previous_motif.gif"ALT="Previous"><IMGSRC="contents_motif.gif"ALT="Up"> Retrievedfrom"http://en.wikibooks.org/w/index.php?title=Think_Python/Print_version&oldid=1931999"
Thispagewaslastmodifiedon23October2013,at21:16. TextisavailableundertheCreativeCommonsAttribution/ShareAlikeLicenseadditionaltermsmayapply.Byusingthissite,youagreetotheTermsof UseandPrivacyPolicy.
en.wikibooks.org/wiki/Think_Python/Print_version 281/282
10/24/13
en.wikibooks.org/wiki/Think_Python/Print_version
282/282
Using functions improves code readability and manageability by allowing programmers to encapsulate sequences of statements into single, reusable units, making it easier to read and debug programs . Functions eliminate repetitive code, which reduces the size of the program and centralizes code changes, thus simplifying maintenance . They provide clear interfaces that describe how to use them, making collaboration and code sharing more efficient . Moreover, functions facilitate a modular development approach, enabling programmers to focus on smaller, manageable parts of a program before assembling them into a whole .
Maintaining code consistency with respect to indentation in Python is crucial because Python uses indentation to define the blocks of code. Each block must be consistently indented both for readability and to avoid syntax errors. Unlike other languages that use braces or keywords to define blocks, Python relies entirely on indentation to determine the structure of the code. Thus, mismatched or inconsistent indentation can lead to syntax errors, causing the program to fail to execute properly or even compile . Indentation errors may manifest as syntax errors, which are disruptive and need correcting before the program can run successfully . Thus, clear and consistent indentation is not just a matter of style in Python; it’s a requirement for functional code.
Operator overloading enables custom classes in Python to define or modify the behavior of operators, like '+', making them intuitive to use with the class’ objects. By creating special methods such as '__add__', these classes can support operations consistent with the type of data they model. This capacity to handle user-defined types with familiar syntax facilitates clearer, more readable code, reflecting operations naturally associated with those types .
The '__init__' method in object-oriented programming, often referred to as the initializer, is a special method that automatically executes when a new instance of a class is created. It is used to set initial values for the object's attributes, ensuring that all objects are properly initialized with the necessary data upon creation . The '__str__' method, on the other hand, is another special method used to define how an instance of a class should be represented as a string. It is typically implemented to provide a human-readable string output, which is especially useful when printing objects or for debugging purposes, allowing an object to be passed to the 'print()' function or be converted to a string using 'str()' .
Syntax errors occur when Python cannot translate the source code into byte code due to incorrect syntax, producing a syntax error message. Runtime errors happen when an error occurs during the execution of a program, often identifiable by where in the program it occurred and the context function. Semantic errors, in contrast, appear when a program runs without producing error messages but doesn't perform the intended task, meaning the logic of the code is flawed even if technically correct according to syntax .
Debugging is considered intellectually rich and challenging because it involves detective work and experimental science. Programmers must analyze clues and infer the processes that led to errors, akin to solving a mystery. The process requires the development and testing of hypotheses about what might be going wrong, iterating solutions, and refining understanding of the code. This makes debugging both a critical and stimulating aspect of programming, where eliminating the impossible variables often leads to the solution, drawing from ideas similar to those espoused by Sherlock Holmes .
The search pattern in Python enables problem-solving by providing a systematic way to iterate over sequences to find or check elements, facilitating solutions to exercises like checking for forbidden or required characters in words. By using loops and conditionals, it allows programmers to efficiently determine characteristics of strings and lists, helping in tasks such as verifying the absence of certain letters, or confirming the presence of required attributes .
Operator overloading combined with method binding in class-based implementations, like with Time objects, provides enhanced functionality by allowing intuitive arithmetic or logical operations directly on objects, like adding times, without cumbersome methods. This enables code to read naturally, similarly to sentence structure, improving readability. Overloading methods like '__add__' and using binding for specific logic keeps operations encapsulated and tied logically to the object’s domain, promoting clear, maintainable code .
Bisection search improves efficiency by leveraging the ordered nature of a sorted list to halve the search space each time it's compared, taking logarithmic steps proportional to the size of the list, rather than the linear steps required in a direct linear search, where each element is checked sequentially. This method reduces the number of comparisons dramatically, allowing a very quick conclusion on the presence or absence of an element .
A function in Python might return 'None' when it does not explicitly return a value, or when its execution path ends without hitting a return statement. In Python, all functions return 'None' implicitly if no return statement is executed . This behavior is significant for error handling and program flow because it allows functions to signal that no result is available, or that an expected operation did not occur, such as in cases of insufficient conditions met in the function logic. For instance, if a function lacks a return statement in certain branches, it can indirectly indicate that the logic path was not anticipated or handled, which can be useful for debugging and control flow .