White Mountain Auto is Northern New Hampshire and Vermont's largest provider of used automotive vehicles with Buy Here, Pay Here financing!

4.67 Rating by ClearWebStats
whitemtauto.com is 1 decade 9 years 3 months old. This website has a #9,155,912 rank in global traffic. It has a com as an domain extension. This website has a Google PageRank of 1 out of 10. The DNS for Whitemtauto is hosted at 198.178.114.50. While no active threats were reported recently by users, whitemtauto.com is SAFE to browse.
Get Custom Widget

Traffic Report of Whitemtauto

Daily Unique Visitors: 53
Daily Pageviews: 106

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View whitemtauto.com Pagerank
Alexa Rank: 9,155,912
Domain Authority: Not Applicable
Google Pagerank
PR 1 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View whitemtauto.com site advisor rating No Risk Issues

Where is whitemtauto.com server located?

Hosted IP Address:

198.178.114.50 View other site hosted with whitemtauto.com

Hosted Country:

whitemtauto.com hosted country US whitemtauto.com hosted country

Location Latitude:

37.751

Location Longitude:

-97.822

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View whitemtauto.com HTML resources

Homepage Links Analysis

White Mountain Auto | Used Car Dealership | New Hampshire & Vermont

white mountain auto, white mountain auto broker, white mt auto, whitemtauto.com, buy here, pay here financing, new hampshire, vermont, whitefield, nh, used cars, preowned vehicles, car dealership, auto loan financing, sport utility vehicles, preowned trucks, used van, bad credit, auto loans, bad credit auto loans, guaranteed credit approval, guaranteed financing, auto financing, credit repair, used car auto loans, fast finance, parts, parts department, loans automotive, bankruptcy, buy here pay here, cheap used cars, used car dealers, reliable used cars, auto broker, best reliable used cars, warranty on used cars, bhph, quality used cars, no money down, easy financing, used car dealer, vehicle trade, we finance anyone, cheap reliable used cars, no credit, no credit check, rebuild your credit, preowned cars, guaranteed used cars, guaranteed auto financing, auto financing for bad credit, low payments, affordable payments, repossession no problem, used car with warranty, turned down for credit, declined for car loan, bad credit auto financing, auto finance companies, sub prime auto lenders, used cars for sale buy here pay here, buy here pay here car dealership, buy here pay here car, buy here pay here used cars, buy here pay here cars bad credit, buy here pay here lots, buy here pay here dealership, buy here and pay here, buy here pay here financing, best by here pay here, buy here pay here auto sales, auto credit, bad credit auto dealers, reliable cars, poor credit, credit challenged, bad credit no credit bankruptcy

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • whitemtauto.co
  • whitemtauto.cm
  • whitemtauto.con
  • whitemtauto.net
  • whitemtauto.org
  • wwhitemtauto.com
  • whhitemtauto.com
  • whiitemtauto.com
  • whittemtauto.com
  • whiteemtauto.com
  • whitemmtauto.com
  • whitemttauto.com
  • whitemtaauto.com
  • whitemtauuto.com
  • whitemtautto.com

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 15
Google Adsense: Not Applicable Google Analytics: UA-61252366-3

Websites Hosted on Same IP (i.e. 198.178.114.50)

Used Car Dealership in Muncy, PA | Veterans Auto

whitemtauto.com favicon - veteransautopa.com

Come to Veterans Auto in Muncy, PA to have an experience that meets and exceeds your expectations. We have the used car, truck, van, or SUV you need!

View whitemtauto.com Pagerank   whitemtauto.com alexa rank Not Applicable   whitemtauto.com website value $ 8.95

Jumping Jack Auto | Used Vehicles Denver, CO

whitemtauto.com favicon - jumpingjackauto.com

Visit Jumping Jack Auto in Denver, CO to find the best selection of used vehicles. We can help you find the financing you need for a vehicle you'll love. Find the best savings on the highest quality vehicles.

View whitemtauto.com Pagerank   whitemtauto.com alexa rank 5,712,529   whitemtauto.com website value $ 240.00

HTTP Header Analysis

HTTP/2 200
date: Mon, 17 Oct 2022 20:15:22 GMT
server: Apache/2.4.38 (Debian)
cache-control: no-store, no-cache, must-revalidate
cache-control: post-check=0, pre-check=0
pragma: no-cache
p3p: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
x-ua-compatible: IE=edge,chrome=1
content-security-policy: img-src 'unsafe-eval' 'unsafe-inline' blob: http: https: data:; script-src 'unsafe-eval' 'unsafe-inline' 'self' https:; style-src 'unsafe-inline' 'self' https: http:; default-src 'self' data: gap: https: wss://*.gubagoo.io
x-content-type-options: nosniff
referrer-policy: no-referrer-when-downgrade
feature-policy: sync-xhr *
expires: Mon, 24 Jan 2000 13:00:00 GMT
last-modified: Mon, 17 Oct 2022 20:15:22 GMT
strict-transport-security: max-age=31536000;
x-frame-options: SAMEORIGIN
vary: Accept-Encoding
content-encoding: gzip
content-length: 8075
content-type: text/html; charset=UTF-8

Domain Information for whitemtauto.com

Domain Registrar: GODADDY.COM, LLC whitemtauto.com registrar info
Registration Date: 2006-10-27 1 decade 9 years 3 months ago
Last Modified: 2022-09-04 3 years 5 months 2 weeks ago
Domain Status:
  • clientDeleteProhibited
  • clientRenewProhibited
  • clientTransferProhibited
  • clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns2.inmotionhosting.com whitemtauto.com name server information 70.39.150.2 whitemtauto.com server is located in United States United States
ns1.inmotionhosting.com whitemtauto.com name server information 74.124.210.242 whitemtauto.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
whitemtauto.com A 900 IP:198.178.114.50
whitemtauto.com A 900 IP:198.178.114.55
whitemtauto.com NS 14400 Target:ns1.inmotionhosting.com
whitemtauto.com NS 14400 Target:ns2.inmotionhosting.com
whitemtauto.com SOA 14400 MNAME:ns1.inmotionhosting.com
RNAME:null.inmotionhosting.com
Serial:2022051101
Refresh:86400
Retry:7200
Expire:3600000
Minimum TTL:86400
whitemtauto.com MX 900 Target:mail.whitemtauto.com
whitemtauto.com TXT 900 TXT:v=spf1 +a +mx +ip4:216.194.171.140
include:smtp.servconfig.com
+ip4:198.46.90.218 +ip4:198.46.81.5
+include:dealermarketingservicesspf.smtp
.com +a:ecbiz172.inmotionhosting.com
+a:smtp.servconfig.com ~all

Similarly Ranked Websites to Whitemtauto

Optimize Survival — finding the best way to live

whitemtauto.com favicon - optimizesurvival.com

finding the best way to live

View whitemtauto.com Pagerank   Alexa rank for whitemtauto.com 9,155,938   website value of whitemtauto.com $ 8.95

WYATT'S OUTDOOR, INC.

whitemtauto.com favicon - wyattsoutdoor.com

View whitemtauto.com Pagerank   Alexa rank for whitemtauto.com 9,156,023   website value of whitemtauto.com $ 8.95

Finca Perú

whitemtauto.com favicon - fincaperu.net

View whitemtauto.com Pagerank   Alexa rank for whitemtauto.com 9,156,036   website value of whitemtauto.com $ 8.95

Sunset Beach NC - Visit Sunset Beach NC

whitemtauto.com favicon - visitsunsetbeachnc.com

View whitemtauto.com Pagerank   Alexa rank for whitemtauto.com 9,156,143   website value of whitemtauto.com $ 8.95

BrazosSports

whitemtauto.com favicon - brazossports.com

View whitemtauto.com Pagerank   Alexa rank for whitemtauto.com 9,156,151   website value of whitemtauto.com $ 8.95

Full WHOIS Lookup for whitemtauto.com

Domain Name: WHITEMTAUTO.COM
Registry Domain ID: 648296836_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-09-04T05:28:40Z
Creation Date: 2006-10-27T14:42:03Z
Registry Expiry Date: 2022-10-27T14:42:03Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.INMOTIONHOSTING.COM
Name Server: NS2.INMOTIONHOSTING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-10-17T20:15:23Z