Web Kuyusu, kaliteli içeriğin yer aldığı web dizinidir. Sitenizi web rehberimize ekleyerek aramıza katılın. Site ekle, hit kazan.

1.83 Rating by ClearWebStats
webkuyusu.com is 2 decades 8 months 1 week old. This website has a #689,673 rank in global traffic. It has a com as an domain extension. This website has a Google PageRank of 1 out of 10. The DNS for Webkuyusu is hosted at 31.210.47.2. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, webkuyusu.com is SAFE to browse.
Get Custom Widget

Traffic Report of Webkuyusu

Daily Unique Visitors: 698
Daily Pageviews: 1,396

Estimated Valuation

Income Per Day: $ 4.00
Estimated Worth: $ 960.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for webkuyusu.com Good
WOT Privacy: WOT privacy rank for webkuyusu.com Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View webkuyusu.com Pagerank
Alexa Rank: 689,673
Domain Authority: Not Applicable
Google Pagerank
PR 1 out of 10
PageSpeed Score
Score: 71on 100
Siteadvisor Rating
View webkuyusu.com site advisor rating Not Applicable

Where is webkuyusu.com server located?

Hosted IP Address:

31.210.47.2 View other site hosted with webkuyusu.com

Hosted Country:

webkuyusu.com hosted country TR webkuyusu.com hosted country

Location Latitude:

41.0138

Location Longitude:

28.9497

Social Engagement

Facebook Shares: 8
Facebook Likes: 1
Facebook Comments: Not Applicable

Page Resources Breakdown

View webkuyusu.com HTML resources

Homepage Links Analysis

Web Rehberi Site Ekle Firma Ekle Site Kaydet

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • webkuyusu.co
  • webkuyusu.cm
  • webkuyusu.con
  • webkuyusu.net
  • webkuyusu.org
  • wwebkuyusu.com
  • weebkuyusu.com
  • webbkuyusu.com
  • webkkuyusu.com
  • webkuuyusu.com
  • webkuyyusu.com
  • webkuyuusu.com
  • webkuyussu.com
  • webkuyusuu.com
  • ebkuyusu.com

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 37
Google Adsense: pub-2242501009367824 Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 31.210.47.2)

Hazır Emlak Sitesi | Emlak Sitesi | Emlak Ofisleri İçin 1 Saatte Hazır Web Sitesi

webkuyusu.com favicon - emlaksitesikurulumu.com

Hazır Emlak Sitesi. Emlak ofislerine kısa süre içinde hazır emlak web sitesi. Farklı versiyonlar ile satışa sunduğumuz emlak sitesi tasarım paketlerim

View webkuyusu.com Pagerank   webkuyusu.com alexa rank 798,334   webkuyusu.com website value $ 960.00

Hazır Oto Galeri Web Sitesi | Oto Galeri Sitesi

webkuyusu.com favicon - otogalerisitesi.com

Oto galeri web sitesi. Büyük ve küçük ölçekli tüm oto galerileri için en ekonomik ve pratik hazır oto galeri sitesi. Oto galeri sitesi tasarımı Ankara

View webkuyusu.com Pagerank   webkuyusu.com alexa rank 2,045,024   webkuyusu.com website value $ 240.00


Bergama İlçesi Web Sitesi | Bergama Haberleri, Videolar, Bergama Resimleri | Bergama İlçesi Web Sitesi

webkuyusu.com favicon - bergamailcesi.com

Bergama İlçesi Web Sitesi. Bergama hakkında bilgiler, Bergama haberleri, Bergama Resimleri, Bergama Videoları, Bergama tarihi, Bergama tarihi yerler.

View webkuyusu.com Pagerank   webkuyusu.com alexa rank 880,814   webkuyusu.com website value $ 720.00

Ankara Evden Eve Nakliyat Rehberi - Bölgelere Göre Ankara Nakliye Firmaları

webkuyusu.com favicon - ankaraevdenevenakliyatfirmalari.com

Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.

View webkuyusu.com Pagerank   webkuyusu.com alexa rank 873,410   webkuyusu.com website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 31 Aug 2014 04:05:53 GMT
Server:
X-Powered-By: PHP/5.4.32
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html

Domain Information for webkuyusu.com

Domain Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM webkuyusu.com registrar info
Registration Date: 2005-06-14 2 decades 8 months 1 week ago
Last Modified: 2014-06-24 1 decade 1 year 8 months ago
Expiration Date: 2015-06-14 1 decade 8 months 1 week ago
Domain Status: ok

Domain Nameserver Information

Host IP Address Country
ns3.rehberhost.net webkuyusu.com name server information 31.169.72.148 webkuyusu.com server is located in Turkey Turkey
ns4.rehberhost.net webkuyusu.com name server information 31.169.72.149 webkuyusu.com server is located in Turkey Turkey

DNS Record Analysis

Host Type TTL Extra
webkuyusu.com A 14385 IP:31.210.47.2
webkuyusu.com NS 86400 Target:ns2.rehberhost.net
webkuyusu.com NS 86400 Target:ns1.rehberhost.net
webkuyusu.com NS 86400 Target:ns3.rehberhost.net
webkuyusu.com NS 86400 Target:ns4.rehberhost.net
webkuyusu.com SOA 86400 MNAME:ns1.rehberhost.net
RNAME:info.rehberhost.net
Serial:2014061801
Refresh:86400
Retry:7200
Expire:3600000
Minimum TTL:86400
webkuyusu.com MX 14400 Target:webkuyusu.com

Similarly Ranked Websites to Webkuyusu

WebsiteGespot.nl is een social bookmarking startpagina.

webkuyusu.com favicon - websitegespot.nl

Hier is het mogelijk om website's toe te voegen waarop gebruikers en bezoekers van de site kunnen stemmen en delen. Elke dag leuke websites spotten.

View webkuyusu.com Pagerank   Alexa rank for webkuyusu.com 689,673   website value of webkuyusu.com $ 960.00

Watch Online Megavideo, Streaming, Putlocker, Divx Movies, Download Full.

webkuyusu.com favicon - megavideoweb.com

Putlocker-Watch stream live tv shows,internet movie database and download movie full hd for free trial full length,trailers and movies news.

View webkuyusu.com Pagerank   Alexa rank for webkuyusu.com 689,673   website value of webkuyusu.com $ 960.00

403: Access Forbidden

webkuyusu.com favicon - bindcommerce.com

View webkuyusu.com Pagerank   Alexa rank for webkuyusu.com 689,673   website value of webkuyusu.com $ 960.00

ごちゃまぜっ! | 何でもありの、ごちゃまぜブログ。

webkuyusu.com favicon - h-mkt.com

何でもありの、ごちゃまぜブログ。

View webkuyusu.com Pagerank   Alexa rank for webkuyusu.com 689,674   website value of webkuyusu.com $ 960.00

Muslimah Corner | Artikel Muslim Terkini dan Terupdate

webkuyusu.com favicon - muslimahcorner.com

View webkuyusu.com Pagerank   Alexa rank for webkuyusu.com 689,674   website value of webkuyusu.com $ 960.00