2.00 Rating by ClearWebStats
rehberhost.net is 2 decades 11 months 2 weeks old. This website has a #787,702 rank in global traffic. It has a net as an domain extension. This website has a Google PageRank of 2 out of 10. The DNS for Rehberhost is hosted at 31.210.47.2. While no active threats were reported recently by users, rehberhost.net is SAFE to browse.
Get Custom Widget

Traffic Report of Rehberhost

Daily Unique Visitors: 611
Daily Pageviews: 1,222

Estimated Valuation

Income Per Day: $ 4.00
Estimated Worth: $ 960.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for rehberhost.net Good
WOT Privacy: WOT privacy rank for rehberhost.net Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View rehberhost.net Pagerank
Alexa Rank: 787,702
Domain Authority: Not Applicable
Google Pagerank
PR 2 out of 10
PageSpeed Score
Score: 68on 100
Siteadvisor Rating
View rehberhost.net site advisor rating Not Applicable

Where is rehberhost.net server located?

Hosted IP Address:

31.210.47.2 View other site hosted with rehberhost.net

Hosted Country:

rehberhost.net hosted country TR rehberhost.net hosted country

Location Latitude:

41.0138

Location Longitude:

28.9497

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View rehberhost.net HTML resources

Homepage Links Analysis

Ana sayfa - Linux Hosting, Mail Hosting, Domain Kayıt - RehberHOST.net Ankara

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • rehberhost.ne
  • rehberhost.com
  • rehberhost.org
  • rrehberhost.net
  • reehberhost.net
  • rehhberhost.net
  • rehbberhost.net
  • rehbeerhost.net
  • rehberrhost.net
  • rehberhhost.net
  • rehberhoost.net
  • rehberhosst.net
  • rehberhostt.net
  • ehberhost.net
  • rhberhost.net

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 26
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 31.210.47.2)

Hazır Emlak Sitesi | Emlak Sitesi | Emlak Ofisleri İçin 1 Saatte Hazır Web Sitesi

rehberhost.net favicon - emlaksitesikurulumu.com

Hazır Emlak Sitesi. Emlak ofislerine kısa süre içinde hazır emlak web sitesi. Farklı versiyonlar ile satışa sunduğumuz emlak sitesi tasarım paketlerim

View rehberhost.net Pagerank   rehberhost.net alexa rank 798,334   rehberhost.net website value $ 960.00

Hazır Oto Galeri Web Sitesi | Oto Galeri Sitesi

rehberhost.net favicon - otogalerisitesi.com

Oto galeri web sitesi. Büyük ve küçük ölçekli tüm oto galerileri için en ekonomik ve pratik hazır oto galeri sitesi. Oto galeri sitesi tasarımı Ankara

View rehberhost.net Pagerank   rehberhost.net alexa rank 2,045,024   rehberhost.net website value $ 240.00

Bergama İlçesi Web Sitesi | Bergama Haberleri, Videolar, Bergama Resimleri | Bergama İlçesi Web Sitesi

rehberhost.net favicon - bergamailcesi.com

Bergama İlçesi Web Sitesi. Bergama hakkında bilgiler, Bergama haberleri, Bergama Resimleri, Bergama Videoları, Bergama tarihi, Bergama tarihi yerler.

View rehberhost.net Pagerank   rehberhost.net alexa rank 880,814   rehberhost.net website value $ 720.00

Web Rehberi Site Ekle Firma Ekle Site Kaydet

rehberhost.net favicon - webkuyusu.com

Web Kuyusu, kaliteli içeriğin yer aldığı web dizinidir. Sitenizi web rehberimize ekleyerek aramıza katılın. Site ekle, hit kazan.

View rehberhost.net Pagerank   rehberhost.net alexa rank 689,673   rehberhost.net website value $ 960.00

Ankara Evden Eve Nakliyat Rehberi - Bölgelere Göre Ankara Nakliye Firmaları

rehberhost.net favicon - ankaraevdenevenakliyatfirmalari.com

Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.

View rehberhost.net Pagerank   rehberhost.net alexa rank 873,410   rehberhost.net website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 20 Nov 2014 01:54:50 GMT
Server:
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 5107
Connection: close
Content-Type: text/html; charset=utf-8

Domain Information for rehberhost.net

Domain Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM rehberhost.net registrar info
Registration Date: 2005-03-08 2 decades 11 months 2 weeks ago
Last Modified: 2014-05-19 1 decade 1 year 9 months ago
Expiration Date: 2015-03-08 1 decade 11 months 2 weeks ago
Domain Status: clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.rehberhost.net rehberhost.net name server information 31.169.72.146 rehberhost.net server is located in Turkey Turkey
ns2.rehberhost.net rehberhost.net name server information 31.169.72.147 rehberhost.net server is located in Turkey Turkey

DNS Record Analysis

Host Type TTL Extra
rehberhost.net A 14399 IP:31.210.47.2
rehberhost.net NS 21599 Target:ns3.rehberhost.net
rehberhost.net NS 21599 Target:ns2.rehberhost.net
rehberhost.net NS 21599 Target:ns4.rehberhost.net
rehberhost.net NS 21599 Target:ns1.rehberhost.net
rehberhost.net SOA 21599 MNAME:ns1.rehberhost.net
RNAME:info.rehberhost.net
Serial:2014061803
Refresh:86400
Retry:7200
Expire:3600000
Minimum TTL:86400
rehberhost.net MX 14399 Target:rehberhost.net

Similarly Ranked Websites to Rehberhost

HPCareer.Net, llc

rehberhost.net favicon - hpcareer.net

View rehberhost.net Pagerank   Alexa rank for rehberhost.net 787,702   website value of rehberhost.net $ 960.00

Üldinfo - Vihula Vallavalitsus

rehberhost.net favicon - vihula.ee

View rehberhost.net Pagerank   Alexa rank for rehberhost.net 787,703   website value of rehberhost.net $ 960.00

Super-H.fr - Hebergement web gratuit

rehberhost.net favicon - super-h.fr

Offre d'hébergement web 100% gratuite réservée aux associations à but non-lucratif.

View rehberhost.net Pagerank   Alexa rank for rehberhost.net 787,704   website value of rehberhost.net $ 960.00


Siti Web Torino - Siti Internet Torino - WebandYou - Webmaster Torino

rehberhost.net favicon - webandyou.net

Realizzazione siti web a Torino. Realizziamo siti internet a Torino con ottimizzazione e posizionamento sui motori di ricerca. Consulenza web marketing. Preventivo sito internet

View rehberhost.net Pagerank   Alexa rank for rehberhost.net 787,706   website value of rehberhost.net $ 960.00