Package: tmap 4.2.0.9000

tmap: Thematic Maps
Thematic maps are geographical maps in which spatial data distributions are visualized. This package offers a flexible, layer-based, and easy to use approach to create thematic maps, such as choropleths and bubble maps.
Authors:
tmap_4.2.0.9000.tar.gz
tmap_4.2.0.9000.zip(r-4.6)tmap_4.2.0.9000.zip(r-4.5)tmap_4.2.0.9000.zip(r-4.4)
tmap_4.2.0.9000.tgz(r-4.6-any)tmap_4.2.0.9000.tgz(r-4.5-any)
tmap_4.2.0.9000.tar.gz(r-4.6-any)tmap_4.2.0.9000.tar.gz(r-4.5-any)
tmap_4.2.0.9000.tgz(r-4.5-emscripten)
tmap.pdf |tmap.html✨
tmap/json (API)
NEWS
| # Install 'tmap' in R: |
| install.packages('tmap', repos = c('https://r-tmap.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/r-tmap/tmap/issues
Pkgdown/docs site:https://r-tmap.github.io
choropleth-mapsmapsspatialthematic-mapsvisualisation
Last updated from:4965253285. Checks:9 OK. Indexed: yes.
| Target | Result | Total time | Artifact |
|---|---|---|---|
| linux-devel-x86_64 | OK | 328 | |
| source / vignettes | OK | 342 | |
| linux-release-x86_64 | OK | 322 | |
| macos-devel-arm64 | OK | 210 | |
| macos-release-arm64 | OK | 191 | |
| windows-devel | OK | 280 | |
| windows-release | OK | 271 | |
| windows-oldrel | OK | 646 | |
| wasm-release | OK | 156 |
Exports:.TMAP.TMAP_GRID.TMAP_LEAFLET.tmap_providerschart_savedata_classdata_typeformat_aes_resultsget_fact_levels_naget_scale_defaultslwd_to_mmmake_by_varsmarker_iconopt_tm_bubblesopt_tm_dotsopt_tm_labelsopt_tm_linesopt_tm_markersopt_tm_polygonsopt_tm_rasteropt_tm_rgbopt_tm_sfopt_tm_squaresopt_tm_symbolsopt_tm_textqtmrenderTmaprtmrtmpshapeTMtheme_pstm_add_legendtm_animatetm_animate_fasttm_basemaptm_borderstm_bubblestm_chart_bartm_chart_boxtm_chart_donuttm_chart_heatmaptm_chart_histogramtm_chart_nonetm_chart_violintm_check_fixtm_compasstm_componentstm_consttm_creditstm_crstm_dotstm_elementtm_element_listtm_extra_inner_margintm_facetstm_facets_fliptm_facets_gridtm_facets_hstacktm_facets_pagewisetm_facets_stacktm_facets_vstacktm_facets_wraptm_filltm_formattm_graticulestm_gridtm_grouptm_insettm_isotm_label_formattm_labelstm_labels_highlightedtm_layouttm_legendtm_legend_bivariatetm_legend_combinetm_legend_hidetm_linestm_logotm_markerstm_minimaptm_mouse_coordinatestm_optionstm_place_legends_bottomtm_place_legends_insidetm_place_legends_lefttm_place_legends_righttm_place_legends_toptm_plottm_plot_ordertm_polygonstm_postm_pos_auto_intm_pos_auto_outtm_pos_intm_pos_on_toptm_pos_outtm_rastertm_remove_layertm_rgbtm_rgbatm_scaletm_scale_asistm_scale_bartm_scale_bivariatetm_scale_categoricaltm_scale_continuoustm_scale_continuous_logtm_scale_continuous_log10tm_scale_continuous_log1ptm_scale_continuous_log2tm_scale_continuous_pseudo_logtm_scale_continuous_sqrttm_scale_discretetm_scale_intervalstm_scale_ordinaltm_scale_ranktm_scale_rgbtm_scale_rgbatm_scalebartm_seqtm_sftm_shapetm_squarestm_styletm_symbolstm_texttm_tilestm_titletm_title_intm_title_outtm_varstm_viewtm_xlabtm_ylabtmap_animationtmap_arrangetmap_design_modetmap_devel_modetmap_formattmap_format_addtmap_grobtmap_iconstmap_lasttmap_leaflettmap_modetmap_optionstmap_options_difftmap_options_modetmap_options_resettmap_options_savetmap_overviewtmap_provider_creditstmap_providerstmap_savetmap_styletmap_style_catalogtmap_style_cataloguetmap_tiptmapAddLayerOptionstmapChartBinnedtmapChartBinned_categoricaltmapChartBinned_numerictmapChartBinned2dtmapChartBinned2d_catcattmapChartBinned2d_numcattmapChartBinned2d_numnumtmapChartNonetmapChartPasstmapChartRawtmapChartRaw_nnatmapGetCompGroupArgstmapGetShapeMeta1tmapGetShapeMeta2tmapGpartmapGridAuxPlottmapGridAuxPreparetmapGridCompPreparetmapGridDataPlottmapLeafletAuxPlottmapLeafletAuxPreparetmapLeafletCompPreparetmapLeafletDataPlottmapModetmapOutputtmapProxytmapScaletmapScaleAsIstmapScaleAutotmapScaleBivariatetmapScaleCategoricaltmapScaleIntervalstmapScaleRanktmapSeqtmapShapetmapSplitShptmapSubmitOptionstmapSubsetShptmapTpartmapTransCentroidtmapTransLinestmapTransPolygonstmapTransRastertmapUsrClstmapValuesBVV_bgcoltmapValuesBVV_coltmapValuesBVV_filltmapValuesCheck_angletmapValuesCheck_areatmapValuesCheck_bgcoltmapValuesCheck_bgcol_alphatmapValuesCheck_coltmapValuesCheck_col_alphatmapValuesCheck_filltmapValuesCheck_fill_alphatmapValuesCheck_fontfacetmapValuesCheck_ltytmapValuesCheck_lwdtmapValuesCheck_numtmapValuesCheck_shapetmapValuesCheck_sizetmapValuesCheck_skiptmapValuesCheck_texttmapValuesCheck_xmodtmapValuesColorize_angletmapValuesColorize_areatmapValuesColorize_bgcoltmapValuesColorize_bgcol_alphatmapValuesColorize_coltmapValuesColorize_col_alphatmapValuesColorize_filltmapValuesColorize_fill_alphatmapValuesColorize_fontfacetmapValuesColorize_ltytmapValuesColorize_lwdtmapValuesColorize_numtmapValuesColorize_shapetmapValuesColorize_sizetmapValuesColorize_skiptmapValuesColorize_texttmapValuesColorize_xmodtmapValuesCVV_angletmapValuesCVV_areatmapValuesCVV_bgcoltmapValuesCVV_bgcol_alphatmapValuesCVV_coltmapValuesCVV_col_alphatmapValuesCVV_filltmapValuesCVV_fill_alphatmapValuesCVV_fontfacetmapValuesCVV_ltytmapValuesCVV_lwdtmapValuesCVV_numtmapValuesCVV_shapetmapValuesCVV_sizetmapValuesCVV_skiptmapValuesCVV_texttmapValuesCVV_xmodtmapValuesCVV_ymodtmapValuesIsDiv_angletmapValuesIsDiv_areatmapValuesIsDiv_bgcoltmapValuesIsDiv_bgcol_alphatmapValuesIsDiv_coltmapValuesIsDiv_col_alphatmapValuesIsDiv_filltmapValuesIsDiv_fill_alphatmapValuesIsDiv_fontfacetmapValuesIsDiv_ltytmapValuesIsDiv_lwdtmapValuesIsDiv_numtmapValuesIsDiv_shapetmapValuesIsDiv_sizetmapValuesIsDiv_skiptmapValuesIsDiv_texttmapValuesIsDiv_xmodtmapValuesRange_angletmapValuesRange_areatmapValuesRange_bgcoltmapValuesRange_bgcol_alphatmapValuesRange_coltmapValuesRange_col_alphatmapValuesRange_filltmapValuesRange_fill_alphatmapValuesRange_fontfacetmapValuesRange_ltytmapValuesRange_lwdtmapValuesRange_numtmapValuesRange_shapetmapValuesRange_sizetmapValuesRange_skiptmapValuesRange_texttmapValuesRange_xmodtmapValuesScale_angletmapValuesScale_areatmapValuesScale_bgcoltmapValuesScale_bgcol_alphatmapValuesScale_coltmapValuesScale_col_alphatmapValuesScale_filltmapValuesScale_fill_alphatmapValuesScale_fontfacetmapValuesScale_ltytmapValuesScale_lwdtmapValuesScale_numtmapValuesScale_shapetmapValuesScale_sizetmapValuesScale_skiptmapValuesScale_texttmapValuesScale_xmodtmapValuesSubmit_angletmapValuesSubmit_areatmapValuesSubmit_bgcoltmapValuesSubmit_bgcol_alphatmapValuesSubmit_coltmapValuesSubmit_col_alphatmapValuesSubmit_filltmapValuesSubmit_fill_alphatmapValuesSubmit_fontfacetmapValuesSubmit_ltytmapValuesSubmit_lwdtmapValuesSubmit_numtmapValuesSubmit_shapetmapValuesSubmit_sizetmapValuesSubmit_skiptmapValuesSubmit_texttmapValuesSubmit_xmodtmapValuesSubmit_ymodtmapValuesVV_angletmapValuesVV_areatmapValuesVV_bgcoltmapValuesVV_bgcol_alphatmapValuesVV_coltmapValuesVV_col_alphatmapValuesVV_filltmapValuesVV_fill_alphatmapValuesVV_fontfacetmapValuesVV_ltytmapValuesVV_lwdtmapValuesVV_numtmapValuesVV_shapetmapValuesVV_sizetmapValuesVV_skiptmapValuesVV_texttmapValuesVV_xmodtoTitleCasetransform_valuesttmttmp
Dependencies:abindbase64encbslibcachemclassclassIntclicolorspacecols4allcrosstalkcurldata.tableDBIdigeste1071evaluatefarverfastmapfontawesomefsgeojsonsfgeometriesgluehighrhtmltoolshtmlwidgetshttpuvjquerylibjsonifyjsonliteKernSmoothknitrlabelinglaterlatticelazyevalleafemleafglleaflegendleafletleaflet.providersleafsynclifecycleloggerlwgeommagrittrmaptilesMASSmemoisemimeotelpngpromisesproxyR6rapidjsonrrappdirsrasterRColorBrewerRcpprlangrmarkdowns2sassscalesservrsfsfheadersspspacesXYZstarsstringdistterratinytextmaptoolsunitsviridisLitewkxfunXMLyaml
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Thematic Map Visualization | tmap-package tmap |
| Get basemap tiles providers | .tmap_providers tmap_providers tmap_provider_credits |
| Spatial data of global land cover | land |
| Spatial data of metropolitan areas | metro |
| Netherlands datasets | NLD_dist NLD_muni NLD_prov |
| Draw thematic map | knit_print.tmap print.tmap |
| Quick thematic map plot | qtm |
| Wrapper functions for using *tmap* in *shiny* | renderTmap tmapOutput tmapProxy tm_remove_layer |
| ggplot2 theme for proportional symbols | theme_ps |
| Map component: manual legend | tm_add_legend |
| Specify an animation | tm_animate tm_animate_fast |
| Map layer: basemap / overlay tiles | tm_basemap tm_tiles |
| Legend charts | tm_chart tm_chart_bar tm_chart_box tm_chart_donut tm_chart_heatmap tm_chart_histogram tm_chart_none tm_chart_violin |
| tmap options | tmap_options tmap_options_diff tmap_options_mode tmap_options_reset tmap_options_save tm_check_fix |
| Map component: compass | tm_compass |
| Group components | tm_components |
| tmap function to define a constant visual value | tm_const |
| Map component: (credits) text | tm_credits |
| Set the map projection (CRS) | tm_crs |
| Specify facets | tm_facets tm_facets_flip tm_facets_grid tm_facets_hstack tm_facets_pagewise tm_facets_stack tm_facets_vstack tm_facets_wrap |
| Coordinate grid / graticule lines | tm_graticules tm_grid |
| Layer group control | tm_group |
| Map component: inset maps and other objects | tm_inset |
| Map layer: iso (contour) | tm_iso |
| tmap function to specify labels | tm_label_format |
| Legend | tm_legend tm_legend_bivariate tm_legend_combine tm_legend_hide |
| Map layer: lines | opt_tm_lines tm_lines |
| Map component: logo | tm_logo |
| Map component: minimap | tm_minimap |
| Map component: mouse coordinates | tm_mouse_coordinates |
| tmap options | tm_options |
| tmap layout: helper functions | tm_extra_inner_margin tm_extra_innner_margin tm_place_legends_bottom tm_place_legends_inside tm_place_legends_left tm_place_legends_right tm_place_legends_top |
| Plot mode options | tm_plot |
| Determine plotting order of features | tm_plot_order |
| Map layer: polygons | opt_tm_polygons tm_borders tm_fill tm_polygons |
| Set the position of map components | tm_pos tm_pos_auto_in tm_pos_auto_out tm_pos_in tm_pos_on_top tm_pos_out |
| Map layer: raster | opt_tm_raster tm_raster |
| Map layer: rgb images | opt_tm_rgb tm_rgb tm_rgba |
| Scales: automatic scale | tm_scale |
| Scales: as is | tm_scale_asis |
| Scales: bivariate scale | tm_scale_bivariate |
| Scales: continuous scale | tm_scale_continuous tm_scale_continuous_log tm_scale_continuous_log10 tm_scale_continuous_log1p tm_scale_continuous_log2 tm_scale_continuous_pseudo_log tm_scale_continuous_sqrt |
| Scales: discrete scale | tm_scale_discrete |
| Scales: interval scale | tm_scale_intervals |
| Scales: categorical and ordinal scale | tm_scale_categorical tm_scale_ordinal |
| Scales: rank scale | tm_scale_rank |
| Scales: RGB | tm_scale_rgb tm_scale_rgba |
| Map component: scale bar | tm_scalebar |
| Specify a numeric sequence | tm_seq |
| Map layer: simple features | opt_tm_sf tm_sf |
| Shape (spatial object) specification | tm_shape |
| Layout options | tm_layout tm_style |
| Map layer: symbols | opt_tm_bubbles opt_tm_dots opt_tm_markers opt_tm_squares opt_tm_symbols tm_bubbles tm_dots tm_markers tm_squares tm_symbols |
| Map layer: text | opt_tm_labels opt_tm_text tm_labels tm_labels_highlighted tm_text |
| Map component: title | tm_title tm_title_in tm_title_out |
| tmap function to specify variables | tm_vars |
| View mode options | tm_view |
| Map: x and y labels | tm_xlab tm_ylab |
| Create animation | tmap_animation |
| Arrange small multiples in grid layout | knit_print.tmap_arrange print.tmap_arrange tmap_arrange |
| Set the design mode | tmap_design_mode |
| Set the development mode | tmap_devel_mode |
| Specify icons | marker_icon tmap_icons |
| Retrieve the last map to be modified or created | tmap_last |
| Export tmap to the format of the used graphics mode | tmap_grob tmap_leaflet |
| Set tmap mode to static plotting or interactive viewing | rtm rtmp tmap_mode ttm ttmp |
| Overview of tmap layers | tmap_overview |
| Save tmap | tmap_save |
| Set or get the default tmap style | tmap_style |
| Create a style catalogue | tmap_style_catalog tmap_style_catalogue |
| Print a random tip to the console | tmap_tip |
| Stacking of tmap elements | +.tmap tmap-element |
| World dataset | World |
| Spatial data of rivers | World_rivers |
