Package: tmap 4.2.0.9000

Martijn Tennekes

tmap: Thematic Maps

Thematic maps are geographical maps in which spatial data distributions are visualized. This package offers a flexible, layer-based, and easy to use approach to create thematic maps, such as choropleths and bubble maps.

Authors:Martijn Tennekes [aut, cre], Jakub Nowosad [ctb], Joel Gombin [ctb], Sebastian Jeworutzki [ctb], Kent Russell [ctb], Richard Zijdeman [ctb], John Clouse [ctb], Robin Lovelace [ctb], Jannes Muenchow [ctb], Olivier Roy [ctb], Edzer Pebesma [ctb], Hugh Graham [ctb], Michael D. Sumner [ctb], Tim Appelhans [ctb], Nick Bearman [ctb], Pukar Bhandari [ctb], Stéphane Guillou [ctb], Monika Anna Tomaszewska [ctb], Ajoke Onojeghuo [ctb], Jerome Guelat [ctb]

tmap_4.2.0.9000.tar.gz
tmap_4.2.0.9000.zip(r-4.6)tmap_4.2.0.9000.zip(r-4.5)tmap_4.2.0.9000.zip(r-4.4)
tmap_4.2.0.9000.tgz(r-4.6-any)tmap_4.2.0.9000.tgz(r-4.5-any)
tmap_4.2.0.9000.tar.gz(r-4.6-any)tmap_4.2.0.9000.tar.gz(r-4.5-any)
tmap_4.2.0.9000.tgz(r-4.5-emscripten)
tmap.pdf |tmap.html
tmap/json (API)
NEWS

# Install 'tmap' in R:
install.packages('tmap', repos = c('https://r-tmap.r-universe.dev', 'https://cloud.r-project.org'))

Bug tracker:https://github.com/r-tmap/tmap/issues

Pkgdown/docs site:https://r-tmap.github.io

Datasets:

On CRAN:

Conda:

choropleth-mapsmapsspatialthematic-mapsvisualisation

16.32 score 897 stars 28 packages 16k scripts 27k downloads 88 mentions 349 exports 81 dependencies

Last updated from:4965253285. Checks:9 OK. Indexed: yes.

TargetResultTotal timeArtifact
linux-devel-x86_64OK328
source / vignettesOK342
linux-release-x86_64OK322
macos-devel-arm64OK210
macos-release-arm64OK191
windows-develOK280
windows-releaseOK271
windows-oldrelOK646
wasm-releaseOK156

Exports:.TMAP.TMAP_GRID.TMAP_LEAFLET.tmap_providerschart_savedata_classdata_typeformat_aes_resultsget_fact_levels_naget_scale_defaultslwd_to_mmmake_by_varsmarker_iconopt_tm_bubblesopt_tm_dotsopt_tm_labelsopt_tm_linesopt_tm_markersopt_tm_polygonsopt_tm_rasteropt_tm_rgbopt_tm_sfopt_tm_squaresopt_tm_symbolsopt_tm_textqtmrenderTmaprtmrtmpshapeTMtheme_pstm_add_legendtm_animatetm_animate_fasttm_basemaptm_borderstm_bubblestm_chart_bartm_chart_boxtm_chart_donuttm_chart_heatmaptm_chart_histogramtm_chart_nonetm_chart_violintm_check_fixtm_compasstm_componentstm_consttm_creditstm_crstm_dotstm_elementtm_element_listtm_extra_inner_margintm_facetstm_facets_fliptm_facets_gridtm_facets_hstacktm_facets_pagewisetm_facets_stacktm_facets_vstacktm_facets_wraptm_filltm_formattm_graticulestm_gridtm_grouptm_insettm_isotm_label_formattm_labelstm_labels_highlightedtm_layouttm_legendtm_legend_bivariatetm_legend_combinetm_legend_hidetm_linestm_logotm_markerstm_minimaptm_mouse_coordinatestm_optionstm_place_legends_bottomtm_place_legends_insidetm_place_legends_lefttm_place_legends_righttm_place_legends_toptm_plottm_plot_ordertm_polygonstm_postm_pos_auto_intm_pos_auto_outtm_pos_intm_pos_on_toptm_pos_outtm_rastertm_remove_layertm_rgbtm_rgbatm_scaletm_scale_asistm_scale_bartm_scale_bivariatetm_scale_categoricaltm_scale_continuoustm_scale_continuous_logtm_scale_continuous_log10tm_scale_continuous_log1ptm_scale_continuous_log2tm_scale_continuous_pseudo_logtm_scale_continuous_sqrttm_scale_discretetm_scale_intervalstm_scale_ordinaltm_scale_ranktm_scale_rgbtm_scale_rgbatm_scalebartm_seqtm_sftm_shapetm_squarestm_styletm_symbolstm_texttm_tilestm_titletm_title_intm_title_outtm_varstm_viewtm_xlabtm_ylabtmap_animationtmap_arrangetmap_design_modetmap_devel_modetmap_formattmap_format_addtmap_grobtmap_iconstmap_lasttmap_leaflettmap_modetmap_optionstmap_options_difftmap_options_modetmap_options_resettmap_options_savetmap_overviewtmap_provider_creditstmap_providerstmap_savetmap_styletmap_style_catalogtmap_style_cataloguetmap_tiptmapAddLayerOptionstmapChartBinnedtmapChartBinned_categoricaltmapChartBinned_numerictmapChartBinned2dtmapChartBinned2d_catcattmapChartBinned2d_numcattmapChartBinned2d_numnumtmapChartNonetmapChartPasstmapChartRawtmapChartRaw_nnatmapGetCompGroupArgstmapGetShapeMeta1tmapGetShapeMeta2tmapGpartmapGridAuxPlottmapGridAuxPreparetmapGridCompPreparetmapGridDataPlottmapLeafletAuxPlottmapLeafletAuxPreparetmapLeafletCompPreparetmapLeafletDataPlottmapModetmapOutputtmapProxytmapScaletmapScaleAsIstmapScaleAutotmapScaleBivariatetmapScaleCategoricaltmapScaleIntervalstmapScaleRanktmapSeqtmapShapetmapSplitShptmapSubmitOptionstmapSubsetShptmapTpartmapTransCentroidtmapTransLinestmapTransPolygonstmapTransRastertmapUsrClstmapValuesBVV_bgcoltmapValuesBVV_coltmapValuesBVV_filltmapValuesCheck_angletmapValuesCheck_areatmapValuesCheck_bgcoltmapValuesCheck_bgcol_alphatmapValuesCheck_coltmapValuesCheck_col_alphatmapValuesCheck_filltmapValuesCheck_fill_alphatmapValuesCheck_fontfacetmapValuesCheck_ltytmapValuesCheck_lwdtmapValuesCheck_numtmapValuesCheck_shapetmapValuesCheck_sizetmapValuesCheck_skiptmapValuesCheck_texttmapValuesCheck_xmodtmapValuesColorize_angletmapValuesColorize_areatmapValuesColorize_bgcoltmapValuesColorize_bgcol_alphatmapValuesColorize_coltmapValuesColorize_col_alphatmapValuesColorize_filltmapValuesColorize_fill_alphatmapValuesColorize_fontfacetmapValuesColorize_ltytmapValuesColorize_lwdtmapValuesColorize_numtmapValuesColorize_shapetmapValuesColorize_sizetmapValuesColorize_skiptmapValuesColorize_texttmapValuesColorize_xmodtmapValuesCVV_angletmapValuesCVV_areatmapValuesCVV_bgcoltmapValuesCVV_bgcol_alphatmapValuesCVV_coltmapValuesCVV_col_alphatmapValuesCVV_filltmapValuesCVV_fill_alphatmapValuesCVV_fontfacetmapValuesCVV_ltytmapValuesCVV_lwdtmapValuesCVV_numtmapValuesCVV_shapetmapValuesCVV_sizetmapValuesCVV_skiptmapValuesCVV_texttmapValuesCVV_xmodtmapValuesCVV_ymodtmapValuesIsDiv_angletmapValuesIsDiv_areatmapValuesIsDiv_bgcoltmapValuesIsDiv_bgcol_alphatmapValuesIsDiv_coltmapValuesIsDiv_col_alphatmapValuesIsDiv_filltmapValuesIsDiv_fill_alphatmapValuesIsDiv_fontfacetmapValuesIsDiv_ltytmapValuesIsDiv_lwdtmapValuesIsDiv_numtmapValuesIsDiv_shapetmapValuesIsDiv_sizetmapValuesIsDiv_skiptmapValuesIsDiv_texttmapValuesIsDiv_xmodtmapValuesRange_angletmapValuesRange_areatmapValuesRange_bgcoltmapValuesRange_bgcol_alphatmapValuesRange_coltmapValuesRange_col_alphatmapValuesRange_filltmapValuesRange_fill_alphatmapValuesRange_fontfacetmapValuesRange_ltytmapValuesRange_lwdtmapValuesRange_numtmapValuesRange_shapetmapValuesRange_sizetmapValuesRange_skiptmapValuesRange_texttmapValuesRange_xmodtmapValuesScale_angletmapValuesScale_areatmapValuesScale_bgcoltmapValuesScale_bgcol_alphatmapValuesScale_coltmapValuesScale_col_alphatmapValuesScale_filltmapValuesScale_fill_alphatmapValuesScale_fontfacetmapValuesScale_ltytmapValuesScale_lwdtmapValuesScale_numtmapValuesScale_shapetmapValuesScale_sizetmapValuesScale_skiptmapValuesScale_texttmapValuesScale_xmodtmapValuesSubmit_angletmapValuesSubmit_areatmapValuesSubmit_bgcoltmapValuesSubmit_bgcol_alphatmapValuesSubmit_coltmapValuesSubmit_col_alphatmapValuesSubmit_filltmapValuesSubmit_fill_alphatmapValuesSubmit_fontfacetmapValuesSubmit_ltytmapValuesSubmit_lwdtmapValuesSubmit_numtmapValuesSubmit_shapetmapValuesSubmit_sizetmapValuesSubmit_skiptmapValuesSubmit_texttmapValuesSubmit_xmodtmapValuesSubmit_ymodtmapValuesVV_angletmapValuesVV_areatmapValuesVV_bgcoltmapValuesVV_bgcol_alphatmapValuesVV_coltmapValuesVV_col_alphatmapValuesVV_filltmapValuesVV_fill_alphatmapValuesVV_fontfacetmapValuesVV_ltytmapValuesVV_lwdtmapValuesVV_numtmapValuesVV_shapetmapValuesVV_sizetmapValuesVV_skiptmapValuesVV_texttmapValuesVV_xmodtoTitleCasetransform_valuesttmttmp

Dependencies:abindbase64encbslibcachemclassclassIntclicolorspacecols4allcrosstalkcurldata.tableDBIdigeste1071evaluatefarverfastmapfontawesomefsgeojsonsfgeometriesgluehighrhtmltoolshtmlwidgetshttpuvjquerylibjsonifyjsonliteKernSmoothknitrlabelinglaterlatticelazyevalleafemleafglleaflegendleafletleaflet.providersleafsynclifecycleloggerlwgeommagrittrmaptilesMASSmemoisemimeotelpngpromisesproxyR6rapidjsonrrappdirsrasterRColorBrewerRcpprlangrmarkdowns2sassscalesservrsfsfheadersspspacesXYZstarsstringdistterratinytextmaptoolsunitsviridisLitewkxfunXMLyaml

Readme and manuals

Help Manual

Help pageTopics
Thematic Map Visualizationtmap-package tmap
Get basemap tiles providers.tmap_providers tmap_providers tmap_provider_credits
Spatial data of global land coverland
Spatial data of metropolitan areasmetro
Netherlands datasetsNLD_dist NLD_muni NLD_prov
Draw thematic mapknit_print.tmap print.tmap
Quick thematic map plotqtm
Wrapper functions for using *tmap* in *shiny*renderTmap tmapOutput tmapProxy tm_remove_layer
ggplot2 theme for proportional symbolstheme_ps
Map component: manual legendtm_add_legend
Specify an animationtm_animate tm_animate_fast
Map layer: basemap / overlay tilestm_basemap tm_tiles
Legend chartstm_chart tm_chart_bar tm_chart_box tm_chart_donut tm_chart_heatmap tm_chart_histogram tm_chart_none tm_chart_violin
tmap optionstmap_options tmap_options_diff tmap_options_mode tmap_options_reset tmap_options_save tm_check_fix
Map component: compasstm_compass
Group componentstm_components
tmap function to define a constant visual valuetm_const
Map component: (credits) texttm_credits
Set the map projection (CRS)tm_crs
Specify facetstm_facets tm_facets_flip tm_facets_grid tm_facets_hstack tm_facets_pagewise tm_facets_stack tm_facets_vstack tm_facets_wrap
Coordinate grid / graticule linestm_graticules tm_grid
Layer group controltm_group
Map component: inset maps and other objectstm_inset
Map layer: iso (contour)tm_iso
tmap function to specify labelstm_label_format
Legendtm_legend tm_legend_bivariate tm_legend_combine tm_legend_hide
Map layer: linesopt_tm_lines tm_lines
Map component: logotm_logo
Map component: minimaptm_minimap
Map component: mouse coordinatestm_mouse_coordinates
tmap optionstm_options
tmap layout: helper functionstm_extra_inner_margin tm_extra_innner_margin tm_place_legends_bottom tm_place_legends_inside tm_place_legends_left tm_place_legends_right tm_place_legends_top
Plot mode optionstm_plot
Determine plotting order of featurestm_plot_order
Map layer: polygonsopt_tm_polygons tm_borders tm_fill tm_polygons
Set the position of map componentstm_pos tm_pos_auto_in tm_pos_auto_out tm_pos_in tm_pos_on_top tm_pos_out
Map layer: rasteropt_tm_raster tm_raster
Map layer: rgb imagesopt_tm_rgb tm_rgb tm_rgba
Scales: automatic scaletm_scale
Scales: as istm_scale_asis
Scales: bivariate scaletm_scale_bivariate
Scales: continuous scaletm_scale_continuous tm_scale_continuous_log tm_scale_continuous_log10 tm_scale_continuous_log1p tm_scale_continuous_log2 tm_scale_continuous_pseudo_log tm_scale_continuous_sqrt
Scales: discrete scaletm_scale_discrete
Scales: interval scaletm_scale_intervals
Scales: categorical and ordinal scaletm_scale_categorical tm_scale_ordinal
Scales: rank scaletm_scale_rank
Scales: RGBtm_scale_rgb tm_scale_rgba
Map component: scale bartm_scalebar
Specify a numeric sequencetm_seq
Map layer: simple featuresopt_tm_sf tm_sf
Shape (spatial object) specificationtm_shape
Layout optionstm_layout tm_style
Map layer: symbolsopt_tm_bubbles opt_tm_dots opt_tm_markers opt_tm_squares opt_tm_symbols tm_bubbles tm_dots tm_markers tm_squares tm_symbols
Map layer: textopt_tm_labels opt_tm_text tm_labels tm_labels_highlighted tm_text
Map component: titletm_title tm_title_in tm_title_out
tmap function to specify variablestm_vars
View mode optionstm_view
Map: x and y labelstm_xlab tm_ylab
Create animationtmap_animation
Arrange small multiples in grid layoutknit_print.tmap_arrange print.tmap_arrange tmap_arrange
Set the design modetmap_design_mode
Set the development modetmap_devel_mode
Specify iconsmarker_icon tmap_icons
Retrieve the last map to be modified or createdtmap_last
Export tmap to the format of the used graphics modetmap_grob tmap_leaflet
Set tmap mode to static plotting or interactive viewingrtm rtmp tmap_mode ttm ttmp
Overview of tmap layerstmap_overview
Save tmaptmap_save
Set or get the default tmap styletmap_style
Create a style cataloguetmap_style_catalog tmap_style_catalogue
Print a random tip to the consoletmap_tip
Stacking of tmap elements+.tmap tmap-element
World datasetWorld
Spatial data of riversWorld_rivers