1.67 Rating by ClearWebStats
It has a com as an domain extension. The DNS for Proventureimpex is hosted at 103.24.202.75. While no active threats were reported recently by users, proventureimpex.com is SAFE to browse.
Get Custom Widget

Traffic Report of Proventureimpex

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View proventureimpex.com site advisor rating Not Applicable

Where is proventureimpex.com server located?

Hosted IP Address:

103.24.202.75 View other site hosted with proventureimpex.com

Hosted Country:

proventureimpex.com hosted country NL proventureimpex.com hosted country

Location Latitude:

52.374

Location Longitude:

4.88969

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View proventureimpex.com HTML resources

Homepage Links Analysis

Index of /

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • proventureimpex.co
  • proventureimpex.cm
  • proventureimpex.con
  • proventureimpex.net
  • proventureimpex.org
  • pproventureimpex.com
  • prroventureimpex.com
  • prooventureimpex.com
  • provventureimpex.com
  • proveentureimpex.com
  • provenntureimpex.com
  • proventtureimpex.com
  • proventuureimpex.com
  • proventurreimpex.com
  • proventureeimpex.com

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.202.75)

.:: Kuchipudi dance classes in Dallas, Texas, Indian Classical dance classes in DFW, Abhinaya Kuchipudi Dance Academy ::.

proventureimpex.com favicon - akdanceacademy.com

Indian Classical dance classes in DFW,Indian Classical dance classes in texas,Abhinaya Kuchipudi Dance Academy, Kalyani Avula, Kuchipudi, Kuchipudi Dance, Texas , Kuchipudi Dance, Frisco ,Kuchipudi Dance, Flower Mound, Kuchipudi Dance, Plano,Kuchipudi Dance, Irving,Indian Classical Dance, Texas,Indian Classical Dance, Frisco, Indian Classical Dance, Flower Mound, Indian Classical Dance, Plano, Indian Classical Dance, Irving, Indian Classical...

View proventureimpex.com Pagerank   proventureimpex.com alexa rank Not Applicable   proventureimpex.com website value $ 8.95

Chilli India

proventureimpex.com favicon - chilliindia.com.au

View proventureimpex.com Pagerank   proventureimpex.com alexa rank 19,798,671   proventureimpex.com website value $ 8.95

.:: Anara Group ::.

proventureimpex.com favicon - anaragroup.com

View proventureimpex.com Pagerank   proventureimpex.com alexa rank Not Applicable   proventureimpex.com website value $ 8.95

.:: Indian Olympaids ::.

proventureimpex.com favicon - indianolympiads.com

View proventureimpex.com Pagerank   proventureimpex.com alexa rank Not Applicable   proventureimpex.com website value $ 8.95

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

proventureimpex.com favicon - srisubrahmanyaswamydevalayamskandagiri.org

View proventureimpex.com Pagerank   proventureimpex.com alexa rank 1,178,223   proventureimpex.com website value $ 720.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 09 Sep 2016 12:58:12 GMT
Server: Apache
Content-Length: 363
Content-Type: text/html;charset=ISO-8859-1

Similarly Ranked Websites to Proventureimpex

Just a moment...

proventureimpex.com favicon - absolutefiction.com

View proventureimpex.com Pagerank   Alexa rank for proventureimpex.com Not Applicable   website value of proventureimpex.com $ 15.95

SCOP agyRem Conseil - La SCOP agyRem Conseil

proventureimpex.com favicon - agyrem.com

La SCOP agyRem Conseil est un cabinet coopératif engagé dans la professionnalisation de l'économie sociale et la promotion de la RSE en entreprise

View proventureimpex.com Pagerank   Alexa rank for proventureimpex.com Not Applicable   website value of proventureimpex.com $ 8.95

Wyvern Jubilee Morris - Welcome One And All

proventureimpex.com favicon - wjm.org.uk

Wyvern Jubilee Morris

View proventureimpex.com Pagerank   Alexa rank for proventureimpex.com Not Applicable   website value of proventureimpex.com $ 8.95

Leaders Only - Keys of Spinal Cord Injuries

proventureimpex.com favicon - leadersonly.info

Exploring the options of treatment and supplies of the disabled and those with brain and traumatic spinal cord injury.

View proventureimpex.com Pagerank   Alexa rank for proventureimpex.com Not Applicable   website value of proventureimpex.com $ 8.95

eBuy Bangladesh: Bangladesh largest free online Real Estate Site|Largest Online Realestate Agent and Buy/Sell in Bangladesh|Real Estate Market in Bangladesh|Realestate Project and Ready Apartment...

proventureimpex.com favicon - ebuybd.info

Real Estate Market in Bangladesh, Real Estate Market in Bangladesh, Realestate Project and Ready Apartment Listing in Bangladesh, Online Shopping in Bangladesh, Buy/Sell in Bangladesh, buy flat and apartment in bangladesh, apartment price,land price

View proventureimpex.com Pagerank   Alexa rank for proventureimpex.com Not Applicable   website value of proventureimpex.com $ 8.95