2.20 Rating by ClearWebStats
mediacenterstreams.com is 6 years 8 months 2 days old. It has a com as an domain extension. The DNS for Mediacenterstreams is hosted at 192.186.194.69. While no active threats were reported recently by users, mediacenterstreams.com is SAFE to browse.
Get Custom Widget

Traffic Report of Mediacenterstreams

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View mediacenterstreams.com site advisor rating Not Applicable

Where is mediacenterstreams.com server located?

Hosted IP Address:

192.186.194.69 View other site hosted with mediacenterstreams.com

Hosted Country:

mediacenterstreams.com hosted country US mediacenterstreams.com hosted country

Location Latitude:

33.6013

Location Longitude:

-111.8867

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View mediacenterstreams.com HTML resources

Homepage Links Analysis

403 Forbidden

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • mediacenterstreams.co
  • mediacenterstreams.cm
  • mediacenterstreams.con
  • mediacenterstreams.net
  • mediacenterstreams.org
  • mmediacenterstreams.com
  • meediacenterstreams.com
  • meddiacenterstreams.com
  • mediiacenterstreams.com
  • mediaacenterstreams.com
  • mediaccenterstreams.com
  • mediaceenterstreams.com
  • mediacennterstreams.com
  • mediacentterstreams.com
  • mediacenteerstreams.com

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.186.194.69)

Future Stars - Summer Sports and Specialty Camps in New York

mediacenterstreams.com favicon - fscamps.com

Kids love Future Stars sports camps. Join us for a summer of sports and fun in Westchester or Long Island. Soccer, Tennis, Baseball, basketball and more.

View mediacenterstreams.com Pagerank   mediacenterstreams.com alexa rank 3,339,322   mediacenterstreams.com website value $ 240.00

Pocket Keto – a pocket guide to ketogenic living

mediacenterstreams.com favicon - pocketketo.com

View mediacenterstreams.com Pagerank   mediacenterstreams.com alexa rank Not Applicable   mediacenterstreams.com website value $ 8.95

My blog – Just another WordPress site

mediacenterstreams.com favicon - utterfrugal.com

View mediacenterstreams.com Pagerank   mediacenterstreams.com alexa rank Not Applicable   mediacenterstreams.com website value $ 8.95

NHS Scotland scorecard

mediacenterstreams.com favicon - nhsscotland-scorecard.org

View mediacenterstreams.com Pagerank   mediacenterstreams.com alexa rank Not Applicable   mediacenterstreams.com website value $ 8.95

WELCOME TO KADIRI LAKSHMI NARASIMHA SWAMY TEMPLE

mediacenterstreams.com favicon - kadirilakshminarasimhaswamytemple.com

View mediacenterstreams.com Pagerank   mediacenterstreams.com alexa rank Not Applicable   mediacenterstreams.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 403 Forbidden
Date: Fri, 05 Jul 2019 06:43:43 GMT
Server: Apache
Content-Length: 328
Content-Type: text/html; charset=iso-8859-1

Domain Information for mediacenterstreams.com

Domain Registrar: GODADDY.COM, LLC mediacenterstreams.com registrar info
Registration Date: 2019-06-25 6 years 8 months 2 days ago
Last Modified: 2019-06-25 6 years 8 months 2 days ago
Domain Status:
  • clientDeleteProhibited
  • clientRenewProhibited
  • clientTransferProhibited
  • clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns07.domaincontrol.com mediacenterstreams.com name server information 97.74.103.4 mediacenterstreams.com server is located in United States United States
ns08.domaincontrol.com mediacenterstreams.com name server information 173.201.71.4 mediacenterstreams.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
mediacenterstreams.com A 10799 IP:192.186.194.69
mediacenterstreams.com NS 3599 Target:ns07.domaincontrol.com
mediacenterstreams.com NS 3599 Target:ns08.domaincontrol.com
mediacenterstreams.com SOA 3599 MNAME:ns07.domaincontrol.com
RNAME:dns.jomax.net
Serial:2019062501
Refresh:28800
Retry:7200
Expire:604800
Minimum TTL:600

Similarly Ranked Websites to Mediacenterstreams

Just a moment...

mediacenterstreams.com favicon - absolutefiction.com

View mediacenterstreams.com Pagerank   Alexa rank for mediacenterstreams.com Not Applicable   website value of mediacenterstreams.com $ 15.95

SCOP agyRem Conseil - La SCOP agyRem Conseil

mediacenterstreams.com favicon - agyrem.com

La SCOP agyRem Conseil est un cabinet coopératif engagé dans la professionnalisation de l'économie sociale et la promotion de la RSE en entreprise

View mediacenterstreams.com Pagerank   Alexa rank for mediacenterstreams.com Not Applicable   website value of mediacenterstreams.com $ 8.95

Wyvern Jubilee Morris - Welcome One And All

mediacenterstreams.com favicon - wjm.org.uk

Wyvern Jubilee Morris

View mediacenterstreams.com Pagerank   Alexa rank for mediacenterstreams.com Not Applicable   website value of mediacenterstreams.com $ 8.95

Leaders Only - Keys of Spinal Cord Injuries

mediacenterstreams.com favicon - leadersonly.info

Exploring the options of treatment and supplies of the disabled and those with brain and traumatic spinal cord injury.

View mediacenterstreams.com Pagerank   Alexa rank for mediacenterstreams.com Not Applicable   website value of mediacenterstreams.com $ 8.95

eBuy Bangladesh: Bangladesh largest free online Real Estate Site|Largest Online Realestate Agent and Buy/Sell in Bangladesh|Real Estate Market in Bangladesh|Realestate Project and Ready Apartment...

mediacenterstreams.com favicon - ebuybd.info

Real Estate Market in Bangladesh, Real Estate Market in Bangladesh, Realestate Project and Ready Apartment Listing in Bangladesh, Online Shopping in Bangladesh, Buy/Sell in Bangladesh, buy flat and apartment in bangladesh, apartment price,land price

View mediacenterstreams.com Pagerank   Alexa rank for mediacenterstreams.com Not Applicable   website value of mediacenterstreams.com $ 8.95

Full WHOIS Lookup for mediacenterstreams.com

Domain Name: MEDIACENTERSTREAMS.COM
Registry Domain ID: 2406026086_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-06-25T15:16:26Z
Creation Date: 2019-06-25T15:16:26Z
Registry Expiry Date: 2020-06-25T15:16:26Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS07.DOMAINCONTROL.COM
Name Server: NS08.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-07-05T06:43:36Z