Web stats for Letsplayminecraftvideos - letsplayminecraftvideos.com
All you favourite Minecraft Videos Under One Roof!
Traffic Report of Letsplayminecraftvideos
| Daily Unique Visitors: | 23 |
| Daily Pageviews: | 46 |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | 21,107,847 |
| Domain Authority: | Not Applicable |
Where is letsplayminecraftvideos.com server located?
Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Similar Domain Names
These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.
- letsplayminecraftvideos.co
- letsplayminecraftvideos.cm
- letsplayminecraftvideos.con
- letsplayminecraftvideos.net
- letsplayminecraftvideos.org
- lletsplayminecraftvideos.com
- leetsplayminecraftvideos.com
- lettsplayminecraftvideos.com
- letssplayminecraftvideos.com
- letspplayminecraftvideos.com
- letspllayminecraftvideos.com
- letsplaayminecraftvideos.com
- letsplayyminecraftvideos.com
- letsplaymminecraftvideos.com
- letsplaymiinecraftvideos.com
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | 11 |
| H3 Headings: | 6 | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 2 | Total Images: | 18 |
| Google Adsense: | pub-8079950109197396 | Google Analytics: | UA-18217863-25 |
Websites Hosted on Same IP (i.e. 88.208.252.223)
ACRE | Action with Communities in Rural England
Action with Communities in Rural England is the national voice for the community support agencies who make up the country’s largest rural network
Kieron Williamson
Here you will find everything you might need or want to know about Kieron and his incredible talent as one of the world’s youngest and most internationally
AbleStable: Serving the Creative Community
The home page of AbleStable, an award winning web site dedicated to encourage and support creativity. AbleStable runs a listing of creative professionals, an on-line exhibitions area, a creative product area, and is an invaluable source of freeware, articles, and reviews for and about creative people.
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 10 Aug 2016 21:33:09 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
X-UA-Compatible: IE=edge
Link:
Domain Information for letsplayminecraftvideos.com
Domain Nameserver Information
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| letsplayminecraftvideos.com | A | 3579 |
IP:88.208.252.223 |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns2.livedns.co.uk |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns3.livedns.co.uk |
| letsplayminecraftvideos.com | NS | 3600 |
Target:ns1.livedns.co.uk |
| letsplayminecraftvideos.com | SOA | 3600 |
MNAME:ns1.livedns.co.uk RNAME:admin.letsplayminecraftvideos.com Serial:1418169416 Refresh:10800 Retry:3600 Expire:604800 Minimum TTL:3600 |
| letsplayminecraftvideos.com | MX | 3600 |
Priority:10 Target:mailserver.letsplayminecraftvideos.com |
| letsplayminecraftvideos.com | TXT | 3600 |
TXT:google-site-verification=NjGdbhWQcQ_GvBV Fh7no_VktJuxwDyn47lNRHuL8D9E |
Similarly Ranked Websites to Letsplayminecraftvideos
Blue Ridge Pictures | 828-505-6312
Wedding Photography & Videography, Family Portraits, Seniors, Advertising, Studio, Fashion, Model, Product, Website, Food, Real Estate, Film Projects
Painted Fish Cafe & Beer Bar
A truly unique upscale dining experience in Banner Elk, North Carolina. Recognizable, homespun dishes—always with a twist at surprisingly reasonable prices.
The Marcello Giordani Foundation
The official website of The Marcello Giordani Foundation.
Humane Slaughter Equipment, Captive Bolt Stunners
Humane slaughter equipment, bolt stunners provided by UK based Accles and Shelvoke.
Full WHOIS Lookup for letsplayminecraftvideos.com
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: LETSPLAYMINECRAFTVIDEOS.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Updated Date: 31-jul-2016
Creation Date: 27-jul-2014
Expiration Date: 27-jul-2017
>>> Last update of whois database: Wed, 10 Aug 2016 21:33:18 GMT
Germany