Web stats for Kievapts - kievapts.com

If you need Kiev Apartments, Rent Kiev Apartment, Kiev Ukraine Apartments you've found the right place! American owned company.

2.00 Rating by ClearWebStats
kievapts.com is 1 decade 9 years 7 months old. This website has a #873,410 rank in global traffic. It has a com as an domain extension. This website has a Google PageRank of 4 out of 10. The DNS for Kievapts is hosted at 206.214.223.42. While no active threats were reported recently by users, kievapts.com is SAFE to browse.
Get Custom Widget

Traffic Report of Kievapts

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: 1,320
Yahoo Indexed Pages: 1,149
Bing Indexed Pages: 173

Search Engine Backlinks

Google Backlinks: 12
Bing Backlinks: 602

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View kievapts.com Pagerank
Alexa Rank: 873,410
Domain Authority: Not Applicable
Google Pagerank
PR 4 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View kievapts.com site advisor rating No Risk Issues

Where is kievapts.com server located?

Hosted IP Address:

206.214.223.42 View other site hosted with kievapts.com

Hosted Country:

kievapts.com hosted country ZZ kievapts.com hosted country

Location Latitude:

Not Applicable

Location Longitude:

Not Applicable

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View kievapts.com HTML resources

Homepage Links Analysis

View kievapts.com homepage link analysis

Kiev Apartments - Rent Kiev Apartment in Ukraine

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • kievapts.co
  • kievapts.cm
  • kievapts.con
  • kievapts.net
  • kievapts.org
  • kkievapts.com
  • kiievapts.com
  • kieevapts.com
  • kievvapts.com
  • kievaapts.com
  • kievappts.com
  • kievaptts.com
  • kievaptss.com
  • ievapts.com
  • kevapts.com

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Domain Information for kievapts.com

Domain Registrar: GODADDY.COM, INC. kievapts.com registrar info
Registration Date: 2006-06-28 1 decade 9 years 7 months ago
Last Modified: 2010-01-26 1 decade 6 years 3 weeks ago
Expiration Date: 2012-06-28 1 decade 3 years 7 months ago

Domain Nameserver Information

Host IP Address Country
ns.servint.com kievapts.com name server information 85.17.150.23 kievapts.com server is located in Netherlands Netherlands
ns2.servint.com kievapts.com name server information 62.212.64.121 kievapts.com server is located in Netherlands Netherlands

Similarly Ranked Websites to Kievapts

Ankara Evden Eve Nakliyat Rehberi - Bölgelere Göre Ankara Nakliye Firmaları

kievapts.com favicon - ankaraevdenevenakliyatfirmalari.com

Ankara nakliyat rehberi. Ankara Evden Eve Nakliye Firmalarının Ankara ilçelerine göre listelendiği nakliye rehberi. Ankara ev taşıma firmaları.

View kievapts.com Pagerank   Alexa rank for kievapts.com 873,410   website value of kievapts.com $ 720.00

KOSGEB Girişimcilik Destek Programı - Girişimcilik Desteği

kievapts.com favicon - girisimcilikdestegi.com

View kievapts.com Pagerank   Alexa rank for kievapts.com 873,410   website value of kievapts.com $ 720.00

Praxis S.A.

kievapts.com favicon - praxis.pl

Dystrybucja nośników magnetycznych, materiałów eksploatacyjnych do drukarek i kopiarek (atramenty / głowice z tuszem, tonery, taśmy barwiące, papiery / folie) oraz części serwisowych do urządzeń biurowych. Sprzedaż komputerów, urządzeń peryferyjnych

View kievapts.com Pagerank   Alexa rank for kievapts.com 873,411   website value of kievapts.com $ 720.00

Wild Mint ~ Natural, Eco Friendly Products & Organic Products

kievapts.com favicon - wildmintshop.com

Wild Mint is helping families live a more natural, eco friendly lifestyle with eco friendly products and organic products. Shop and learn about healthier living with green companies like ours!

View kievapts.com Pagerank   Alexa rank for kievapts.com 873,412   website value of kievapts.com $ 720.00

Discounts and coupons

kievapts.com favicon - discountread.com

Discounts and coupons

View kievapts.com Pagerank   Alexa rank for kievapts.com 873,413   website value of kievapts.com $ 720.00
Copyright © 2026 ClearWebStats.com, All Rights Reserved.
All brand names, logos, and trademarks appearing on this site are the property of their respective owners. ClearWebStats is an independent service that provides publicly available website statistics and is not affiliated with, endorsed by, or sponsored by any brand or website featured on this platform.