2.20 Rating by ClearWebStats
jayenterprise.co is 2 decades 5 years 8 months old. This website has a #11,389,778 rank in global traffic. It has a co as an domain extension. The DNS for Jayenterprise is hosted at 162.241.148.33. While no active threats were reported recently by users, jayenterprise.co is SAFE to browse.
Get Custom Widget

Traffic Report of Jayenterprise

Daily Unique Visitors: 42
Daily Pageviews: 84

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 11,389,778
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 63on 100
Siteadvisor Rating
View jayenterprise.co site advisor rating Not Applicable

Where is jayenterprise.co server located?

Hosted IP Address:

162.241.148.33 View other site hosted with jayenterprise.co

Hosted Country:

jayenterprise.co hosted country US jayenterprise.co hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View jayenterprise.co HTML resources

Homepage Links Analysis

Jay Enterprises – Buy Umbrellas Online for Ladies, Gents & Kids from Jay Enterprises: A well known trusted company of umbrella from more than years.

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • jjayenterprise.co
  • jaayenterprise.co
  • jayyenterprise.co
  • jayeenterprise.co
  • jayennterprise.co
  • jayentterprise.co
  • jayenteerprise.co
  • jayenterrprise.co
  • jayenterpprise.co
  • jayenterprrise.co
  • jayenterpriise.co
  • jayenterprisse.co
  • jayenterprisee.co
  • ayenterprise.co
  • jyenterprise.co

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 12
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: 2 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 27
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

jayenterprise.co favicon - jenniferchemsales.com

View jayenterprise.co Pagerank   jayenterprise.co alexa rank Not Applicable   jayenterprise.co website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

jayenterprise.co favicon - shrivishwakarmasafetytraininginstitute.com

View jayenterprise.co Pagerank   jayenterprise.co alexa rank Not Applicable   jayenterprise.co website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

jayenterprise.co favicon - theshineenglishacademy.com

View jayenterprise.co Pagerank   jayenterprise.co alexa rank Not Applicable   jayenterprise.co website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

jayenterprise.co favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View jayenterprise.co Pagerank   jayenterprise.co alexa rank Not Applicable   jayenterprise.co website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

jayenterprise.co favicon - 247bestpillpharma.com

View jayenterprise.co Pagerank   jayenterprise.co alexa rank Not Applicable   jayenterprise.co website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 01 Jun 2019 11:47:51 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Link: <http://jayenterprise.co/wp-json/>; rel="https://api.w.org/", <http://jayenterprise.co/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for jayenterprise.co

Domain Registrar: .CO Internet, S.A.S. jayenterprise.co registrar info
Registration Date: 2000-05-23 2 decades 5 years 8 months ago
Domain Status: clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net jayenterprise.co name server information 162.241.148.33 jayenterprise.co server is located in United States United States
ns2.bh-ht-17.webhostbox.net jayenterprise.co name server information 162.241.148.33 jayenterprise.co server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
jayenterprise.co A 10792 IP:162.241.148.33
jayenterprise.co NS 86400 Target:ns2.bh-ht-17.webhostbox.net
jayenterprise.co NS 86400 Target:ns1.bh-ht-17.webhostbox.net
jayenterprise.co SOA 10800 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019052802
Refresh:3600
Retry:1800
Expire:1209600
Minimum TTL:86400
jayenterprise.co MX 14400 Target:jayenterprise.co
jayenterprise.co TXT 14400 TXT:v=spf1 +a +mx +ip4:162.241.148.33 ~all

Similarly Ranked Websites to Jayenterprise

buxmarley.com

jayenterprise.co favicon - buxmarley.com

buxmarley.com

View jayenterprise.co Pagerank   Alexa rank for jayenterprise.co 11,389,784   website value of jayenterprise.co $ 8.95

Bolsos originales hecho en España con estampados originales

jayenterprise.co favicon - sanyurishop.com

Bolsos de diseño exclusivo fabricados con piel y lona de algodón. Hecho en España. De inspiración Mediterránea. Diseñado y producido por Sanyuri.

View jayenterprise.co Pagerank   Alexa rank for jayenterprise.co 11,389,789   website value of jayenterprise.co $ 8.95

Cosas Alucinantes -

jayenterprise.co favicon - cosasalucinantes.com

Sorprendente,Extraordinario,Increible ...

View jayenterprise.co Pagerank   Alexa rank for jayenterprise.co 11,389,796   website value of jayenterprise.co $ 8.95

WTIS AM 1110 | Inspiration Talk Radio

jayenterprise.co favicon - wtis1110.com

View jayenterprise.co Pagerank   Alexa rank for jayenterprise.co 11,389,799   website value of jayenterprise.co $ 8.95

Fachschaft Wirtschaftsinformatik |

jayenterprise.co favicon - winf.at

View jayenterprise.co Pagerank   Alexa rank for jayenterprise.co 11,389,812   website value of jayenterprise.co $ 8.95

Full WHOIS Lookup for jayenterprise.co

Domain Name: jayenterprise.co
Registry Domain ID: D85F431BF3BA64E98BF7CDC150C2AB098-NSR
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-05-29T07:57:17Z
Creation Date: 2019-05-23T08:51:38Z
Registry Expiry Date: 2020-05-23T08:51:38Z
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name:
Registrant Organization: WhoisGuard, Inc.
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns1.bh-ht-17.webhostbox.net
Name Server: ns2.bh-ht-17.webhostbox.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2019-06-01T11:46:54Z