2.50 Rating by ClearWebStats
This website has a #3,656,703 rank in global traffic. It has a org as an domain extension. This website has a Google PageRank of 5 out of 10. The DNS for I-doo is hosted at 92.48.78.51. While no active threats were reported recently by users, i-doo.org is SAFE to browse.
Get Custom Widget

Traffic Report of I-doo

Daily Unique Visitors: 132
Daily Pageviews: 264

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View i-doo.org Pagerank
Alexa Rank: 3,656,703
Domain Authority: Not Applicable
Google Pagerank
PR 5 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View i-doo.org site advisor rating Not Applicable

Where is i-doo.org server located?

Hosted IP Address:

92.48.78.51 View other site hosted with i-doo.org

Hosted Country:

i-doo.org hosted country GB i-doo.org hosted country

Location Latitude:

51.5228

Location Longitude:

-0.71986

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View i-doo.org HTML resources

Homepage Links Analysis

Nothing found for 406 Shtml

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • i-doo.or
  • i-doo.com
  • i-doo.net
  • ii-doo.org
  • i--doo.org
  • i-ddoo.org
  • i-dooo.org
  • -doo.org
  • idoo.org
  • i-oo.org
  • i-do.org
  • -idoo.org
  • id-oo.org
  • i-odo.org
  • u-doo.org

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 10 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 21
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 92.48.78.51)

The Prestige

i-doo.org favicon - dianafigueroapa.com

View i-doo.org Pagerank   i-doo.org alexa rank 922,219   i-doo.org website value $ 720.00

A Glass of Blessings -

i-doo.org favicon - helmetcamfirefighter.com

View i-doo.org Pagerank   i-doo.org alexa rank 418,357   i-doo.org website value $ 5,760.00

Chalet of the Smokies | Vacation blog

i-doo.org favicon - chaletsofthesmokies.com

View i-doo.org Pagerank   i-doo.org alexa rank Not Applicable   i-doo.org website value $ 8.95

蛻台コ倶コ倶サカ縺ョ隗」豎コ繧貞シ∬ュキ螢ォ縺ォ萓晞

i-doo.org favicon - newarkdelawarecriminaldefenselawyer.com

View i-doo.org Pagerank   i-doo.org alexa rank Not Applicable   i-doo.org website value $ 8.95

Azenx – Hi-Gear Inspiration

i-doo.org favicon - azenx.com

View i-doo.org Pagerank   i-doo.org alexa rank Not Applicable   i-doo.org website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 404
Status: 404 Not Found
Date: Wed, 12 Nov 2014 05:50:17 GMT
Server: Apache/2.4.9 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.30
X-Pingback: http://www.i-doo.org/xmlrpc.php
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Pragma: no-cache
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for i-doo.org

Domain Registrar: Public Interest Registry i-doo.org registrar info

Domain Nameserver Information

Host IP Address Country
ns2.ndx21.com i-doo.org name server information 213.229.101.106 i-doo.org server is located in United Kingdom United Kingdom
ns1.ndx21.com i-doo.org name server information 213.229.101.106 i-doo.org server is located in United Kingdom United Kingdom

DNS Record Analysis

Host Type TTL Extra
i-doo.org A 14399 IP:92.48.78.51
i-doo.org NS 21599 Target:ns2.ndx21.com
i-doo.org NS 21599 Target:ns1.ndx21.com
i-doo.org SOA 21599 MNAME:ns1.ndx21.com
RNAME:postmaster.nocmonitoring.org
Serial:2014050800
Refresh:86400
Retry:7200
Expire:3600000
Minimum TTL:86400
i-doo.org MX 14399 Target:i-doo.org

Similarly Ranked Websites to I-doo

IDontPay.com - Free stuff directory with unique categories.

i-doo.org favicon - idontpay.com

Fast-loading pages with free fantasy sports, free spyware removal, pet freebies and free online stock trades.

View i-doo.org Pagerank   Alexa rank for i-doo.org 3,656,704   website value of i-doo.org $ 240.00

NOMAD CHIC

i-doo.org favicon - nomad-chic.com

NOMAD - CHIC is a lifestyle website featuring inspired style, travel trends cerebral destinations and pop-up shops for the modern, free spirit.

View i-doo.org Pagerank   Alexa rank for i-doo.org 3,656,709   website value of i-doo.org $ 240.00

Member's Login

i-doo.org favicon - clcmembers.com

View i-doo.org Pagerank   Alexa rank for i-doo.org 3,656,738   website value of i-doo.org $ 240.00

Peak District Cottages & Derbyshire Holiday Accommodation | Derbyshire Cottages

i-doo.org favicon - derbyshire-cottages.info

Find holiday cottages & self catering accommodation in Derbyshire & the Peak District National Park. Check availability and book online with Derbyshire Cottages.

View i-doo.org Pagerank   Alexa rank for i-doo.org 3,656,740   website value of i-doo.org $ 240.00

Home page

i-doo.org favicon - thecorralwesternwear.com

The Corral Western Wear is your one stop shop for Cowboy Boots, Cowgirl Boots,Cowboy Hats, and all other Western Wear and Work Wear in Orange County California.

View i-doo.org Pagerank   Alexa rank for i-doo.org 3,656,765   website value of i-doo.org $ 240.00