2.20 Rating by ClearWebStats
heylinkit.com is 6 years 11 months 1 week old. It has a com as an domain extension. The DNS for Heylinkit is hosted at 198.252.106.234. While no active threats were reported recently by users, heylinkit.com is SAFE to browse.
Get Custom Widget

Traffic Report of Heylinkit

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View heylinkit.com site advisor rating Not Applicable

Where is heylinkit.com server located?

Hosted IP Address:

198.252.106.234 View other site hosted with heylinkit.com

Hosted Country:

heylinkit.com hosted country US heylinkit.com hosted country

Location Latitude:

34.0522

Location Longitude:

-118.244

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View heylinkit.com HTML resources

Homepage Links Analysis

403: Access Forbidden

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • heylinkit.co
  • heylinkit.cm
  • heylinkit.con
  • heylinkit.net
  • heylinkit.org
  • hheylinkit.com
  • heeylinkit.com
  • heyylinkit.com
  • heyllinkit.com
  • heyliinkit.com
  • heylinnkit.com
  • heylinkkit.com
  • heylinkiit.com
  • heylinkitt.com
  • eylinkit.com

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 198.252.106.234)

Melones Old Movies

heylinkit.com favicon - melonesoldmovies.com

Free Download Classic Old Movies

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Shop -

heylinkit.com favicon - customtshirtscheap.com

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Ebooks For Easy Life – Ebooks For Easy Life

heylinkit.com favicon - ebooksforeasylife.com

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

Cinema World Movies

heylinkit.com favicon - cinemaworldmovies.com

cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.

View heylinkit.com Pagerank   heylinkit.com alexa rank 409,402   heylinkit.com website value $ 5,760.00

Home and Kitchen Appliances Review

heylinkit.com favicon - homeandkitchenappliancesreview.com

Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison

View heylinkit.com Pagerank   heylinkit.com alexa rank Not Applicable   heylinkit.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Content-Type: text/html; charset=UTF-8
Content-Length: 291
Content-Encoding: br
Vary: Accept-Encoding
Date: Tue, 19 Mar 2019 04:57:43 GMT
Server: LiteSpeed
Connection: close

Domain Information for heylinkit.com

Domain Registrar: WEST263 INTERNATIONAL LIMITED heylinkit.com registrar info
Registration Date: 2019-03-14 6 years 11 months 1 week ago
Last Modified: 2019-03-14 6 years 11 months 1 week ago
Domain Status: ok https://icann.org/epp#ok

Domain Nameserver Information

Host IP Address Country
ns1.hawkhost.com heylinkit.com name server information 198.252.96.100 heylinkit.com server is located in United States United States
ns13.hawkhost.com heylinkit.com name server information 198.252.96.160 heylinkit.com server is located in United States United States
ns14.hawkhost.com heylinkit.com name server information 198.252.97.160 heylinkit.com server is located in United States United States
ns2.hawkhost.com heylinkit.com name server information 198.252.97.100 heylinkit.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
heylinkit.com A 14399 IP:198.252.106.234
heylinkit.com NS 21599 Target:ns13.hawkhost.com
heylinkit.com NS 21599 Target:ns14.hawkhost.com
heylinkit.com SOA 21599 MNAME:ns13.hawkhost.com
RNAME:server.hawkhost.com
Serial:2019031403
Refresh:86400
Retry:7200
Expire:2419200
Minimum TTL:86400
heylinkit.com MX 14399 Target:heylinkit.com
heylinkit.com TXT 14399 TXT:v=spf1 +a +mx +ip4:198.252.106.85
+include:_spf.arandomserver.com ~all

Similarly Ranked Websites to Heylinkit

Just a moment...

heylinkit.com favicon - absolutefiction.com

View heylinkit.com Pagerank   Alexa rank for heylinkit.com Not Applicable   website value of heylinkit.com $ 15.95

SCOP agyRem Conseil - La SCOP agyRem Conseil

heylinkit.com favicon - agyrem.com

La SCOP agyRem Conseil est un cabinet coopératif engagé dans la professionnalisation de l'économie sociale et la promotion de la RSE en entreprise

View heylinkit.com Pagerank   Alexa rank for heylinkit.com Not Applicable   website value of heylinkit.com $ 8.95

Wyvern Jubilee Morris - Welcome One And All

heylinkit.com favicon - wjm.org.uk

Wyvern Jubilee Morris

View heylinkit.com Pagerank   Alexa rank for heylinkit.com Not Applicable   website value of heylinkit.com $ 8.95

Leaders Only - Keys of Spinal Cord Injuries

heylinkit.com favicon - leadersonly.info

Exploring the options of treatment and supplies of the disabled and those with brain and traumatic spinal cord injury.

View heylinkit.com Pagerank   Alexa rank for heylinkit.com Not Applicable   website value of heylinkit.com $ 8.95

eBuy Bangladesh: Bangladesh largest free online Real Estate Site|Largest Online Realestate Agent and Buy/Sell in Bangladesh|Real Estate Market in Bangladesh|Realestate Project and Ready Apartment...

heylinkit.com favicon - ebuybd.info

Real Estate Market in Bangladesh, Real Estate Market in Bangladesh, Realestate Project and Ready Apartment Listing in Bangladesh, Online Shopping in Bangladesh, Buy/Sell in Bangladesh, buy flat and apartment in bangladesh, apartment price,land price

View heylinkit.com Pagerank   Alexa rank for heylinkit.com Not Applicable   website value of heylinkit.com $ 8.95

Full WHOIS Lookup for heylinkit.com

Domain Name: HEYLINKIT.COM
Registry Domain ID: 2369172262_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.hkdns.hk
Registrar URL: http://www.hkdns.hk
Updated Date: 2019-03-14T10:08:55Z
Creation Date: 2019-03-14T08:50:23Z
Registry Expiry Date: 2020-03-14T08:50:23Z
Registrar: West263 International Limited
Registrar IANA ID: 1915
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +86.62778877 Ext8364
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.HAWKHOST.COM
Name Server: NS13.HAWKHOST.COM
Name Server: NS14.HAWKHOST.COM
Name Server: NS2.HAWKHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-03-19T04:57:47Z