GBREL.TXT Genetic Sequence Data Bank December 15 2024 NCBI-GenBank Flat File Release 264.0 Distribution Release Notes 254365075 sequences, 5085904976338 bases, for traditional GenBank records 5101949186 sequences, 33880196332289 bases, for set-based (WGS/TSA/TLS) records This document describes the format and content of the flat files that comprise releases of the GenBank nucleotide sequence database. If you have any questions or comments about GenBank or this document, please contact NCBI via email at info@ncbi.nlm.nih.gov or: GenBank National Center for Biotechnology Information National Library of Medicine, 38A, 8N805 8600 Rockville Pike Bethesda, MD 20894 USA GenBank releases do not include sequence records that originate from third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project. Rather, GenBank is the archival/primary resource which those other efforts draw upon. For information about TPA and RefSeq, please visit: http://www.ncbi.nih.gov/Genbank/TPA.html http://www.ncbi.nlm.nih.gov/RefSeq ========================================================================== TABLE OF CONTENTS ========================================================================== 1. INTRODUCTION 1.1 Release 264.0 1.2 Cutoff Date 1.3 Important Changes in Release 264.0 1.4 Upcoming Changes 1.5 Request for Direct Submission of Sequence Data 1.6 Organization of This Document 2. ORGANIZATION OF DATA FILES 2.1 Overview 2.2 Files 2.2.1 File Descriptions 2.2.5 File Sizes 2.2.6 Per-Division Statistics 2.2.7 Selected Per-Organism Statistics 2.2.8 Growth of GenBank 3. FILE FORMATS 3.1 File Header Information 3.4 Sequence Entry Files 3.4.1 File Organization 3.4.2 Entry Organization 3.4.3 Sample Sequence Data File 3.4.4 LOCUS Format 3.4.5 DEFINITION Format 3.4.5.1 DEFINITION Format for NLM Entries 3.4.6 ACCESSION Format 3.4.7 VERSION Format 3.4.8 KEYWORDS Format 3.4.9 SEGMENT Format 3.4.10 SOURCE Format 3.4.11 REFERENCE Format 3.4.12 FEATURES Format 3.4.12.1 Feature Key Names 3.4.12.2 Feature Location 3.4.12.3 Feature Qualifiers 3.4.12.4 Cross-Reference Information 3.4.12.5 Feature Table Examples 3.4.13 ORIGIN Format 3.4.14 SEQUENCE Format 3.4.15 CONTIG Format 4. ALTERNATE RELEASES 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries 6. GENBANK ADMINISTRATION 6.1 Registered Trademark Notice 6.2 Citing GenBank 6.3 GenBank Distribution Formats and Media 6.4 Other Methods of Accessing GenBank Data 6.5 Request for Corrections and Comments 6.6 Credits and Acknowledgments 6.7 Disclaimer ========================================================================== 1. INTRODUCTION 1.1 Release 264.0 The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), National Institutes of Health (NIH) is responsible for producing and distributing the GenBank Sequence Database. NCBI handles all GenBank direct submissions and authors are advised to use the address below. Submitters are encouraged to use Submission Portal or BankIt for sending sequence data. ***************************************************************************** The address for direct submissions to GenBank is: GenBank Submissions National Center for Biotechnology Information Bldg 38A, Rm. 8N-803 8600 Rockville Pike Bethesda, MD 20894 Email: gb-sub@ncbi.nlm.nih.gov Updates and changes to existing GenBank records: https://www.ncbi.nlm.nih.gov/genbank/update/ Email: update@ncbi.nlm.nih.gov URLs for GenBank's web-based submission tools: Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ See Section 1.5 for additional details about submitting data to GenBank. ***************************************************************************** GenBank Release 264.0 is a release of sequence data by NCBI in the GenBank Flatfile format. GenBank is a component of a tri-partite collaboration of sequence databases in the U.S., Europe, and Japan, known as the International Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are incorporated through arrangements with the U.S. Patent and Trademark Office, and via the collaborating international databases from other international patent offices. The database is converted to various output formats, including the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1 and Flatfile forms of the data are available at NCBI's anonymous FTP server : ftp://ftp.ncbi.nih.gov/ncbi-asn1 ftp://ftp.ncbi.nih.gov/genbank GenBank releases do not contain sequence records that originate from unfinished Whole Genome Shotgun (WGS) genome sequencing projects, Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from Targeted Locus Study (TLS) sequencing projects. The sequence data from those efforts are made available separately, on a per-project basis: ftp://ftp.ncbi.nih.gov/genbank/wgs ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/tsa ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa ftp://ftp.ncbi.nih.gov/genbank/tls ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls See the README files in those areas for more information. 1.2 Cutoff Date This full release, 264.0, incorporates data processed by the INSDC databases as of Friday December 13, 8:22PM EDT. For more recent data, users are advised to: o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI: ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format) ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format) o Use the interactive Network-Entrez or Web-Entrez applications to query the 'Entrez: Nucleotide' database (see Section 6.4 of this document). 1.3 Important Changes in Release 264.0 1.3.1 Organizational changes The total number of sequence data files for traditional GenBank records (non-WGS/TSA/TLS) increased by 777 with this release: - the BCT division is now composed of 412 files (+18) - the ENV division is now composed of 27 files (-2) - the EST division is now composed of 164 files (+1) - the INV division is now composed of 1082 files (+148) - the MAM division is now composed of 165 files (+9) - the PAT division is now composed of 80 files (+2) - the PLN division is now composed of 1875 files (+215) - the PRI division is now composed of 678 files (+353) - the ROD division is now composed of 115 files (+2) - the VRL division is now composed of 333 files (+2) - the VRT division is now composed of 317 files (+29) The decrease in the number of ENV-division files is due to the suppression of 8233 sequence records with OY accession prefixes, which were erroneously submitted as chromosomes. Further details can be obtained from the European Nucleotide Archive. 1.4 Upcoming Changes 1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country) and /collection_date for sequence submissions, in alignment with its goal of increasing the number of sequences for which the origin of a sample can be precisely located in time and space. This requirement is expected to take effect by the end of December 2024, and further details can be found at: https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/ Because there are valid circumstances in which location and/or the collection date for a sequenced sample cannot be provided, the domain of allowed values for these two source-feature qualifiers will be expanded to include a variety of "null terms". They are: missing not applicable not collected not provided restricted access missing: control sample missing: sample group missing: synthetic construct missing: lab stock missing: third party data missing: data agreement established pre-2023 missing: endangered species missing: human-identifiable The timeframe for introducing these new values is still uncertain, but the earliest possible date for their appearance was June 15 2023, and they will definitely be encountered after Dec 31 2024, when /geo_loc_name and /collection_date have become mandatory. 1.5 Request for Direct Submission of Sequence Data A successful GenBank requires that sequence data enter the database as soon as possible after publication, that the annotations be as complete as possible, and that the sequence and annotation data be accurate. All three of these requirements are best met if authors of sequence data submit their data directly to GenBank utilizing the tools summarized below. GenBank must rely on direct author submission of data to ensure that it achieves its goals of completeness, accuracy, and timeliness. General information for submitting to Genbank is available online: https://www.ncbi.nlm.nih.gov/genbank/submit/ To assist researchers in entering their own sequence data, GenBank provides Web-based submission tools: Submission Portal and Bankit. Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ Submission Portal provides an efficient submission pathway for high frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1, SARS-CoV-2, etc.). BankIt is an easy-to-use program that enables authors to enter one or more sequences, annotate, and submit to GenBank. BankIt provides a simple forms-based approach for submitting your sequence and the relevant associated metadata to GenBank. Genbank also provides submission preparation tools which require uploading via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant: table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/ table2asn is a command-line program that automates the creation of sequence records for submission to GenBank. It is used primarily for submission of complete genomes and large batches of sequences and is available by FTP for use on MAC, PC and Unix platforms: https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/ Genome Workbench offers a rich set of integrated tools for studying and analyzing genetic data. The Submission Wizard allows you to prepare submissions of single eukaryotic and prokaryotic genomes. You can also use Genome Workbench to edit and visualize an ASN.1 file created by table2asn. Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/ Through the international collaboration of DNA sequence databases, GenBank submissions are forwarded daily for inclusion in the European Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ). AUTHORIN. Authorin sequence submissions are no longer accepted by GenBank, and the Authorin application is no longer distributed by NCBI. SEQUIN. As of January 2021, Sequin sequence submissions are no longer accepted by GenBank, and the Sequin application is no longer distributed by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/ If you have questions about GenBank submissions or any of the data submission tools, contact NCBI at: info@ncbi.nlm.nih.gov . 1.6 Organization of This Document The second section describes the contents of GenBank releases. The third section illustrates the formats of the flat files. The fourth section describes other versions of the data, the fifth section identifies known prob- lems, and the sixth contains administrative details. 2. ORGANIZATION OF DATA FILES 2.1 Overview GenBank releases consist of a set of ASCII text files, most of which contain sequence data. A few supplemental files are also supplied, containing lists of new, modified, and deleted sequence records. The line-lengths of these files is variable. 2.2 Files This GenBank flat file release consists of 5480 files. The lists that follow describe each of the files included in the distribution. Their sizes and base pair content are also summarized. 2.2.1 File Descriptions Files included in this release are: 1. gbbct1.seq - Bacterial sequence entries, part 1. 2. gbbct10.seq - Bacterial sequence entries, part 10. 3. gbbct100.seq - Bacterial sequence entries, part 100. 4. gbbct101.seq - Bacterial sequence entries, part 101. 5. gbbct102.seq - Bacterial sequence entries, part 102. 6. gbbct103.seq - Bacterial sequence entries, part 103. 7. gbbct104.seq - Bacterial sequence entries, part 104. 8. gbbct105.seq - Bacterial sequence entries, part 105. 9. gbbct106.seq - Bacterial sequence entries, part 106. 10. gbbct107.seq - Bacterial sequence entries, part 107. 11. gbbct108.seq - Bacterial sequence entries, part 108. 12. gbbct109.seq - Bacterial sequence entries, part 109. 13. gbbct11.seq - Bacterial sequence entries, part 11. 14. gbbct110.seq - Bacterial sequence entries, part 110. 15. gbbct111.seq - Bacterial sequence entries, part 111. 16. gbbct112.seq - Bacterial sequence entries, part 112. 17. gbbct113.seq - Bacterial sequence entries, part 113. 18. gbbct114.seq - Bacterial sequence entries, part 114. 19. gbbct115.seq - Bacterial sequence entries, part 115. 20. gbbct116.seq - Bacterial sequence entries, part 116. 21. gbbct117.seq - Bacterial sequence entries, part 117. 22. gbbct118.seq - Bacterial sequence entries, part 118. 23. gbbct119.seq - Bacterial sequence entries, part 119. 24. gbbct12.seq - Bacterial sequence entries, part 12. 25. gbbct120.seq - Bacterial sequence entries, part 120. 26. gbbct121.seq - Bacterial sequence entries, part 121. 27. gbbct122.seq - Bacterial sequence entries, part 122. 28. gbbct123.seq - Bacterial sequence entries, part 123. 29. gbbct124.seq - Bacterial sequence entries, part 124. 30. gbbct125.seq - Bacterial sequence entries, part 125. 31. gbbct126.seq - Bacterial sequence entries, part 126. 32. gbbct127.seq - Bacterial sequence entries, part 127. 33. gbbct128.seq - Bacterial sequence entries, part 128. 34. gbbct129.seq - Bacterial sequence entries, part 129. 35. gbbct13.seq - Bacterial sequence entries, part 13. 36. gbbct130.seq - Bacterial sequence entries, part 130. 37. gbbct131.seq - Bacterial sequence entries, part 131. 38. gbbct132.seq - Bacterial sequence entries, part 132. 39. gbbct133.seq - Bacterial sequence entries, part 133. 40. gbbct134.seq - Bacterial sequence entries, part 134. 41. gbbct135.seq - Bacterial sequence entries, part 135. 42. gbbct136.seq - Bacterial sequence entries, part 136. 43. gbbct137.seq - Bacterial sequence entries, part 137. 44. gbbct138.seq - Bacterial sequence entries, part 138. 45. gbbct139.seq - Bacterial sequence entries, part 139. 46. gbbct14.seq - Bacterial sequence entries, part 14. 47. gbbct140.seq - Bacterial sequence entries, part 140. 48. gbbct141.seq - Bacterial sequence entries, part 141. 49. gbbct142.seq - Bacterial sequence entries, part 142. 50. gbbct143.seq - Bacterial sequence entries, part 143. 51. gbbct144.seq - Bacterial sequence entries, part 144. 52. gbbct145.seq - Bacterial sequence entries, part 145. 53. gbbct146.seq - Bacterial sequence entries, part 146. 54. gbbct147.seq - Bacterial sequence entries, part 147. 55. gbbct148.seq - Bacterial sequence entries, part 148. 56. gbbct149.seq - Bacterial sequence entries, part 149. 57. gbbct15.seq - Bacterial sequence entries, part 15. 58. gbbct150.seq - Bacterial sequence entries, part 150. 59. gbbct151.seq - Bacterial sequence entries, part 151. 60. gbbct152.seq - Bacterial sequence entries, part 152. 61. gbbct153.seq - Bacterial sequence entries, part 153. 62. gbbct154.seq - Bacterial sequence entries, part 154. 63. gbbct155.seq - Bacterial sequence entries, part 155. 64. gbbct156.seq - Bacterial sequence entries, part 156. 65. gbbct157.seq - Bacterial sequence entries, part 157. 66. gbbct158.seq - Bacterial sequence entries, part 158. 67. gbbct159.seq - Bacterial sequence entries, part 159. 68. gbbct16.seq - Bacterial sequence entries, part 16. 69. gbbct160.seq - Bacterial sequence entries, part 160. 70. gbbct161.seq - Bacterial sequence entries, part 161. 71. gbbct162.seq - Bacterial sequence entries, part 162. 72. gbbct163.seq - Bacterial sequence entries, part 163. 73. gbbct164.seq - Bacterial sequence entries, part 164. 74. gbbct165.seq - Bacterial sequence entries, part 165. 75. gbbct166.seq - Bacterial sequence entries, part 166. 76. gbbct167.seq - Bacterial sequence entries, part 167. 77. gbbct168.seq - Bacterial sequence entries, part 168. 78. gbbct169.seq - Bacterial sequence entries, part 169. 79. gbbct17.seq - Bacterial sequence entries, part 17. 80. gbbct170.seq - Bacterial sequence entries, part 170. 81. gbbct171.seq - Bacterial sequence entries, part 171. 82. gbbct172.seq - Bacterial sequence entries, part 172. 83. gbbct173.seq - Bacterial sequence entries, part 173. 84. gbbct174.seq - Bacterial sequence entries, part 174. 85. gbbct175.seq - Bacterial sequence entries, part 175. 86. gbbct176.seq - Bacterial sequence entries, part 176. 87. gbbct177.seq - Bacterial sequence entries, part 177. 88. gbbct178.seq - Bacterial sequence entries, part 178. 89. gbbct179.seq - Bacterial sequence entries, part 179. 90. gbbct18.seq - Bacterial sequence entries, part 18. 91. gbbct180.seq - Bacterial sequence entries, part 180. 92. gbbct181.seq - Bacterial sequence entries, part 181. 93. gbbct182.seq - Bacterial sequence entries, part 182. 94. gbbct183.seq - Bacterial sequence entries, part 183. 95. gbbct184.seq - Bacterial sequence entries, part 184. 96. gbbct185.seq - Bacterial sequence entries, part 185. 97. gbbct186.seq - Bacterial sequence entries, part 186. 98. gbbct187.seq - Bacterial sequence entries, part 187. 99. gbbct188.seq - Bacterial sequence entries, part 188. 100. gbbct189.seq - Bacterial sequence entries, part 189. 101. gbbct19.seq - Bacterial sequence entries, part 19. 102. gbbct190.seq - Bacterial sequence entries, part 190. 103. gbbct191.seq - Bacterial sequence entries, part 191. 104. gbbct192.seq - Bacterial sequence entries, part 192. 105. gbbct193.seq - Bacterial sequence entries, part 193. 106. gbbct194.seq - Bacterial sequence entries, part 194. 107. gbbct195.seq - Bacterial sequence entries, part 195. 108. gbbct196.seq - Bacterial sequence entries, part 196. 109. gbbct197.seq - Bacterial sequence entries, part 197. 110. gbbct198.seq - Bacterial sequence entries, part 198. 111. gbbct199.seq - Bacterial sequence entries, part 199. 112. gbbct2.seq - Bacterial sequence entries, part 2. 113. gbbct20.seq - Bacterial sequence entries, part 20. 114. gbbct200.seq - Bacterial sequence entries, part 200. 115. gbbct201.seq - Bacterial sequence entries, part 201. 116. gbbct202.seq - Bacterial sequence entries, part 202. 117. gbbct203.seq - Bacterial sequence entries, part 203. 118. gbbct204.seq - Bacterial sequence entries, part 204. 119. gbbct205.seq - Bacterial sequence entries, part 205. 120. gbbct206.seq - Bacterial sequence entries, part 206. 121. gbbct207.seq - Bacterial sequence entries, part 207. 122. gbbct208.seq - Bacterial sequence entries, part 208. 123. gbbct209.seq - Bacterial sequence entries, part 209. 124. gbbct21.seq - Bacterial sequence entries, part 21. 125. gbbct210.seq - Bacterial sequence entries, part 210. 126. gbbct211.seq - Bacterial sequence entries, part 211. 127. gbbct212.seq - Bacterial sequence entries, part 212. 128. gbbct213.seq - Bacterial sequence entries, part 213. 129. gbbct214.seq - Bacterial sequence entries, part 214. 130. gbbct215.seq - Bacterial sequence entries, part 215. 131. gbbct216.seq - Bacterial sequence entries, part 216. 132. gbbct217.seq - Bacterial sequence entries, part 217. 133. gbbct218.seq - Bacterial sequence entries, part 218. 134. gbbct219.seq - Bacterial sequence entries, part 219. 135. gbbct22.seq - Bacterial sequence entries, part 22. 136. gbbct220.seq - Bacterial sequence entries, part 220. 137. gbbct221.seq - Bacterial sequence entries, part 221. 138. gbbct222.seq - Bacterial sequence entries, part 222. 139. gbbct223.seq - Bacterial sequence entries, part 223. 140. gbbct224.seq - Bacterial sequence entries, part 224. 141. gbbct225.seq - Bacterial sequence entries, part 225. 142. gbbct226.seq - Bacterial sequence entries, part 226. 143. gbbct227.seq - Bacterial sequence entries, part 227. 144. gbbct228.seq - Bacterial sequence entries, part 228. 145. gbbct229.seq - Bacterial sequence entries, part 229. 146. gbbct23.seq - Bacterial sequence entries, part 23. 147. gbbct230.seq - Bacterial sequence entries, part 230. 148. gbbct231.seq - Bacterial sequence entries, part 231. 149. gbbct232.seq - Bacterial sequence entries, part 232. 150. gbbct233.seq - Bacterial sequence entries, part 233. 151. gbbct234.seq - Bacterial sequence entries, part 234. 152. gbbct235.seq - Bacterial sequence entries, part 235. 153. gbbct236.seq - Bacterial sequence entries, part 236. 154. gbbct237.seq - Bacterial sequence entries, part 237. 155. gbbct238.seq - Bacterial sequence entries, part 238. 156. gbbct239.seq - Bacterial sequence entries, part 239. 157. gbbct24.seq - Bacterial sequence entries, part 24. 158. gbbct240.seq - Bacterial sequence entries, part 240. 159. gbbct241.seq - Bacterial sequence entries, part 241. 160. gbbct242.seq - Bacterial sequence entries, part 242. 161. gbbct243.seq - Bacterial sequence entries, part 243. 162. gbbct244.seq - Bacterial sequence entries, part 244. 163. gbbct245.seq - Bacterial sequence entries, part 245. 164. gbbct246.seq - Bacterial sequence entries, part 246. 165. gbbct247.seq - Bacterial sequence entries, part 247. 166. gbbct248.seq - Bacterial sequence entries, part 248. 167. gbbct249.seq - Bacterial sequence entries, part 249. 168. gbbct25.seq - Bacterial sequence entries, part 25. 169. gbbct250.seq - Bacterial sequence entries, part 250. 170. gbbct251.seq - Bacterial sequence entries, part 251. 171. gbbct252.seq - Bacterial sequence entries, part 252. 172. gbbct253.seq - Bacterial sequence entries, part 253. 173. gbbct254.seq - Bacterial sequence entries, part 254. 174. gbbct255.seq - Bacterial sequence entries, part 255. 175. gbbct256.seq - Bacterial sequence entries, part 256. 176. gbbct257.seq - Bacterial sequence entries, part 257. 177. gbbct258.seq - Bacterial sequence entries, part 258. 178. gbbct259.seq - Bacterial sequence entries, part 259. 179. gbbct26.seq - Bacterial sequence entries, part 26. 180. gbbct260.seq - Bacterial sequence entries, part 260. 181. gbbct261.seq - Bacterial sequence entries, part 261. 182. gbbct262.seq - Bacterial sequence entries, part 262. 183. gbbct263.seq - Bacterial sequence entries, part 263. 184. gbbct264.seq - Bacterial sequence entries, part 264. 185. gbbct265.seq - Bacterial sequence entries, part 265. 186. gbbct266.seq - Bacterial sequence entries, part 266. 187. gbbct267.seq - Bacterial sequence entries, part 267. 188. gbbct268.seq - Bacterial sequence entries, part 268. 189. gbbct269.seq - Bacterial sequence entries, part 269. 190. gbbct27.seq - Bacterial sequence entries, part 27. 191. gbbct270.seq - Bacterial sequence entries, part 270. 192. gbbct271.seq - Bacterial sequence entries, part 271. 193. gbbct272.seq - Bacterial sequence entries, part 272. 194. gbbct273.seq - Bacterial sequence entries, part 273. 195. gbbct274.seq - Bacterial sequence entries, part 274. 196. gbbct275.seq - Bacterial sequence entries, part 275. 197. gbbct276.seq - Bacterial sequence entries, part 276. 198. gbbct277.seq - Bacterial sequence entries, part 277. 199. gbbct278.seq - Bacterial sequence entries, part 278. 200. gbbct279.seq - Bacterial sequence entries, part 279. 201. gbbct28.seq - Bacterial sequence entries, part 28. 202. gbbct280.seq - Bacterial sequence entries, part 280. 203. gbbct281.seq - Bacterial sequence entries, part 281. 204. gbbct282.seq - Bacterial sequence entries, part 282. 205. gbbct283.seq - Bacterial sequence entries, part 283. 206. gbbct284.seq - Bacterial sequence entries, part 284. 207. gbbct285.seq - Bacterial sequence entries, part 285. 208. gbbct286.seq - Bacterial sequence entries, part 286. 209. gbbct287.seq - Bacterial sequence entries, part 287. 210. gbbct288.seq - Bacterial sequence entries, part 288. 211. gbbct289.seq - Bacterial sequence entries, part 289. 212. gbbct29.seq - Bacterial sequence entries, part 29. 213. gbbct290.seq - Bacterial sequence entries, part 290. 214. gbbct291.seq - Bacterial sequence entries, part 291. 215. gbbct292.seq - Bacterial sequence entries, part 292. 216. gbbct293.seq - Bacterial sequence entries, part 293. 217. gbbct294.seq - Bacterial sequence entries, part 294. 218. gbbct295.seq - Bacterial sequence entries, part 295. 219. gbbct296.seq - Bacterial sequence entries, part 296. 220. gbbct297.seq - Bacterial sequence entries, part 297. 221. gbbct298.seq - Bacterial sequence entries, part 298. 222. gbbct299.seq - Bacterial sequence entries, part 299. 223. gbbct3.seq - Bacterial sequence entries, part 3. 224. gbbct30.seq - Bacterial sequence entries, part 30. 225. gbbct300.seq - Bacterial sequence entries, part 300. 226. gbbct301.seq - Bacterial sequence entries, part 301. 227. gbbct302.seq - Bacterial sequence entries, part 302. 228. gbbct303.seq - Bacterial sequence entries, part 303. 229. gbbct304.seq - Bacterial sequence entries, part 304. 230. gbbct305.seq - Bacterial sequence entries, part 305. 231. gbbct306.seq - Bacterial sequence entries, part 306. 232. gbbct307.seq - Bacterial sequence entries, part 307. 233. gbbct308.seq - Bacterial sequence entries, part 308. 234. gbbct309.seq - Bacterial sequence entries, part 309. 235. gbbct31.seq - Bacterial sequence entries, part 31. 236. gbbct310.seq - Bacterial sequence entries, part 310. 237. gbbct311.seq - Bacterial sequence entries, part 311. 238. gbbct312.seq - Bacterial sequence entries, part 312. 239. gbbct313.seq - Bacterial sequence entries, part 313. 240. gbbct314.seq - Bacterial sequence entries, part 314. 241. gbbct315.seq - Bacterial sequence entries, part 315. 242. gbbct316.seq - Bacterial sequence entries, part 316. 243. gbbct317.seq - Bacterial sequence entries, part 317. 244. gbbct318.seq - Bacterial sequence entries, part 318. 245. gbbct319.seq - Bacterial sequence entries, part 319. 246. gbbct32.seq - Bacterial sequence entries, part 32. 247. gbbct320.seq - Bacterial sequence entries, part 320. 248. gbbct321.seq - Bacterial sequence entries, part 321. 249. gbbct322.seq - Bacterial sequence entries, part 322. 250. gbbct323.seq - Bacterial sequence entries, part 323. 251. gbbct324.seq - Bacterial sequence entries, part 324. 252. gbbct325.seq - Bacterial sequence entries, part 325. 253. gbbct326.seq - Bacterial sequence entries, part 326. 254. gbbct327.seq - Bacterial sequence entries, part 327. 255. gbbct328.seq - Bacterial sequence entries, part 328. 256. gbbct329.seq - Bacterial sequence entries, part 329. 257. gbbct33.seq - Bacterial sequence entries, part 33. 258. gbbct330.seq - Bacterial sequence entries, part 330. 259. gbbct331.seq - Bacterial sequence entries, part 331. 260. gbbct332.seq - Bacterial sequence entries, part 332. 261. gbbct333.seq - Bacterial sequence entries, part 333. 262. gbbct334.seq - Bacterial sequence entries, part 334. 263. gbbct335.seq - Bacterial sequence entries, part 335. 264. gbbct336.seq - Bacterial sequence entries, part 336. 265. gbbct337.seq - Bacterial sequence entries, part 337. 266. gbbct338.seq - Bacterial sequence entries, part 338. 267. gbbct339.seq - Bacterial sequence entries, part 339. 268. gbbct34.seq - Bacterial sequence entries, part 34. 269. gbbct340.seq - Bacterial sequence entries, part 340. 270. gbbct341.seq - Bacterial sequence entries, part 341. 271. gbbct342.seq - Bacterial sequence entries, part 342. 272. gbbct343.seq - Bacterial sequence entries, part 343. 273. gbbct344.seq - Bacterial sequence entries, part 344. 274. gbbct345.seq - Bacterial sequence entries, part 345. 275. gbbct346.seq - Bacterial sequence entries, part 346. 276. gbbct347.seq - Bacterial sequence entries, part 347. 277. gbbct348.seq - Bacterial sequence entries, part 348. 278. gbbct349.seq - Bacterial sequence entries, part 349. 279. gbbct35.seq - Bacterial sequence entries, part 35. 280. gbbct350.seq - Bacterial sequence entries, part 350. 281. gbbct351.seq - Bacterial sequence entries, part 351. 282. gbbct352.seq - Bacterial sequence entries, part 352. 283. gbbct353.seq - Bacterial sequence entries, part 353. 284. gbbct354.seq - Bacterial sequence entries, part 354. 285. gbbct355.seq - Bacterial sequence entries, part 355. 286. gbbct356.seq - Bacterial sequence entries, part 356. 287. gbbct357.seq - Bacterial sequence entries, part 357. 288. gbbct358.seq - Bacterial sequence entries, part 358. 289. gbbct359.seq - Bacterial sequence entries, part 359. 290. gbbct36.seq - Bacterial sequence entries, part 36. 291. gbbct360.seq - Bacterial sequence entries, part 360. 292. gbbct361.seq - Bacterial sequence entries, part 361. 293. gbbct362.seq - Bacterial sequence entries, part 362. 294. gbbct363.seq - Bacterial sequence entries, part 363. 295. gbbct364.seq - Bacterial sequence entries, part 364. 296. gbbct365.seq - Bacterial sequence entries, part 365. 297. gbbct366.seq - Bacterial sequence entries, part 366. 298. gbbct367.seq - Bacterial sequence entries, part 367. 299. gbbct368.seq - Bacterial sequence entries, part 368. 300. gbbct369.seq - Bacterial sequence entries, part 369. 301. gbbct37.seq - Bacterial sequence entries, part 37. 302. gbbct370.seq - Bacterial sequence entries, part 370. 303. gbbct371.seq - Bacterial sequence entries, part 371. 304. gbbct372.seq - Bacterial sequence entries, part 372. 305. gbbct373.seq - Bacterial sequence entries, part 373. 306. gbbct374.seq - Bacterial sequence entries, part 374. 307. gbbct375.seq - Bacterial sequence entries, part 375. 308. gbbct376.seq - Bacterial sequence entries, part 376. 309. gbbct377.seq - Bacterial sequence entries, part 377. 310. gbbct378.seq - Bacterial sequence entries, part 378. 311. gbbct379.seq - Bacterial sequence entries, part 379. 312. gbbct38.seq - Bacterial sequence entries, part 38. 313. gbbct380.seq - Bacterial sequence entries, part 380. 314. gbbct381.seq - Bacterial sequence entries, part 381. 315. gbbct382.seq - Bacterial sequence entries, part 382. 316. gbbct383.seq - Bacterial sequence entries, part 383. 317. gbbct384.seq - Bacterial sequence entries, part 384. 318. gbbct385.seq - Bacterial sequence entries, part 385. 319. gbbct386.seq - Bacterial sequence entries, part 386. 320. gbbct387.seq - Bacterial sequence entries, part 387. 321. gbbct388.seq - Bacterial sequence entries, part 388. 322. gbbct389.seq - Bacterial sequence entries, part 389. 323. gbbct39.seq - Bacterial sequence entries, part 39. 324. gbbct390.seq - Bacterial sequence entries, part 390. 325. gbbct391.seq - Bacterial sequence entries, part 391. 326. gbbct392.seq - Bacterial sequence entries, part 392. 327. gbbct393.seq - Bacterial sequence entries, part 393. 328. gbbct394.seq - Bacterial sequence entries, part 394. 329. gbbct395.seq - Bacterial sequence entries, part 395. 330. gbbct396.seq - Bacterial sequence entries, part 396. 331. gbbct397.seq - Bacterial sequence entries, part 397. 332. gbbct398.seq - Bacterial sequence entries, part 398. 333. gbbct399.seq - Bacterial sequence entries, part 399. 334. gbbct4.seq - Bacterial sequence entries, part 4. 335. gbbct40.seq - Bacterial sequence entries, part 40. 336. gbbct400.seq - Bacterial sequence entries, part 400. 337. gbbct401.seq - Bacterial sequence entries, part 401. 338. gbbct402.seq - Bacterial sequence entries, part 402. 339. gbbct403.seq - Bacterial sequence entries, part 403. 340. gbbct404.seq - Bacterial sequence entries, part 404. 341. gbbct405.seq - Bacterial sequence entries, part 405. 342. gbbct406.seq - Bacterial sequence entries, part 406. 343. gbbct407.seq - Bacterial sequence entries, part 407. 344. gbbct408.seq - Bacterial sequence entries, part 408. 345. gbbct409.seq - Bacterial sequence entries, part 409. 346. gbbct41.seq - Bacterial sequence entries, part 41. 347. gbbct410.seq - Bacterial sequence entries, part 410. 348. gbbct411.seq - Bacterial sequence entries, part 411. 349. gbbct412.seq - Bacterial sequence entries, part 412. 350. gbbct42.seq - Bacterial sequence entries, part 42. 351. gbbct43.seq - Bacterial sequence entries, part 43. 352. gbbct44.seq - Bacterial sequence entries, part 44. 353. gbbct45.seq - Bacterial sequence entries, part 45. 354. gbbct46.seq - Bacterial sequence entries, part 46. 355. gbbct47.seq - Bacterial sequence entries, part 47. 356. gbbct48.seq - Bacterial sequence entries, part 48. 357. gbbct49.seq - Bacterial sequence entries, part 49. 358. gbbct5.seq - Bacterial sequence entries, part 5. 359. gbbct50.seq - Bacterial sequence entries, part 50. 360. gbbct51.seq - Bacterial sequence entries, part 51. 361. gbbct52.seq - Bacterial sequence entries, part 52. 362. gbbct53.seq - Bacterial sequence entries, part 53. 363. gbbct54.seq - Bacterial sequence entries, part 54. 364. gbbct55.seq - Bacterial sequence entries, part 55. 365. gbbct56.seq - Bacterial sequence entries, part 56. 366. gbbct57.seq - Bacterial sequence entries, part 57. 367. gbbct58.seq - Bacterial sequence entries, part 58. 368. gbbct59.seq - Bacterial sequence entries, part 59. 369. gbbct6.seq - Bacterial sequence entries, part 6. 370. gbbct60.seq - Bacterial sequence entries, part 60. 371. gbbct61.seq - Bacterial sequence entries, part 61. 372. gbbct62.seq - Bacterial sequence entries, part 62. 373. gbbct63.seq - Bacterial sequence entries, part 63. 374. gbbct64.seq - Bacterial sequence entries, part 64. 375. gbbct65.seq - Bacterial sequence entries, part 65. 376. gbbct66.seq - Bacterial sequence entries, part 66. 377. gbbct67.seq - Bacterial sequence entries, part 67. 378. gbbct68.seq - Bacterial sequence entries, part 68. 379. gbbct69.seq - Bacterial sequence entries, part 69. 380. gbbct7.seq - Bacterial sequence entries, part 7. 381. gbbct70.seq - Bacterial sequence entries, part 70. 382. gbbct71.seq - Bacterial sequence entries, part 71. 383. gbbct72.seq - Bacterial sequence entries, part 72. 384. gbbct73.seq - Bacterial sequence entries, part 73. 385. gbbct74.seq - Bacterial sequence entries, part 74. 386. gbbct75.seq - Bacterial sequence entries, part 75. 387. gbbct76.seq - Bacterial sequence entries, part 76. 388. gbbct77.seq - Bacterial sequence entries, part 77. 389. gbbct78.seq - Bacterial sequence entries, part 78. 390. gbbct79.seq - Bacterial sequence entries, part 79. 391. gbbct8.seq - Bacterial sequence entries, part 8. 392. gbbct80.seq - Bacterial sequence entries, part 80. 393. gbbct81.seq - Bacterial sequence entries, part 81. 394. gbbct82.seq - Bacterial sequence entries, part 82. 395. gbbct83.seq - Bacterial sequence entries, part 83. 396. gbbct84.seq - Bacterial sequence entries, part 84. 397. gbbct85.seq - Bacterial sequence entries, part 85. 398. gbbct86.seq - Bacterial sequence entries, part 86. 399. gbbct87.seq - Bacterial sequence entries, part 87. 400. gbbct88.seq - Bacterial sequence entries, part 88. 401. gbbct89.seq - Bacterial sequence entries, part 89. 402. gbbct9.seq - Bacterial sequence entries, part 9. 403. gbbct90.seq - Bacterial sequence entries, part 90. 404. gbbct91.seq - Bacterial sequence entries, part 91. 405. gbbct92.seq - Bacterial sequence entries, part 92. 406. gbbct93.seq - Bacterial sequence entries, part 93. 407. gbbct94.seq - Bacterial sequence entries, part 94. 408. gbbct95.seq - Bacterial sequence entries, part 95. 409. gbbct96.seq - Bacterial sequence entries, part 96. 410. gbbct97.seq - Bacterial sequence entries, part 97. 411. gbbct98.seq - Bacterial sequence entries, part 98. 412. gbbct99.seq - Bacterial sequence entries, part 99. 413. gbchg.txt - Accession numbers of entries updated since the previous release. 414. gbcon1.seq - Constructed sequence entries, part 1. 415. gbcon10.seq - Constructed sequence entries, part 10. 416. gbcon11.seq - Constructed sequence entries, part 11. 417. gbcon12.seq - Constructed sequence entries, part 12. 418. gbcon13.seq - Constructed sequence entries, part 13. 419. gbcon14.seq - Constructed sequence entries, part 14. 420. gbcon15.seq - Constructed sequence entries, part 15. 421. gbcon16.seq - Constructed sequence entries, part 16. 422. gbcon17.seq - Constructed sequence entries, part 17. 423. gbcon18.seq - Constructed sequence entries, part 18. 424. gbcon19.seq - Constructed sequence entries, part 19. 425. gbcon2.seq - Constructed sequence entries, part 2. 426. gbcon20.seq - Constructed sequence entries, part 20. 427. gbcon21.seq - Constructed sequence entries, part 21. 428. gbcon22.seq - Constructed sequence entries, part 22. 429. gbcon23.seq - Constructed sequence entries, part 23. 430. gbcon24.seq - Constructed sequence entries, part 24. 431. gbcon25.seq - Constructed sequence entries, part 25. 432. gbcon26.seq - Constructed sequence entries, part 26. 433. gbcon27.seq - Constructed sequence entries, part 27. 434. gbcon28.seq - Constructed sequence entries, part 28. 435. gbcon29.seq - Constructed sequence entries, part 29. 436. gbcon3.seq - Constructed sequence entries, part 3. 437. gbcon30.seq - Constructed sequence entries, part 30. 438. gbcon31.seq - Constructed sequence entries, part 31. 439. gbcon32.seq - Constructed sequence entries, part 32. 440. gbcon33.seq - Constructed sequence entries, part 33. 441. gbcon34.seq - Constructed sequence entries, part 34. 442. gbcon35.seq - Constructed sequence entries, part 35. 443. gbcon36.seq - Constructed sequence entries, part 36. 444. gbcon37.seq - Constructed sequence entries, part 37. 445. gbcon38.seq - Constructed sequence entries, part 38. 446. gbcon39.seq - Constructed sequence entries, part 39. 447. gbcon4.seq - Constructed sequence entries, part 4. 448. gbcon40.seq - Constructed sequence entries, part 40. 449. gbcon41.seq - Constructed sequence entries, part 41. 450. gbcon42.seq - Constructed sequence entries, part 42. 451. gbcon43.seq - Constructed sequence entries, part 43. 452. gbcon44.seq - Constructed sequence entries, part 44. 453. gbcon45.seq - Constructed sequence entries, part 45. 454. gbcon46.seq - Constructed sequence entries, part 46. 455. gbcon47.seq - Constructed sequence entries, part 47. 456. gbcon48.seq - Constructed sequence entries, part 48. 457. gbcon49.seq - Constructed sequence entries, part 49. 458. gbcon5.seq - Constructed sequence entries, part 5. 459. gbcon50.seq - Constructed sequence entries, part 50. 460. gbcon51.seq - Constructed sequence entries, part 51. 461. gbcon52.seq - Constructed sequence entries, part 52. 462. gbcon53.seq - Constructed sequence entries, part 53. 463. gbcon54.seq - Constructed sequence entries, part 54. 464. gbcon55.seq - Constructed sequence entries, part 55. 465. gbcon56.seq - Constructed sequence entries, part 56. 466. gbcon57.seq - Constructed sequence entries, part 57. 467. gbcon58.seq - Constructed sequence entries, part 58. 468. gbcon59.seq - Constructed sequence entries, part 59. 469. gbcon6.seq - Constructed sequence entries, part 6. 470. gbcon60.seq - Constructed sequence entries, part 60. 471. gbcon61.seq - Constructed sequence entries, part 61. 472. gbcon62.seq - Constructed sequence entries, part 62. 473. gbcon63.seq - Constructed sequence entries, part 63. 474. gbcon64.seq - Constructed sequence entries, part 64. 475. gbcon65.seq - Constructed sequence entries, part 65. 476. gbcon66.seq - Constructed sequence entries, part 66. 477. gbcon67.seq - Constructed sequence entries, part 67. 478. gbcon68.seq - Constructed sequence entries, part 68. 479. gbcon7.seq - Constructed sequence entries, part 7. 480. gbcon8.seq - Constructed sequence entries, part 8. 481. gbcon9.seq - Constructed sequence entries, part 9. 482. gbdel.txt - Accession numbers of entries deleted since the previous release. 483. gbenv1.seq - Environmental sampling sequence entries, part 1. 484. gbenv10.seq - Environmental sampling sequence entries, part 10. 485. gbenv11.seq - Environmental sampling sequence entries, part 11. 486. gbenv12.seq - Environmental sampling sequence entries, part 12. 487. gbenv13.seq - Environmental sampling sequence entries, part 13. 488. gbenv14.seq - Environmental sampling sequence entries, part 14. 489. gbenv15.seq - Environmental sampling sequence entries, part 15. 490. gbenv16.seq - Environmental sampling sequence entries, part 16. 491. gbenv17.seq - Environmental sampling sequence entries, part 17. 492. gbenv18.seq - Environmental sampling sequence entries, part 18. 493. gbenv19.seq - Environmental sampling sequence entries, part 19. 494. gbenv2.seq - Environmental sampling sequence entries, part 2. 495. gbenv20.seq - Environmental sampling sequence entries, part 20. 496. gbenv21.seq - Environmental sampling sequence entries, part 21. 497. gbenv22.seq - Environmental sampling sequence entries, part 22. 498. gbenv23.seq - Environmental sampling sequence entries, part 23. 499. gbenv24.seq - Environmental sampling sequence entries, part 24. 500. gbenv25.seq - Environmental sampling sequence entries, part 25. 501. gbenv26.seq - Environmental sampling sequence entries, part 26. 502. gbenv27.seq - Environmental sampling sequence entries, part 27. 503. gbenv3.seq - Environmental sampling sequence entries, part 3. 504. gbenv4.seq - Environmental sampling sequence entries, part 4. 505. gbenv5.seq - Environmental sampling sequence entries, part 5. 506. gbenv6.seq - Environmental sampling sequence entries, part 6. 507. gbenv7.seq - Environmental sampling sequence entries, part 7. 508. gbenv8.seq - Environmental sampling sequence entries, part 8. 509. gbenv9.seq - Environmental sampling sequence entries, part 9. 510. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1. 511. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10. 512. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100. 513. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101. 514. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102. 515. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103. 516. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104. 517. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105. 518. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106. 519. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107. 520. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108. 521. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109. 522. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11. 523. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110. 524. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111. 525. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112. 526. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113. 527. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114. 528. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115. 529. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116. 530. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117. 531. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118. 532. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119. 533. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12. 534. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120. 535. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121. 536. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122. 537. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123. 538. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124. 539. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125. 540. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126. 541. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127. 542. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128. 543. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129. 544. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13. 545. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130. 546. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131. 547. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132. 548. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133. 549. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134. 550. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135. 551. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136. 552. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137. 553. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138. 554. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139. 555. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14. 556. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140. 557. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141. 558. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142. 559. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143. 560. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144. 561. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145. 562. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146. 563. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147. 564. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148. 565. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149. 566. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15. 567. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150. 568. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151. 569. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152. 570. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153. 571. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154. 572. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155. 573. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156. 574. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157. 575. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158. 576. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159. 577. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16. 578. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160. 579. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161. 580. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162. 581. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163. 582. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164. 583. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17. 584. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18. 585. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19. 586. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2. 587. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20. 588. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21. 589. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22. 590. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23. 591. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24. 592. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25. 593. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26. 594. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27. 595. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28. 596. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29. 597. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3. 598. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30. 599. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31. 600. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32. 601. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33. 602. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34. 603. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35. 604. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36. 605. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37. 606. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38. 607. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39. 608. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4. 609. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40. 610. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41. 611. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42. 612. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43. 613. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44. 614. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45. 615. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46. 616. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47. 617. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48. 618. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49. 619. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5. 620. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50. 621. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51. 622. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52. 623. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53. 624. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54. 625. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55. 626. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56. 627. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57. 628. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58. 629. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59. 630. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6. 631. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60. 632. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61. 633. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62. 634. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63. 635. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64. 636. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65. 637. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66. 638. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67. 639. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68. 640. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69. 641. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7. 642. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70. 643. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71. 644. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72. 645. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73. 646. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74. 647. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75. 648. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76. 649. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77. 650. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78. 651. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79. 652. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8. 653. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80. 654. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81. 655. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82. 656. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83. 657. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84. 658. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85. 659. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86. 660. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87. 661. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88. 662. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89. 663. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9. 664. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90. 665. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91. 666. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92. 667. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93. 668. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94. 669. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95. 670. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96. 671. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97. 672. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98. 673. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99. 674. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1. 675. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10. 676. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11. 677. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12. 678. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13. 679. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14. 680. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15. 681. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16. 682. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17. 683. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18. 684. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19. 685. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2. 686. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20. 687. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21. 688. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22. 689. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23. 690. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24. 691. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25. 692. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26. 693. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27. 694. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28. 695. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29. 696. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3. 697. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30. 698. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31. 699. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32. 700. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33. 701. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34. 702. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35. 703. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36. 704. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37. 705. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38. 706. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39. 707. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4. 708. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40. 709. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41. 710. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42. 711. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43. 712. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44. 713. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45. 714. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46. 715. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47. 716. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48. 717. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49. 718. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5. 719. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50. 720. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51. 721. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52. 722. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53. 723. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54. 724. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55. 725. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56. 726. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57. 727. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58. 728. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59. 729. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6. 730. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60. 731. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61. 732. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62. 733. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63. 734. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64. 735. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65. 736. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66. 737. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67. 738. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68. 739. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69. 740. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7. 741. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70. 742. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71. 743. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72. 744. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73. 745. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74. 746. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75. 747. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76. 748. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77. 749. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78. 750. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79. 751. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8. 752. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9. 753. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1. 754. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2. 755. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3. 756. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1. 757. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10. 758. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11. 759. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12. 760. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13. 761. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14. 762. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15. 763. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16. 764. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17. 765. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18. 766. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19. 767. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2. 768. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20. 769. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21. 770. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22. 771. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23. 772. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24. 773. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25. 774. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3. 775. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4. 776. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5. 777. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6. 778. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7. 779. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8. 780. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9. 781. gbinv1.seq - Invertebrate sequence entries, part 1. 782. gbinv10.seq - Invertebrate sequence entries, part 10. 783. gbinv100.seq - Invertebrate sequence entries, part 100. 784. gbinv1000.seq - Invertebrate sequence entries, part 1000. 785. gbinv1001.seq - Invertebrate sequence entries, part 1001. 786. gbinv1002.seq - Invertebrate sequence entries, part 1002. 787. gbinv1003.seq - Invertebrate sequence entries, part 1003. 788. gbinv1004.seq - Invertebrate sequence entries, part 1004. 789. gbinv1005.seq - Invertebrate sequence entries, part 1005. 790. gbinv1006.seq - Invertebrate sequence entries, part 1006. 791. gbinv1007.seq - Invertebrate sequence entries, part 1007. 792. gbinv1008.seq - Invertebrate sequence entries, part 1008. 793. gbinv1009.seq - Invertebrate sequence entries, part 1009. 794. gbinv101.seq - Invertebrate sequence entries, part 101. 795. gbinv1010.seq - Invertebrate sequence entries, part 1010. 796. gbinv1011.seq - Invertebrate sequence entries, part 1011. 797. gbinv1012.seq - Invertebrate sequence entries, part 1012. 798. gbinv1013.seq - Invertebrate sequence entries, part 1013. 799. gbinv1014.seq - Invertebrate sequence entries, part 1014. 800. gbinv1015.seq - Invertebrate sequence entries, part 1015. 801. gbinv1016.seq - Invertebrate sequence entries, part 1016. 802. gbinv1017.seq - Invertebrate sequence entries, part 1017. 803. gbinv1018.seq - Invertebrate sequence entries, part 1018. 804. gbinv1019.seq - Invertebrate sequence entries, part 1019. 805. gbinv102.seq - Invertebrate sequence entries, part 102. 806. gbinv1020.seq - Invertebrate sequence entries, part 1020. 807. gbinv1021.seq - Invertebrate sequence entries, part 1021. 808. gbinv1022.seq - Invertebrate sequence entries, part 1022. 809. gbinv1023.seq - Invertebrate sequence entries, part 1023. 810. gbinv1024.seq - Invertebrate sequence entries, part 1024. 811. gbinv1025.seq - Invertebrate sequence entries, part 1025. 812. gbinv1026.seq - Invertebrate sequence entries, part 1026. 813. gbinv1027.seq - Invertebrate sequence entries, part 1027. 814. gbinv1028.seq - Invertebrate sequence entries, part 1028. 815. gbinv1029.seq - Invertebrate sequence entries, part 1029. 816. gbinv103.seq - Invertebrate sequence entries, part 103. 817. gbinv1030.seq - Invertebrate sequence entries, part 1030. 818. gbinv1031.seq - Invertebrate sequence entries, part 1031. 819. gbinv1032.seq - Invertebrate sequence entries, part 1032. 820. gbinv1033.seq - Invertebrate sequence entries, part 1033. 821. gbinv1034.seq - Invertebrate sequence entries, part 1034. 822. gbinv1035.seq - Invertebrate sequence entries, part 1035. 823. gbinv1036.seq - Invertebrate sequence entries, part 1036. 824. gbinv1037.seq - Invertebrate sequence entries, part 1037. 825. gbinv1038.seq - Invertebrate sequence entries, part 1038. 826. gbinv1039.seq - Invertebrate sequence entries, part 1039. 827. gbinv104.seq - Invertebrate sequence entries, part 104. 828. gbinv1040.seq - Invertebrate sequence entries, part 1040. 829. gbinv1041.seq - Invertebrate sequence entries, part 1041. 830. gbinv1042.seq - Invertebrate sequence entries, part 1042. 831. gbinv1043.seq - Invertebrate sequence entries, part 1043. 832. gbinv1044.seq - Invertebrate sequence entries, part 1044. 833. gbinv1045.seq - Invertebrate sequence entries, part 1045. 834. gbinv1046.seq - Invertebrate sequence entries, part 1046. 835. gbinv1047.seq - Invertebrate sequence entries, part 1047. 836. gbinv1048.seq - Invertebrate sequence entries, part 1048. 837. gbinv1049.seq - Invertebrate sequence entries, part 1049. 838. gbinv105.seq - Invertebrate sequence entries, part 105. 839. gbinv1050.seq - Invertebrate sequence entries, part 1050. 840. gbinv1051.seq - Invertebrate sequence entries, part 1051. 841. gbinv1052.seq - Invertebrate sequence entries, part 1052. 842. gbinv1053.seq - Invertebrate sequence entries, part 1053. 843. gbinv1054.seq - Invertebrate sequence entries, part 1054. 844. gbinv1055.seq - Invertebrate sequence entries, part 1055. 845. gbinv1056.seq - Invertebrate sequence entries, part 1056. 846. gbinv1057.seq - Invertebrate sequence entries, part 1057. 847. gbinv1058.seq - Invertebrate sequence entries, part 1058. 848. gbinv1059.seq - Invertebrate sequence entries, part 1059. 849. gbinv106.seq - Invertebrate sequence entries, part 106. 850. gbinv1060.seq - Invertebrate sequence entries, part 1060. 851. gbinv1061.seq - Invertebrate sequence entries, part 1061. 852. gbinv1062.seq - Invertebrate sequence entries, part 1062. 853. gbinv1063.seq - Invertebrate sequence entries, part 1063. 854. gbinv1064.seq - Invertebrate sequence entries, part 1064. 855. gbinv1065.seq - Invertebrate sequence entries, part 1065. 856. gbinv1066.seq - Invertebrate sequence entries, part 1066. 857. gbinv1067.seq - Invertebrate sequence entries, part 1067. 858. gbinv1068.seq - Invertebrate sequence entries, part 1068. 859. gbinv1069.seq - Invertebrate sequence entries, part 1069. 860. gbinv107.seq - Invertebrate sequence entries, part 107. 861. gbinv1070.seq - Invertebrate sequence entries, part 1070. 862. gbinv1071.seq - Invertebrate sequence entries, part 1071. 863. gbinv1072.seq - Invertebrate sequence entries, part 1072. 864. gbinv1073.seq - Invertebrate sequence entries, part 1073. 865. gbinv1074.seq - Invertebrate sequence entries, part 1074. 866. gbinv1075.seq - Invertebrate sequence entries, part 1075. 867. gbinv1076.seq - Invertebrate sequence entries, part 1076. 868. gbinv1077.seq - Invertebrate sequence entries, part 1077. 869. gbinv1078.seq - Invertebrate sequence entries, part 1078. 870. gbinv1079.seq - Invertebrate sequence entries, part 1079. 871. gbinv108.seq - Invertebrate sequence entries, part 108. 872. gbinv1080.seq - Invertebrate sequence entries, part 1080. 873. gbinv1081.seq - Invertebrate sequence entries, part 1081. 874. gbinv1082.seq - Invertebrate sequence entries, part 1082. 875. gbinv109.seq - Invertebrate sequence entries, part 109. 876. gbinv11.seq - Invertebrate sequence entries, part 11. 877. gbinv110.seq - Invertebrate sequence entries, part 110. 878. gbinv111.seq - Invertebrate sequence entries, part 111. 879. gbinv112.seq - Invertebrate sequence entries, part 112. 880. gbinv113.seq - Invertebrate sequence entries, part 113. 881. gbinv114.seq - Invertebrate sequence entries, part 114. 882. gbinv115.seq - Invertebrate sequence entries, part 115. 883. gbinv116.seq - Invertebrate sequence entries, part 116. 884. gbinv117.seq - Invertebrate sequence entries, part 117. 885. gbinv118.seq - Invertebrate sequence entries, part 118. 886. gbinv119.seq - Invertebrate sequence entries, part 119. 887. gbinv12.seq - Invertebrate sequence entries, part 12. 888. gbinv120.seq - Invertebrate sequence entries, part 120. 889. gbinv121.seq - Invertebrate sequence entries, part 121. 890. gbinv122.seq - Invertebrate sequence entries, part 122. 891. gbinv123.seq - Invertebrate sequence entries, part 123. 892. gbinv124.seq - Invertebrate sequence entries, part 124. 893. gbinv125.seq - Invertebrate sequence entries, part 125. 894. gbinv126.seq - Invertebrate sequence entries, part 126. 895. gbinv127.seq - Invertebrate sequence entries, part 127. 896. gbinv128.seq - Invertebrate sequence entries, part 128. 897. gbinv129.seq - Invertebrate sequence entries, part 129. 898. gbinv13.seq - Invertebrate sequence entries, part 13. 899. gbinv130.seq - Invertebrate sequence entries, part 130. 900. gbinv131.seq - Invertebrate sequence entries, part 131. 901. gbinv132.seq - Invertebrate sequence entries, part 132. 902. gbinv133.seq - Invertebrate sequence entries, part 133. 903. gbinv134.seq - Invertebrate sequence entries, part 134. 904. gbinv135.seq - Invertebrate sequence entries, part 135. 905. gbinv136.seq - Invertebrate sequence entries, part 136. 906. gbinv137.seq - Invertebrate sequence entries, part 137. 907. gbinv138.seq - Invertebrate sequence entries, part 138. 908. gbinv139.seq - Invertebrate sequence entries, part 139. 909. gbinv14.seq - Invertebrate sequence entries, part 14. 910. gbinv140.seq - Invertebrate sequence entries, part 140. 911. gbinv141.seq - Invertebrate sequence entries, part 141. 912. gbinv142.seq - Invertebrate sequence entries, part 142. 913. gbinv143.seq - Invertebrate sequence entries, part 143. 914. gbinv144.seq - Invertebrate sequence entries, part 144. 915. gbinv145.seq - Invertebrate sequence entries, part 145. 916. gbinv146.seq - Invertebrate sequence entries, part 146. 917. gbinv147.seq - Invertebrate sequence entries, part 147. 918. gbinv148.seq - Invertebrate sequence entries, part 148. 919. gbinv149.seq - Invertebrate sequence entries, part 149. 920. gbinv15.seq - Invertebrate sequence entries, part 15. 921. gbinv150.seq - Invertebrate sequence entries, part 150. 922. gbinv151.seq - Invertebrate sequence entries, part 151. 923. gbinv152.seq - Invertebrate sequence entries, part 152. 924. gbinv153.seq - Invertebrate sequence entries, part 153. 925. gbinv154.seq - Invertebrate sequence entries, part 154. 926. gbinv155.seq - Invertebrate sequence entries, part 155. 927. gbinv156.seq - Invertebrate sequence entries, part 156. 928. gbinv157.seq - Invertebrate sequence entries, part 157. 929. gbinv158.seq - Invertebrate sequence entries, part 158. 930. gbinv159.seq - Invertebrate sequence entries, part 159. 931. gbinv16.seq - Invertebrate sequence entries, part 16. 932. gbinv160.seq - Invertebrate sequence entries, part 160. 933. gbinv161.seq - Invertebrate sequence entries, part 161. 934. gbinv162.seq - Invertebrate sequence entries, part 162. 935. gbinv163.seq - Invertebrate sequence entries, part 163. 936. gbinv164.seq - Invertebrate sequence entries, part 164. 937. gbinv165.seq - Invertebrate sequence entries, part 165. 938. gbinv166.seq - Invertebrate sequence entries, part 166. 939. gbinv167.seq - Invertebrate sequence entries, part 167. 940. gbinv168.seq - Invertebrate sequence entries, part 168. 941. gbinv169.seq - Invertebrate sequence entries, part 169. 942. gbinv17.seq - Invertebrate sequence entries, part 17. 943. gbinv170.seq - Invertebrate sequence entries, part 170. 944. gbinv171.seq - Invertebrate sequence entries, part 171. 945. gbinv172.seq - Invertebrate sequence entries, part 172. 946. gbinv173.seq - Invertebrate sequence entries, part 173. 947. gbinv174.seq - Invertebrate sequence entries, part 174. 948. gbinv175.seq - Invertebrate sequence entries, part 175. 949. gbinv176.seq - Invertebrate sequence entries, part 176. 950. gbinv177.seq - Invertebrate sequence entries, part 177. 951. gbinv178.seq - Invertebrate sequence entries, part 178. 952. gbinv179.seq - Invertebrate sequence entries, part 179. 953. gbinv18.seq - Invertebrate sequence entries, part 18. 954. gbinv180.seq - Invertebrate sequence entries, part 180. 955. gbinv181.seq - Invertebrate sequence entries, part 181. 956. gbinv182.seq - Invertebrate sequence entries, part 182. 957. gbinv183.seq - Invertebrate sequence entries, part 183. 958. gbinv184.seq - Invertebrate sequence entries, part 184. 959. gbinv185.seq - Invertebrate sequence entries, part 185. 960. gbinv186.seq - Invertebrate sequence entries, part 186. 961. gbinv187.seq - Invertebrate sequence entries, part 187. 962. gbinv188.seq - Invertebrate sequence entries, part 188. 963. gbinv189.seq - Invertebrate sequence entries, part 189. 964. gbinv19.seq - Invertebrate sequence entries, part 19. 965. gbinv190.seq - Invertebrate sequence entries, part 190. 966. gbinv191.seq - Invertebrate sequence entries, part 191. 967. gbinv192.seq - Invertebrate sequence entries, part 192. 968. gbinv193.seq - Invertebrate sequence entries, part 193. 969. gbinv194.seq - Invertebrate sequence entries, part 194. 970. gbinv195.seq - Invertebrate sequence entries, part 195. 971. gbinv196.seq - Invertebrate sequence entries, part 196. 972. gbinv197.seq - Invertebrate sequence entries, part 197. 973. gbinv198.seq - Invertebrate sequence entries, part 198. 974. gbinv199.seq - Invertebrate sequence entries, part 199. 975. gbinv2.seq - Invertebrate sequence entries, part 2. 976. gbinv20.seq - Invertebrate sequence entries, part 20. 977. gbinv200.seq - Invertebrate sequence entries, part 200. 978. gbinv201.seq - Invertebrate sequence entries, part 201. 979. gbinv202.seq - Invertebrate sequence entries, part 202. 980. gbinv203.seq - Invertebrate sequence entries, part 203. 981. gbinv204.seq - Invertebrate sequence entries, part 204. 982. gbinv205.seq - Invertebrate sequence entries, part 205. 983. gbinv206.seq - Invertebrate sequence entries, part 206. 984. gbinv207.seq - Invertebrate sequence entries, part 207. 985. gbinv208.seq - Invertebrate sequence entries, part 208. 986. gbinv209.seq - Invertebrate sequence entries, part 209. 987. gbinv21.seq - Invertebrate sequence entries, part 21. 988. gbinv210.seq - Invertebrate sequence entries, part 210. 989. gbinv211.seq - Invertebrate sequence entries, part 211. 990. gbinv212.seq - Invertebrate sequence entries, part 212. 991. gbinv213.seq - Invertebrate sequence entries, part 213. 992. gbinv214.seq - Invertebrate sequence entries, part 214. 993. gbinv215.seq - Invertebrate sequence entries, part 215. 994. gbinv216.seq - Invertebrate sequence entries, part 216. 995. gbinv217.seq - Invertebrate sequence entries, part 217. 996. gbinv218.seq - Invertebrate sequence entries, part 218. 997. gbinv219.seq - Invertebrate sequence entries, part 219. 998. gbinv22.seq - Invertebrate sequence entries, part 22. 999. gbinv220.seq - Invertebrate sequence entries, part 220. 1000. gbinv221.seq - Invertebrate sequence entries, part 221. 1001. gbinv222.seq - Invertebrate sequence entries, part 222. 1002. gbinv223.seq - Invertebrate sequence entries, part 223. 1003. gbinv224.seq - Invertebrate sequence entries, part 224. 1004. gbinv225.seq - Invertebrate sequence entries, part 225. 1005. gbinv226.seq - Invertebrate sequence entries, part 226. 1006. gbinv227.seq - Invertebrate sequence entries, part 227. 1007. gbinv228.seq - Invertebrate sequence entries, part 228. 1008. gbinv229.seq - Invertebrate sequence entries, part 229. 1009. gbinv23.seq - Invertebrate sequence entries, part 23. 1010. gbinv230.seq - Invertebrate sequence entries, part 230. 1011. gbinv231.seq - Invertebrate sequence entries, part 231. 1012. gbinv232.seq - Invertebrate sequence entries, part 232. 1013. gbinv233.seq - Invertebrate sequence entries, part 233. 1014. gbinv234.seq - Invertebrate sequence entries, part 234. 1015. gbinv235.seq - Invertebrate sequence entries, part 235. 1016. gbinv236.seq - Invertebrate sequence entries, part 236. 1017. gbinv237.seq - Invertebrate sequence entries, part 237. 1018. gbinv238.seq - Invertebrate sequence entries, part 238. 1019. gbinv239.seq - Invertebrate sequence entries, part 239. 1020. gbinv24.seq - Invertebrate sequence entries, part 24. 1021. gbinv240.seq - Invertebrate sequence entries, part 240. 1022. gbinv241.seq - Invertebrate sequence entries, part 241. 1023. gbinv242.seq - Invertebrate sequence entries, part 242. 1024. gbinv243.seq - Invertebrate sequence entries, part 243. 1025. gbinv244.seq - Invertebrate sequence entries, part 244. 1026. gbinv245.seq - Invertebrate sequence entries, part 245. 1027. gbinv246.seq - Invertebrate sequence entries, part 246. 1028. gbinv247.seq - Invertebrate sequence entries, part 247. 1029. gbinv248.seq - Invertebrate sequence entries, part 248. 1030. gbinv249.seq - Invertebrate sequence entries, part 249. 1031. gbinv25.seq - Invertebrate sequence entries, part 25. 1032. gbinv250.seq - Invertebrate sequence entries, part 250. 1033. gbinv251.seq - Invertebrate sequence entries, part 251. 1034. gbinv252.seq - Invertebrate sequence entries, part 252. 1035. gbinv253.seq - Invertebrate sequence entries, part 253. 1036. gbinv254.seq - Invertebrate sequence entries, part 254. 1037. gbinv255.seq - Invertebrate sequence entries, part 255. 1038. gbinv256.seq - Invertebrate sequence entries, part 256. 1039. gbinv257.seq - Invertebrate sequence entries, part 257. 1040. gbinv258.seq - Invertebrate sequence entries, part 258. 1041. gbinv259.seq - Invertebrate sequence entries, part 259. 1042. gbinv26.seq - Invertebrate sequence entries, part 26. 1043. gbinv260.seq - Invertebrate sequence entries, part 260. 1044. gbinv261.seq - Invertebrate sequence entries, part 261. 1045. gbinv262.seq - Invertebrate sequence entries, part 262. 1046. gbinv263.seq - Invertebrate sequence entries, part 263. 1047. gbinv264.seq - Invertebrate sequence entries, part 264. 1048. gbinv265.seq - Invertebrate sequence entries, part 265. 1049. gbinv266.seq - Invertebrate sequence entries, part 266. 1050. gbinv267.seq - Invertebrate sequence entries, part 267. 1051. gbinv268.seq - Invertebrate sequence entries, part 268. 1052. gbinv269.seq - Invertebrate sequence entries, part 269. 1053. gbinv27.seq - Invertebrate sequence entries, part 27. 1054. gbinv270.seq - Invertebrate sequence entries, part 270. 1055. gbinv271.seq - Invertebrate sequence entries, part 271. 1056. gbinv272.seq - Invertebrate sequence entries, part 272. 1057. gbinv273.seq - Invertebrate sequence entries, part 273. 1058. gbinv274.seq - Invertebrate sequence entries, part 274. 1059. gbinv275.seq - Invertebrate sequence entries, part 275. 1060. gbinv276.seq - Invertebrate sequence entries, part 276. 1061. gbinv277.seq - Invertebrate sequence entries, part 277. 1062. gbinv278.seq - Invertebrate sequence entries, part 278. 1063. gbinv279.seq - Invertebrate sequence entries, part 279. 1064. gbinv28.seq - Invertebrate sequence entries, part 28. 1065. gbinv280.seq - Invertebrate sequence entries, part 280. 1066. gbinv281.seq - Invertebrate sequence entries, part 281. 1067. gbinv282.seq - Invertebrate sequence entries, part 282. 1068. gbinv283.seq - Invertebrate sequence entries, part 283. 1069. gbinv284.seq - Invertebrate sequence entries, part 284. 1070. gbinv285.seq - Invertebrate sequence entries, part 285. 1071. gbinv286.seq - Invertebrate sequence entries, part 286. 1072. gbinv287.seq - Invertebrate sequence entries, part 287. 1073. gbinv288.seq - Invertebrate sequence entries, part 288. 1074. gbinv289.seq - Invertebrate sequence entries, part 289. 1075. gbinv29.seq - Invertebrate sequence entries, part 29. 1076. gbinv290.seq - Invertebrate sequence entries, part 290. 1077. gbinv291.seq - Invertebrate sequence entries, part 291. 1078. gbinv292.seq - Invertebrate sequence entries, part 292. 1079. gbinv293.seq - Invertebrate sequence entries, part 293. 1080. gbinv294.seq - Invertebrate sequence entries, part 294. 1081. gbinv295.seq - Invertebrate sequence entries, part 295. 1082. gbinv296.seq - Invertebrate sequence entries, part 296. 1083. gbinv297.seq - Invertebrate sequence entries, part 297. 1084. gbinv298.seq - Invertebrate sequence entries, part 298. 1085. gbinv299.seq - Invertebrate sequence entries, part 299. 1086. gbinv3.seq - Invertebrate sequence entries, part 3. 1087. gbinv30.seq - Invertebrate sequence entries, part 30. 1088. gbinv300.seq - Invertebrate sequence entries, part 300. 1089. gbinv301.seq - Invertebrate sequence entries, part 301. 1090. gbinv302.seq - Invertebrate sequence entries, part 302. 1091. gbinv303.seq - Invertebrate sequence entries, part 303. 1092. gbinv304.seq - Invertebrate sequence entries, part 304. 1093. gbinv305.seq - Invertebrate sequence entries, part 305. 1094. gbinv306.seq - Invertebrate sequence entries, part 306. 1095. gbinv307.seq - Invertebrate sequence entries, part 307. 1096. gbinv308.seq - Invertebrate sequence entries, part 308. 1097. gbinv309.seq - Invertebrate sequence entries, part 309. 1098. gbinv31.seq - Invertebrate sequence entries, part 31. 1099. gbinv310.seq - Invertebrate sequence entries, part 310. 1100. gbinv311.seq - Invertebrate sequence entries, part 311. 1101. gbinv312.seq - Invertebrate sequence entries, part 312. 1102. gbinv313.seq - Invertebrate sequence entries, part 313. 1103. gbinv314.seq - Invertebrate sequence entries, part 314. 1104. gbinv315.seq - Invertebrate sequence entries, part 315. 1105. gbinv316.seq - Invertebrate sequence entries, part 316. 1106. gbinv317.seq - Invertebrate sequence entries, part 317. 1107. gbinv318.seq - Invertebrate sequence entries, part 318. 1108. gbinv319.seq - Invertebrate sequence entries, part 319. 1109. gbinv32.seq - Invertebrate sequence entries, part 32. 1110. gbinv320.seq - Invertebrate sequence entries, part 320. 1111. gbinv321.seq - Invertebrate sequence entries, part 321. 1112. gbinv322.seq - Invertebrate sequence entries, part 322. 1113. gbinv323.seq - Invertebrate sequence entries, part 323. 1114. gbinv324.seq - Invertebrate sequence entries, part 324. 1115. gbinv325.seq - Invertebrate sequence entries, part 325. 1116. gbinv326.seq - Invertebrate sequence entries, part 326. 1117. gbinv327.seq - Invertebrate sequence entries, part 327. 1118. gbinv328.seq - Invertebrate sequence entries, part 328. 1119. gbinv329.seq - Invertebrate sequence entries, part 329. 1120. gbinv33.seq - Invertebrate sequence entries, part 33. 1121. gbinv330.seq - Invertebrate sequence entries, part 330. 1122. gbinv331.seq - Invertebrate sequence entries, part 331. 1123. gbinv332.seq - Invertebrate sequence entries, part 332. 1124. gbinv333.seq - Invertebrate sequence entries, part 333. 1125. gbinv334.seq - Invertebrate sequence entries, part 334. 1126. gbinv335.seq - Invertebrate sequence entries, part 335. 1127. gbinv336.seq - Invertebrate sequence entries, part 336. 1128. gbinv337.seq - Invertebrate sequence entries, part 337. 1129. gbinv338.seq - Invertebrate sequence entries, part 338. 1130. gbinv339.seq - Invertebrate sequence entries, part 339. 1131. gbinv34.seq - Invertebrate sequence entries, part 34. 1132. gbinv340.seq - Invertebrate sequence entries, part 340. 1133. gbinv341.seq - Invertebrate sequence entries, part 341. 1134. gbinv342.seq - Invertebrate sequence entries, part 342. 1135. gbinv343.seq - Invertebrate sequence entries, part 343. 1136. gbinv344.seq - Invertebrate sequence entries, part 344. 1137. gbinv345.seq - Invertebrate sequence entries, part 345. 1138. gbinv346.seq - Invertebrate sequence entries, part 346. 1139. gbinv347.seq - Invertebrate sequence entries, part 347. 1140. gbinv348.seq - Invertebrate sequence entries, part 348. 1141. gbinv349.seq - Invertebrate sequence entries, part 349. 1142. gbinv35.seq - Invertebrate sequence entries, part 35. 1143. gbinv350.seq - Invertebrate sequence entries, part 350. 1144. gbinv351.seq - Invertebrate sequence entries, part 351. 1145. gbinv352.seq - Invertebrate sequence entries, part 352. 1146. gbinv353.seq - Invertebrate sequence entries, part 353. 1147. gbinv354.seq - Invertebrate sequence entries, part 354. 1148. gbinv355.seq - Invertebrate sequence entries, part 355. 1149. gbinv356.seq - Invertebrate sequence entries, part 356. 1150. gbinv357.seq - Invertebrate sequence entries, part 357. 1151. gbinv358.seq - Invertebrate sequence entries, part 358. 1152. gbinv359.seq - Invertebrate sequence entries, part 359. 1153. gbinv36.seq - Invertebrate sequence entries, part 36. 1154. gbinv360.seq - Invertebrate sequence entries, part 360. 1155. gbinv361.seq - Invertebrate sequence entries, part 361. 1156. gbinv362.seq - Invertebrate sequence entries, part 362. 1157. gbinv363.seq - Invertebrate sequence entries, part 363. 1158. gbinv364.seq - Invertebrate sequence entries, part 364. 1159. gbinv365.seq - Invertebrate sequence entries, part 365. 1160. gbinv366.seq - Invertebrate sequence entries, part 366. 1161. gbinv367.seq - Invertebrate sequence entries, part 367. 1162. gbinv368.seq - Invertebrate sequence entries, part 368. 1163. gbinv369.seq - Invertebrate sequence entries, part 369. 1164. gbinv37.seq - Invertebrate sequence entries, part 37. 1165. gbinv370.seq - Invertebrate sequence entries, part 370. 1166. gbinv371.seq - Invertebrate sequence entries, part 371. 1167. gbinv372.seq - Invertebrate sequence entries, part 372. 1168. gbinv373.seq - Invertebrate sequence entries, part 373. 1169. gbinv374.seq - Invertebrate sequence entries, part 374. 1170. gbinv375.seq - Invertebrate sequence entries, part 375. 1171. gbinv376.seq - Invertebrate sequence entries, part 376. 1172. gbinv377.seq - Invertebrate sequence entries, part 377. 1173. gbinv378.seq - Invertebrate sequence entries, part 378. 1174. gbinv379.seq - Invertebrate sequence entries, part 379. 1175. gbinv38.seq - Invertebrate sequence entries, part 38. 1176. gbinv380.seq - Invertebrate sequence entries, part 380. 1177. gbinv381.seq - Invertebrate sequence entries, part 381. 1178. gbinv382.seq - Invertebrate sequence entries, part 382. 1179. gbinv383.seq - Invertebrate sequence entries, part 383. 1180. gbinv384.seq - Invertebrate sequence entries, part 384. 1181. gbinv385.seq - Invertebrate sequence entries, part 385. 1182. gbinv386.seq - Invertebrate sequence entries, part 386. 1183. gbinv387.seq - Invertebrate sequence entries, part 387. 1184. gbinv388.seq - Invertebrate sequence entries, part 388. 1185. gbinv389.seq - Invertebrate sequence entries, part 389. 1186. gbinv39.seq - Invertebrate sequence entries, part 39. 1187. gbinv390.seq - Invertebrate sequence entries, part 390. 1188. gbinv391.seq - Invertebrate sequence entries, part 391. 1189. gbinv392.seq - Invertebrate sequence entries, part 392. 1190. gbinv393.seq - Invertebrate sequence entries, part 393. 1191. gbinv394.seq - Invertebrate sequence entries, part 394. 1192. gbinv395.seq - Invertebrate sequence entries, part 395. 1193. gbinv396.seq - Invertebrate sequence entries, part 396. 1194. gbinv397.seq - Invertebrate sequence entries, part 397. 1195. gbinv398.seq - Invertebrate sequence entries, part 398. 1196. gbinv399.seq - Invertebrate sequence entries, part 399. 1197. gbinv4.seq - Invertebrate sequence entries, part 4. 1198. gbinv40.seq - Invertebrate sequence entries, part 40. 1199. gbinv400.seq - Invertebrate sequence entries, part 400. 1200. gbinv401.seq - Invertebrate sequence entries, part 401. 1201. gbinv402.seq - Invertebrate sequence entries, part 402. 1202. gbinv403.seq - Invertebrate sequence entries, part 403. 1203. gbinv404.seq - Invertebrate sequence entries, part 404. 1204. gbinv405.seq - Invertebrate sequence entries, part 405. 1205. gbinv406.seq - Invertebrate sequence entries, part 406. 1206. gbinv407.seq - Invertebrate sequence entries, part 407. 1207. gbinv408.seq - Invertebrate sequence entries, part 408. 1208. gbinv409.seq - Invertebrate sequence entries, part 409. 1209. gbinv41.seq - Invertebrate sequence entries, part 41. 1210. gbinv410.seq - Invertebrate sequence entries, part 410. 1211. gbinv411.seq - Invertebrate sequence entries, part 411. 1212. gbinv412.seq - Invertebrate sequence entries, part 412. 1213. gbinv413.seq - Invertebrate sequence entries, part 413. 1214. gbinv414.seq - Invertebrate sequence entries, part 414. 1215. gbinv415.seq - Invertebrate sequence entries, part 415. 1216. gbinv416.seq - Invertebrate sequence entries, part 416. 1217. gbinv417.seq - Invertebrate sequence entries, part 417. 1218. gbinv418.seq - Invertebrate sequence entries, part 418. 1219. gbinv419.seq - Invertebrate sequence entries, part 419. 1220. gbinv42.seq - Invertebrate sequence entries, part 42. 1221. gbinv420.seq - Invertebrate sequence entries, part 420. 1222. gbinv421.seq - Invertebrate sequence entries, part 421. 1223. gbinv422.seq - Invertebrate sequence entries, part 422. 1224. gbinv423.seq - Invertebrate sequence entries, part 423. 1225. gbinv424.seq - Invertebrate sequence entries, part 424. 1226. gbinv425.seq - Invertebrate sequence entries, part 425. 1227. gbinv426.seq - Invertebrate sequence entries, part 426. 1228. gbinv427.seq - Invertebrate sequence entries, part 427. 1229. gbinv428.seq - Invertebrate sequence entries, part 428. 1230. gbinv429.seq - Invertebrate sequence entries, part 429. 1231. gbinv43.seq - Invertebrate sequence entries, part 43. 1232. gbinv430.seq - Invertebrate sequence entries, part 430. 1233. gbinv431.seq - Invertebrate sequence entries, part 431. 1234. gbinv432.seq - Invertebrate sequence entries, part 432. 1235. gbinv433.seq - Invertebrate sequence entries, part 433. 1236. gbinv434.seq - Invertebrate sequence entries, part 434. 1237. gbinv435.seq - Invertebrate sequence entries, part 435. 1238. gbinv436.seq - Invertebrate sequence entries, part 436. 1239. gbinv437.seq - Invertebrate sequence entries, part 437. 1240. gbinv438.seq - Invertebrate sequence entries, part 438. 1241. gbinv439.seq - Invertebrate sequence entries, part 439. 1242. gbinv44.seq - Invertebrate sequence entries, part 44. 1243. gbinv440.seq - Invertebrate sequence entries, part 440. 1244. gbinv441.seq - Invertebrate sequence entries, part 441. 1245. gbinv442.seq - Invertebrate sequence entries, part 442. 1246. gbinv443.seq - Invertebrate sequence entries, part 443. 1247. gbinv444.seq - Invertebrate sequence entries, part 444. 1248. gbinv445.seq - Invertebrate sequence entries, part 445. 1249. gbinv446.seq - Invertebrate sequence entries, part 446. 1250. gbinv447.seq - Invertebrate sequence entries, part 447. 1251. gbinv448.seq - Invertebrate sequence entries, part 448. 1252. gbinv449.seq - Invertebrate sequence entries, part 449. 1253. gbinv45.seq - Invertebrate sequence entries, part 45. 1254. gbinv450.seq - Invertebrate sequence entries, part 450. 1255. gbinv451.seq - Invertebrate sequence entries, part 451. 1256. gbinv452.seq - Invertebrate sequence entries, part 452. 1257. gbinv453.seq - Invertebrate sequence entries, part 453. 1258. gbinv454.seq - Invertebrate sequence entries, part 454. 1259. gbinv455.seq - Invertebrate sequence entries, part 455. 1260. gbinv456.seq - Invertebrate sequence entries, part 456. 1261. gbinv457.seq - Invertebrate sequence entries, part 457. 1262. gbinv458.seq - Invertebrate sequence entries, part 458. 1263. gbinv459.seq - Invertebrate sequence entries, part 459. 1264. gbinv46.seq - Invertebrate sequence entries, part 46. 1265. gbinv460.seq - Invertebrate sequence entries, part 460. 1266. gbinv461.seq - Invertebrate sequence entries, part 461. 1267. gbinv462.seq - Invertebrate sequence entries, part 462. 1268. gbinv463.seq - Invertebrate sequence entries, part 463. 1269. gbinv464.seq - Invertebrate sequence entries, part 464. 1270. gbinv465.seq - Invertebrate sequence entries, part 465. 1271. gbinv466.seq - Invertebrate sequence entries, part 466. 1272. gbinv467.seq - Invertebrate sequence entries, part 467. 1273. gbinv468.seq - Invertebrate sequence entries, part 468. 1274. gbinv469.seq - Invertebrate sequence entries, part 469. 1275. gbinv47.seq - Invertebrate sequence entries, part 47. 1276. gbinv470.seq - Invertebrate sequence entries, part 470. 1277. gbinv471.seq - Invertebrate sequence entries, part 471. 1278. gbinv472.seq - Invertebrate sequence entries, part 472. 1279. gbinv473.seq - Invertebrate sequence entries, part 473. 1280. gbinv474.seq - Invertebrate sequence entries, part 474. 1281. gbinv475.seq - Invertebrate sequence entries, part 475. 1282. gbinv476.seq - Invertebrate sequence entries, part 476. 1283. gbinv477.seq - Invertebrate sequence entries, part 477. 1284. gbinv478.seq - Invertebrate sequence entries, part 478. 1285. gbinv479.seq - Invertebrate sequence entries, part 479. 1286. gbinv48.seq - Invertebrate sequence entries, part 48. 1287. gbinv480.seq - Invertebrate sequence entries, part 480. 1288. gbinv481.seq - Invertebrate sequence entries, part 481. 1289. gbinv482.seq - Invertebrate sequence entries, part 482. 1290. gbinv483.seq - Invertebrate sequence entries, part 483. 1291. gbinv484.seq - Invertebrate sequence entries, part 484. 1292. gbinv485.seq - Invertebrate sequence entries, part 485. 1293. gbinv486.seq - Invertebrate sequence entries, part 486. 1294. gbinv487.seq - Invertebrate sequence entries, part 487. 1295. gbinv488.seq - Invertebrate sequence entries, part 488. 1296. gbinv489.seq - Invertebrate sequence entries, part 489. 1297. gbinv49.seq - Invertebrate sequence entries, part 49. 1298. gbinv490.seq - Invertebrate sequence entries, part 490. 1299. gbinv491.seq - Invertebrate sequence entries, part 491. 1300. gbinv492.seq - Invertebrate sequence entries, part 492. 1301. gbinv493.seq - Invertebrate sequence entries, part 493. 1302. gbinv494.seq - Invertebrate sequence entries, part 494. 1303. gbinv495.seq - Invertebrate sequence entries, part 495. 1304. gbinv496.seq - Invertebrate sequence entries, part 496. 1305. gbinv497.seq - Invertebrate sequence entries, part 497. 1306. gbinv498.seq - Invertebrate sequence entries, part 498. 1307. gbinv499.seq - Invertebrate sequence entries, part 499. 1308. gbinv5.seq - Invertebrate sequence entries, part 5. 1309. gbinv50.seq - Invertebrate sequence entries, part 50. 1310. gbinv500.seq - Invertebrate sequence entries, part 500. 1311. gbinv501.seq - Invertebrate sequence entries, part 501. 1312. gbinv502.seq - Invertebrate sequence entries, part 502. 1313. gbinv503.seq - Invertebrate sequence entries, part 503. 1314. gbinv504.seq - Invertebrate sequence entries, part 504. 1315. gbinv505.seq - Invertebrate sequence entries, part 505. 1316. gbinv506.seq - Invertebrate sequence entries, part 506. 1317. gbinv507.seq - Invertebrate sequence entries, part 507. 1318. gbinv508.seq - Invertebrate sequence entries, part 508. 1319. gbinv509.seq - Invertebrate sequence entries, part 509. 1320. gbinv51.seq - Invertebrate sequence entries, part 51. 1321. gbinv510.seq - Invertebrate sequence entries, part 510. 1322. gbinv511.seq - Invertebrate sequence entries, part 511. 1323. gbinv512.seq - Invertebrate sequence entries, part 512. 1324. gbinv513.seq - Invertebrate sequence entries, part 513. 1325. gbinv514.seq - Invertebrate sequence entries, part 514. 1326. gbinv515.seq - Invertebrate sequence entries, part 515. 1327. gbinv516.seq - Invertebrate sequence entries, part 516. 1328. gbinv517.seq - Invertebrate sequence entries, part 517. 1329. gbinv518.seq - Invertebrate sequence entries, part 518. 1330. gbinv519.seq - Invertebrate sequence entries, part 519. 1331. gbinv52.seq - Invertebrate sequence entries, part 52. 1332. gbinv520.seq - Invertebrate sequence entries, part 520. 1333. gbinv521.seq - Invertebrate sequence entries, part 521. 1334. gbinv522.seq - Invertebrate sequence entries, part 522. 1335. gbinv523.seq - Invertebrate sequence entries, part 523. 1336. gbinv524.seq - Invertebrate sequence entries, part 524. 1337. gbinv525.seq - Invertebrate sequence entries, part 525. 1338. gbinv526.seq - Invertebrate sequence entries, part 526. 1339. gbinv527.seq - Invertebrate sequence entries, part 527. 1340. gbinv528.seq - Invertebrate sequence entries, part 528. 1341. gbinv529.seq - Invertebrate sequence entries, part 529. 1342. gbinv53.seq - Invertebrate sequence entries, part 53. 1343. gbinv530.seq - Invertebrate sequence entries, part 530. 1344. gbinv531.seq - Invertebrate sequence entries, part 531. 1345. gbinv532.seq - Invertebrate sequence entries, part 532. 1346. gbinv533.seq - Invertebrate sequence entries, part 533. 1347. gbinv534.seq - Invertebrate sequence entries, part 534. 1348. gbinv535.seq - Invertebrate sequence entries, part 535. 1349. gbinv536.seq - Invertebrate sequence entries, part 536. 1350. gbinv537.seq - Invertebrate sequence entries, part 537. 1351. gbinv538.seq - Invertebrate sequence entries, part 538. 1352. gbinv539.seq - Invertebrate sequence entries, part 539. 1353. gbinv54.seq - Invertebrate sequence entries, part 54. 1354. gbinv540.seq - Invertebrate sequence entries, part 540. 1355. gbinv541.seq - Invertebrate sequence entries, part 541. 1356. gbinv542.seq - Invertebrate sequence entries, part 542. 1357. gbinv543.seq - Invertebrate sequence entries, part 543. 1358. gbinv544.seq - Invertebrate sequence entries, part 544. 1359. gbinv545.seq - Invertebrate sequence entries, part 545. 1360. gbinv546.seq - Invertebrate sequence entries, part 546. 1361. gbinv547.seq - Invertebrate sequence entries, part 547. 1362. gbinv548.seq - Invertebrate sequence entries, part 548. 1363. gbinv549.seq - Invertebrate sequence entries, part 549. 1364. gbinv55.seq - Invertebrate sequence entries, part 55. 1365. gbinv550.seq - Invertebrate sequence entries, part 550. 1366. gbinv551.seq - Invertebrate sequence entries, part 551. 1367. gbinv552.seq - Invertebrate sequence entries, part 552. 1368. gbinv553.seq - Invertebrate sequence entries, part 553. 1369. gbinv554.seq - Invertebrate sequence entries, part 554. 1370. gbinv555.seq - Invertebrate sequence entries, part 555. 1371. gbinv556.seq - Invertebrate sequence entries, part 556. 1372. gbinv557.seq - Invertebrate sequence entries, part 557. 1373. gbinv558.seq - Invertebrate sequence entries, part 558. 1374. gbinv559.seq - Invertebrate sequence entries, part 559. 1375. gbinv56.seq - Invertebrate sequence entries, part 56. 1376. gbinv560.seq - Invertebrate sequence entries, part 560. 1377. gbinv561.seq - Invertebrate sequence entries, part 561. 1378. gbinv562.seq - Invertebrate sequence entries, part 562. 1379. gbinv563.seq - Invertebrate sequence entries, part 563. 1380. gbinv564.seq - Invertebrate sequence entries, part 564. 1381. gbinv565.seq - Invertebrate sequence entries, part 565. 1382. gbinv566.seq - Invertebrate sequence entries, part 566. 1383. gbinv567.seq - Invertebrate sequence entries, part 567. 1384. gbinv568.seq - Invertebrate sequence entries, part 568. 1385. gbinv569.seq - Invertebrate sequence entries, part 569. 1386. gbinv57.seq - Invertebrate sequence entries, part 57. 1387. gbinv570.seq - Invertebrate sequence entries, part 570. 1388. gbinv571.seq - Invertebrate sequence entries, part 571. 1389. gbinv572.seq - Invertebrate sequence entries, part 572. 1390. gbinv573.seq - Invertebrate sequence entries, part 573. 1391. gbinv574.seq - Invertebrate sequence entries, part 574. 1392. gbinv575.seq - Invertebrate sequence entries, part 575. 1393. gbinv576.seq - Invertebrate sequence entries, part 576. 1394. gbinv577.seq - Invertebrate sequence entries, part 577. 1395. gbinv578.seq - Invertebrate sequence entries, part 578. 1396. gbinv579.seq - Invertebrate sequence entries, part 579. 1397. gbinv58.seq - Invertebrate sequence entries, part 58. 1398. gbinv580.seq - Invertebrate sequence entries, part 580. 1399. gbinv581.seq - Invertebrate sequence entries, part 581. 1400. gbinv582.seq - Invertebrate sequence entries, part 582. 1401. gbinv583.seq - Invertebrate sequence entries, part 583. 1402. gbinv584.seq - Invertebrate sequence entries, part 584. 1403. gbinv585.seq - Invertebrate sequence entries, part 585. 1404. gbinv586.seq - Invertebrate sequence entries, part 586. 1405. gbinv587.seq - Invertebrate sequence entries, part 587. 1406. gbinv588.seq - Invertebrate sequence entries, part 588. 1407. gbinv589.seq - Invertebrate sequence entries, part 589. 1408. gbinv59.seq - Invertebrate sequence entries, part 59. 1409. gbinv590.seq - Invertebrate sequence entries, part 590. 1410. gbinv591.seq - Invertebrate sequence entries, part 591. 1411. gbinv592.seq - Invertebrate sequence entries, part 592. 1412. gbinv593.seq - Invertebrate sequence entries, part 593. 1413. gbinv594.seq - Invertebrate sequence entries, part 594. 1414. gbinv595.seq - Invertebrate sequence entries, part 595. 1415. gbinv596.seq - Invertebrate sequence entries, part 596. 1416. gbinv597.seq - Invertebrate sequence entries, part 597. 1417. gbinv598.seq - Invertebrate sequence entries, part 598. 1418. gbinv599.seq - Invertebrate sequence entries, part 599. 1419. gbinv6.seq - Invertebrate sequence entries, part 6. 1420. gbinv60.seq - Invertebrate sequence entries, part 60. 1421. gbinv600.seq - Invertebrate sequence entries, part 600. 1422. gbinv601.seq - Invertebrate sequence entries, part 601. 1423. gbinv602.seq - Invertebrate sequence entries, part 602. 1424. gbinv603.seq - Invertebrate sequence entries, part 603. 1425. gbinv604.seq - Invertebrate sequence entries, part 604. 1426. gbinv605.seq - Invertebrate sequence entries, part 605. 1427. gbinv606.seq - Invertebrate sequence entries, part 606. 1428. gbinv607.seq - Invertebrate sequence entries, part 607. 1429. gbinv608.seq - Invertebrate sequence entries, part 608. 1430. gbinv609.seq - Invertebrate sequence entries, part 609. 1431. gbinv61.seq - Invertebrate sequence entries, part 61. 1432. gbinv610.seq - Invertebrate sequence entries, part 610. 1433. gbinv611.seq - Invertebrate sequence entries, part 611. 1434. gbinv612.seq - Invertebrate sequence entries, part 612. 1435. gbinv613.seq - Invertebrate sequence entries, part 613. 1436. gbinv614.seq - Invertebrate sequence entries, part 614. 1437. gbinv615.seq - Invertebrate sequence entries, part 615. 1438. gbinv616.seq - Invertebrate sequence entries, part 616. 1439. gbinv617.seq - Invertebrate sequence entries, part 617. 1440. gbinv618.seq - Invertebrate sequence entries, part 618. 1441. gbinv619.seq - Invertebrate sequence entries, part 619. 1442. gbinv62.seq - Invertebrate sequence entries, part 62. 1443. gbinv620.seq - Invertebrate sequence entries, part 620. 1444. gbinv621.seq - Invertebrate sequence entries, part 621. 1445. gbinv622.seq - Invertebrate sequence entries, part 622. 1446. gbinv623.seq - Invertebrate sequence entries, part 623. 1447. gbinv624.seq - Invertebrate sequence entries, part 624. 1448. gbinv625.seq - Invertebrate sequence entries, part 625. 1449. gbinv626.seq - Invertebrate sequence entries, part 626. 1450. gbinv627.seq - Invertebrate sequence entries, part 627. 1451. gbinv628.seq - Invertebrate sequence entries, part 628. 1452. gbinv629.seq - Invertebrate sequence entries, part 629. 1453. gbinv63.seq - Invertebrate sequence entries, part 63. 1454. gbinv630.seq - Invertebrate sequence entries, part 630. 1455. gbinv631.seq - Invertebrate sequence entries, part 631. 1456. gbinv632.seq - Invertebrate sequence entries, part 632. 1457. gbinv633.seq - Invertebrate sequence entries, part 633. 1458. gbinv634.seq - Invertebrate sequence entries, part 634. 1459. gbinv635.seq - Invertebrate sequence entries, part 635. 1460. gbinv636.seq - Invertebrate sequence entries, part 636. 1461. gbinv637.seq - Invertebrate sequence entries, part 637. 1462. gbinv638.seq - Invertebrate sequence entries, part 638. 1463. gbinv639.seq - Invertebrate sequence entries, part 639. 1464. gbinv64.seq - Invertebrate sequence entries, part 64. 1465. gbinv640.seq - Invertebrate sequence entries, part 640. 1466. gbinv641.seq - Invertebrate sequence entries, part 641. 1467. gbinv642.seq - Invertebrate sequence entries, part 642. 1468. gbinv643.seq - Invertebrate sequence entries, part 643. 1469. gbinv644.seq - Invertebrate sequence entries, part 644. 1470. gbinv645.seq - Invertebrate sequence entries, part 645. 1471. gbinv646.seq - Invertebrate sequence entries, part 646. 1472. gbinv647.seq - Invertebrate sequence entries, part 647. 1473. gbinv648.seq - Invertebrate sequence entries, part 648. 1474. gbinv649.seq - Invertebrate sequence entries, part 649. 1475. gbinv65.seq - Invertebrate sequence entries, part 65. 1476. gbinv650.seq - Invertebrate sequence entries, part 650. 1477. gbinv651.seq - Invertebrate sequence entries, part 651. 1478. gbinv652.seq - Invertebrate sequence entries, part 652. 1479. gbinv653.seq - Invertebrate sequence entries, part 653. 1480. gbinv654.seq - Invertebrate sequence entries, part 654. 1481. gbinv655.seq - Invertebrate sequence entries, part 655. 1482. gbinv656.seq - Invertebrate sequence entries, part 656. 1483. gbinv657.seq - Invertebrate sequence entries, part 657. 1484. gbinv658.seq - Invertebrate sequence entries, part 658. 1485. gbinv659.seq - Invertebrate sequence entries, part 659. 1486. gbinv66.seq - Invertebrate sequence entries, part 66. 1487. gbinv660.seq - Invertebrate sequence entries, part 660. 1488. gbinv661.seq - Invertebrate sequence entries, part 661. 1489. gbinv662.seq - Invertebrate sequence entries, part 662. 1490. gbinv663.seq - Invertebrate sequence entries, part 663. 1491. gbinv664.seq - Invertebrate sequence entries, part 664. 1492. gbinv665.seq - Invertebrate sequence entries, part 665. 1493. gbinv666.seq - Invertebrate sequence entries, part 666. 1494. gbinv667.seq - Invertebrate sequence entries, part 667. 1495. gbinv668.seq - Invertebrate sequence entries, part 668. 1496. gbinv669.seq - Invertebrate sequence entries, part 669. 1497. gbinv67.seq - Invertebrate sequence entries, part 67. 1498. gbinv670.seq - Invertebrate sequence entries, part 670. 1499. gbinv671.seq - Invertebrate sequence entries, part 671. 1500. gbinv672.seq - Invertebrate sequence entries, part 672. 1501. gbinv673.seq - Invertebrate sequence entries, part 673. 1502. gbinv674.seq - Invertebrate sequence entries, part 674. 1503. gbinv675.seq - Invertebrate sequence entries, part 675. 1504. gbinv676.seq - Invertebrate sequence entries, part 676. 1505. gbinv677.seq - Invertebrate sequence entries, part 677. 1506. gbinv678.seq - Invertebrate sequence entries, part 678. 1507. gbinv679.seq - Invertebrate sequence entries, part 679. 1508. gbinv68.seq - Invertebrate sequence entries, part 68. 1509. gbinv680.seq - Invertebrate sequence entries, part 680. 1510. gbinv681.seq - Invertebrate sequence entries, part 681. 1511. gbinv682.seq - Invertebrate sequence entries, part 682. 1512. gbinv683.seq - Invertebrate sequence entries, part 683. 1513. gbinv684.seq - Invertebrate sequence entries, part 684. 1514. gbinv685.seq - Invertebrate sequence entries, part 685. 1515. gbinv686.seq - Invertebrate sequence entries, part 686. 1516. gbinv687.seq - Invertebrate sequence entries, part 687. 1517. gbinv688.seq - Invertebrate sequence entries, part 688. 1518. gbinv689.seq - Invertebrate sequence entries, part 689. 1519. gbinv69.seq - Invertebrate sequence entries, part 69. 1520. gbinv690.seq - Invertebrate sequence entries, part 690. 1521. gbinv691.seq - Invertebrate sequence entries, part 691. 1522. gbinv692.seq - Invertebrate sequence entries, part 692. 1523. gbinv693.seq - Invertebrate sequence entries, part 693. 1524. gbinv694.seq - Invertebrate sequence entries, part 694. 1525. gbinv695.seq - Invertebrate sequence entries, part 695. 1526. gbinv696.seq - Invertebrate sequence entries, part 696. 1527. gbinv697.seq - Invertebrate sequence entries, part 697. 1528. gbinv698.seq - Invertebrate sequence entries, part 698. 1529. gbinv699.seq - Invertebrate sequence entries, part 699. 1530. gbinv7.seq - Invertebrate sequence entries, part 7. 1531. gbinv70.seq - Invertebrate sequence entries, part 70. 1532. gbinv700.seq - Invertebrate sequence entries, part 700. 1533. gbinv701.seq - Invertebrate sequence entries, part 701. 1534. gbinv702.seq - Invertebrate sequence entries, part 702. 1535. gbinv703.seq - Invertebrate sequence entries, part 703. 1536. gbinv704.seq - Invertebrate sequence entries, part 704. 1537. gbinv705.seq - Invertebrate sequence entries, part 705. 1538. gbinv706.seq - Invertebrate sequence entries, part 706. 1539. gbinv707.seq - Invertebrate sequence entries, part 707. 1540. gbinv708.seq - Invertebrate sequence entries, part 708. 1541. gbinv709.seq - Invertebrate sequence entries, part 709. 1542. gbinv71.seq - Invertebrate sequence entries, part 71. 1543. gbinv710.seq - Invertebrate sequence entries, part 710. 1544. gbinv711.seq - Invertebrate sequence entries, part 711. 1545. gbinv712.seq - Invertebrate sequence entries, part 712. 1546. gbinv713.seq - Invertebrate sequence entries, part 713. 1547. gbinv714.seq - Invertebrate sequence entries, part 714. 1548. gbinv715.seq - Invertebrate sequence entries, part 715. 1549. gbinv716.seq - Invertebrate sequence entries, part 716. 1550. gbinv717.seq - Invertebrate sequence entries, part 717. 1551. gbinv718.seq - Invertebrate sequence entries, part 718. 1552. gbinv719.seq - Invertebrate sequence entries, part 719. 1553. gbinv72.seq - Invertebrate sequence entries, part 72. 1554. gbinv720.seq - Invertebrate sequence entries, part 720. 1555. gbinv721.seq - Invertebrate sequence entries, part 721. 1556. gbinv722.seq - Invertebrate sequence entries, part 722. 1557. gbinv723.seq - Invertebrate sequence entries, part 723. 1558. gbinv724.seq - Invertebrate sequence entries, part 724. 1559. gbinv725.seq - Invertebrate sequence entries, part 725. 1560. gbinv726.seq - Invertebrate sequence entries, part 726. 1561. gbinv727.seq - Invertebrate sequence entries, part 727. 1562. gbinv728.seq - Invertebrate sequence entries, part 728. 1563. gbinv729.seq - Invertebrate sequence entries, part 729. 1564. gbinv73.seq - Invertebrate sequence entries, part 73. 1565. gbinv730.seq - Invertebrate sequence entries, part 730. 1566. gbinv731.seq - Invertebrate sequence entries, part 731. 1567. gbinv732.seq - Invertebrate sequence entries, part 732. 1568. gbinv733.seq - Invertebrate sequence entries, part 733. 1569. gbinv734.seq - Invertebrate sequence entries, part 734. 1570. gbinv735.seq - Invertebrate sequence entries, part 735. 1571. gbinv736.seq - Invertebrate sequence entries, part 736. 1572. gbinv737.seq - Invertebrate sequence entries, part 737. 1573. gbinv738.seq - Invertebrate sequence entries, part 738. 1574. gbinv739.seq - Invertebrate sequence entries, part 739. 1575. gbinv74.seq - Invertebrate sequence entries, part 74. 1576. gbinv740.seq - Invertebrate sequence entries, part 740. 1577. gbinv741.seq - Invertebrate sequence entries, part 741. 1578. gbinv742.seq - Invertebrate sequence entries, part 742. 1579. gbinv743.seq - Invertebrate sequence entries, part 743. 1580. gbinv744.seq - Invertebrate sequence entries, part 744. 1581. gbinv745.seq - Invertebrate sequence entries, part 745. 1582. gbinv746.seq - Invertebrate sequence entries, part 746. 1583. gbinv747.seq - Invertebrate sequence entries, part 747. 1584. gbinv748.seq - Invertebrate sequence entries, part 748. 1585. gbinv749.seq - Invertebrate sequence entries, part 749. 1586. gbinv75.seq - Invertebrate sequence entries, part 75. 1587. gbinv750.seq - Invertebrate sequence entries, part 750. 1588. gbinv751.seq - Invertebrate sequence entries, part 751. 1589. gbinv752.seq - Invertebrate sequence entries, part 752. 1590. gbinv753.seq - Invertebrate sequence entries, part 753. 1591. gbinv754.seq - Invertebrate sequence entries, part 754. 1592. gbinv755.seq - Invertebrate sequence entries, part 755. 1593. gbinv756.seq - Invertebrate sequence entries, part 756. 1594. gbinv757.seq - Invertebrate sequence entries, part 757. 1595. gbinv758.seq - Invertebrate sequence entries, part 758. 1596. gbinv759.seq - Invertebrate sequence entries, part 759. 1597. gbinv76.seq - Invertebrate sequence entries, part 76. 1598. gbinv760.seq - Invertebrate sequence entries, part 760. 1599. gbinv761.seq - Invertebrate sequence entries, part 761. 1600. gbinv762.seq - Invertebrate sequence entries, part 762. 1601. gbinv763.seq - Invertebrate sequence entries, part 763. 1602. gbinv764.seq - Invertebrate sequence entries, part 764. 1603. gbinv765.seq - Invertebrate sequence entries, part 765. 1604. gbinv766.seq - Invertebrate sequence entries, part 766. 1605. gbinv767.seq - Invertebrate sequence entries, part 767. 1606. gbinv768.seq - Invertebrate sequence entries, part 768. 1607. gbinv769.seq - Invertebrate sequence entries, part 769. 1608. gbinv77.seq - Invertebrate sequence entries, part 77. 1609. gbinv770.seq - Invertebrate sequence entries, part 770. 1610. gbinv771.seq - Invertebrate sequence entries, part 771. 1611. gbinv772.seq - Invertebrate sequence entries, part 772. 1612. gbinv773.seq - Invertebrate sequence entries, part 773. 1613. gbinv774.seq - Invertebrate sequence entries, part 774. 1614. gbinv775.seq - Invertebrate sequence entries, part 775. 1615. gbinv776.seq - Invertebrate sequence entries, part 776. 1616. gbinv777.seq - Invertebrate sequence entries, part 777. 1617. gbinv778.seq - Invertebrate sequence entries, part 778. 1618. gbinv779.seq - Invertebrate sequence entries, part 779. 1619. gbinv78.seq - Invertebrate sequence entries, part 78. 1620. gbinv780.seq - Invertebrate sequence entries, part 780. 1621. gbinv781.seq - Invertebrate sequence entries, part 781. 1622. gbinv782.seq - Invertebrate sequence entries, part 782. 1623. gbinv783.seq - Invertebrate sequence entries, part 783. 1624. gbinv784.seq - Invertebrate sequence entries, part 784. 1625. gbinv785.seq - Invertebrate sequence entries, part 785. 1626. gbinv786.seq - Invertebrate sequence entries, part 786. 1627. gbinv787.seq - Invertebrate sequence entries, part 787. 1628. gbinv788.seq - Invertebrate sequence entries, part 788. 1629. gbinv789.seq - Invertebrate sequence entries, part 789. 1630. gbinv79.seq - Invertebrate sequence entries, part 79. 1631. gbinv790.seq - Invertebrate sequence entries, part 790. 1632. gbinv791.seq - Invertebrate sequence entries, part 791. 1633. gbinv792.seq - Invertebrate sequence entries, part 792. 1634. gbinv793.seq - Invertebrate sequence entries, part 793. 1635. gbinv794.seq - Invertebrate sequence entries, part 794. 1636. gbinv795.seq - Invertebrate sequence entries, part 795. 1637. gbinv796.seq - Invertebrate sequence entries, part 796. 1638. gbinv797.seq - Invertebrate sequence entries, part 797. 1639. gbinv798.seq - Invertebrate sequence entries, part 798. 1640. gbinv799.seq - Invertebrate sequence entries, part 799. 1641. gbinv8.seq - Invertebrate sequence entries, part 8. 1642. gbinv80.seq - Invertebrate sequence entries, part 80. 1643. gbinv800.seq - Invertebrate sequence entries, part 800. 1644. gbinv801.seq - Invertebrate sequence entries, part 801. 1645. gbinv802.seq - Invertebrate sequence entries, part 802. 1646. gbinv803.seq - Invertebrate sequence entries, part 803. 1647. gbinv804.seq - Invertebrate sequence entries, part 804. 1648. gbinv805.seq - Invertebrate sequence entries, part 805. 1649. gbinv806.seq - Invertebrate sequence entries, part 806. 1650. gbinv807.seq - Invertebrate sequence entries, part 807. 1651. gbinv808.seq - Invertebrate sequence entries, part 808. 1652. gbinv809.seq - Invertebrate sequence entries, part 809. 1653. gbinv81.seq - Invertebrate sequence entries, part 81. 1654. gbinv810.seq - Invertebrate sequence entries, part 810. 1655. gbinv811.seq - Invertebrate sequence entries, part 811. 1656. gbinv812.seq - Invertebrate sequence entries, part 812. 1657. gbinv813.seq - Invertebrate sequence entries, part 813. 1658. gbinv814.seq - Invertebrate sequence entries, part 814. 1659. gbinv815.seq - Invertebrate sequence entries, part 815. 1660. gbinv816.seq - Invertebrate sequence entries, part 816. 1661. gbinv817.seq - Invertebrate sequence entries, part 817. 1662. gbinv818.seq - Invertebrate sequence entries, part 818. 1663. gbinv819.seq - Invertebrate sequence entries, part 819. 1664. gbinv82.seq - Invertebrate sequence entries, part 82. 1665. gbinv820.seq - Invertebrate sequence entries, part 820. 1666. gbinv821.seq - Invertebrate sequence entries, part 821. 1667. gbinv822.seq - Invertebrate sequence entries, part 822. 1668. gbinv823.seq - Invertebrate sequence entries, part 823. 1669. gbinv824.seq - Invertebrate sequence entries, part 824. 1670. gbinv825.seq - Invertebrate sequence entries, part 825. 1671. gbinv826.seq - Invertebrate sequence entries, part 826. 1672. gbinv827.seq - Invertebrate sequence entries, part 827. 1673. gbinv828.seq - Invertebrate sequence entries, part 828. 1674. gbinv829.seq - Invertebrate sequence entries, part 829. 1675. gbinv83.seq - Invertebrate sequence entries, part 83. 1676. gbinv830.seq - Invertebrate sequence entries, part 830. 1677. gbinv831.seq - Invertebrate sequence entries, part 831. 1678. gbinv832.seq - Invertebrate sequence entries, part 832. 1679. gbinv833.seq - Invertebrate sequence entries, part 833. 1680. gbinv834.seq - Invertebrate sequence entries, part 834. 1681. gbinv835.seq - Invertebrate sequence entries, part 835. 1682. gbinv836.seq - Invertebrate sequence entries, part 836. 1683. gbinv837.seq - Invertebrate sequence entries, part 837. 1684. gbinv838.seq - Invertebrate sequence entries, part 838. 1685. gbinv839.seq - Invertebrate sequence entries, part 839. 1686. gbinv84.seq - Invertebrate sequence entries, part 84. 1687. gbinv840.seq - Invertebrate sequence entries, part 840. 1688. gbinv841.seq - Invertebrate sequence entries, part 841. 1689. gbinv842.seq - Invertebrate sequence entries, part 842. 1690. gbinv843.seq - Invertebrate sequence entries, part 843. 1691. gbinv844.seq - Invertebrate sequence entries, part 844. 1692. gbinv845.seq - Invertebrate sequence entries, part 845. 1693. gbinv846.seq - Invertebrate sequence entries, part 846. 1694. gbinv847.seq - Invertebrate sequence entries, part 847. 1695. gbinv848.seq - Invertebrate sequence entries, part 848. 1696. gbinv849.seq - Invertebrate sequence entries, part 849. 1697. gbinv85.seq - Invertebrate sequence entries, part 85. 1698. gbinv850.seq - Invertebrate sequence entries, part 850. 1699. gbinv851.seq - Invertebrate sequence entries, part 851. 1700. gbinv852.seq - Invertebrate sequence entries, part 852. 1701. gbinv853.seq - Invertebrate sequence entries, part 853. 1702. gbinv854.seq - Invertebrate sequence entries, part 854. 1703. gbinv855.seq - Invertebrate sequence entries, part 855. 1704. gbinv856.seq - Invertebrate sequence entries, part 856. 1705. gbinv857.seq - Invertebrate sequence entries, part 857. 1706. gbinv858.seq - Invertebrate sequence entries, part 858. 1707. gbinv859.seq - Invertebrate sequence entries, part 859. 1708. gbinv86.seq - Invertebrate sequence entries, part 86. 1709. gbinv860.seq - Invertebrate sequence entries, part 860. 1710. gbinv861.seq - Invertebrate sequence entries, part 861. 1711. gbinv862.seq - Invertebrate sequence entries, part 862. 1712. gbinv863.seq - Invertebrate sequence entries, part 863. 1713. gbinv864.seq - Invertebrate sequence entries, part 864. 1714. gbinv865.seq - Invertebrate sequence entries, part 865. 1715. gbinv866.seq - Invertebrate sequence entries, part 866. 1716. gbinv867.seq - Invertebrate sequence entries, part 867. 1717. gbinv868.seq - Invertebrate sequence entries, part 868. 1718. gbinv869.seq - Invertebrate sequence entries, part 869. 1719. gbinv87.seq - Invertebrate sequence entries, part 87. 1720. gbinv870.seq - Invertebrate sequence entries, part 870. 1721. gbinv871.seq - Invertebrate sequence entries, part 871. 1722. gbinv872.seq - Invertebrate sequence entries, part 872. 1723. gbinv873.seq - Invertebrate sequence entries, part 873. 1724. gbinv874.seq - Invertebrate sequence entries, part 874. 1725. gbinv875.seq - Invertebrate sequence entries, part 875. 1726. gbinv876.seq - Invertebrate sequence entries, part 876. 1727. gbinv877.seq - Invertebrate sequence entries, part 877. 1728. gbinv878.seq - Invertebrate sequence entries, part 878. 1729. gbinv879.seq - Invertebrate sequence entries, part 879. 1730. gbinv88.seq - Invertebrate sequence entries, part 88. 1731. gbinv880.seq - Invertebrate sequence entries, part 880. 1732. gbinv881.seq - Invertebrate sequence entries, part 881. 1733. gbinv882.seq - Invertebrate sequence entries, part 882. 1734. gbinv883.seq - Invertebrate sequence entries, part 883. 1735. gbinv884.seq - Invertebrate sequence entries, part 884. 1736. gbinv885.seq - Invertebrate sequence entries, part 885. 1737. gbinv886.seq - Invertebrate sequence entries, part 886. 1738. gbinv887.seq - Invertebrate sequence entries, part 887. 1739. gbinv888.seq - Invertebrate sequence entries, part 888. 1740. gbinv889.seq - Invertebrate sequence entries, part 889. 1741. gbinv89.seq - Invertebrate sequence entries, part 89. 1742. gbinv890.seq - Invertebrate sequence entries, part 890. 1743. gbinv891.seq - Invertebrate sequence entries, part 891. 1744. gbinv892.seq - Invertebrate sequence entries, part 892. 1745. gbinv893.seq - Invertebrate sequence entries, part 893. 1746. gbinv894.seq - Invertebrate sequence entries, part 894. 1747. gbinv895.seq - Invertebrate sequence entries, part 895. 1748. gbinv896.seq - Invertebrate sequence entries, part 896. 1749. gbinv897.seq - Invertebrate sequence entries, part 897. 1750. gbinv898.seq - Invertebrate sequence entries, part 898. 1751. gbinv899.seq - Invertebrate sequence entries, part 899. 1752. gbinv9.seq - Invertebrate sequence entries, part 9. 1753. gbinv90.seq - Invertebrate sequence entries, part 90. 1754. gbinv900.seq - Invertebrate sequence entries, part 900. 1755. gbinv901.seq - Invertebrate sequence entries, part 901. 1756. gbinv902.seq - Invertebrate sequence entries, part 902. 1757. gbinv903.seq - Invertebrate sequence entries, part 903. 1758. gbinv904.seq - Invertebrate sequence entries, part 904. 1759. gbinv905.seq - Invertebrate sequence entries, part 905. 1760. gbinv906.seq - Invertebrate sequence entries, part 906. 1761. gbinv907.seq - Invertebrate sequence entries, part 907. 1762. gbinv908.seq - Invertebrate sequence entries, part 908. 1763. gbinv909.seq - Invertebrate sequence entries, part 909. 1764. gbinv91.seq - Invertebrate sequence entries, part 91. 1765. gbinv910.seq - Invertebrate sequence entries, part 910. 1766. gbinv911.seq - Invertebrate sequence entries, part 911. 1767. gbinv912.seq - Invertebrate sequence entries, part 912. 1768. gbinv913.seq - Invertebrate sequence entries, part 913. 1769. gbinv914.seq - Invertebrate sequence entries, part 914. 1770. gbinv915.seq - Invertebrate sequence entries, part 915. 1771. gbinv916.seq - Invertebrate sequence entries, part 916. 1772. gbinv917.seq - Invertebrate sequence entries, part 917. 1773. gbinv918.seq - Invertebrate sequence entries, part 918. 1774. gbinv919.seq - Invertebrate sequence entries, part 919. 1775. gbinv92.seq - Invertebrate sequence entries, part 92. 1776. gbinv920.seq - Invertebrate sequence entries, part 920. 1777. gbinv921.seq - Invertebrate sequence entries, part 921. 1778. gbinv922.seq - Invertebrate sequence entries, part 922. 1779. gbinv923.seq - Invertebrate sequence entries, part 923. 1780. gbinv924.seq - Invertebrate sequence entries, part 924. 1781. gbinv925.seq - Invertebrate sequence entries, part 925. 1782. gbinv926.seq - Invertebrate sequence entries, part 926. 1783. gbinv927.seq - Invertebrate sequence entries, part 927. 1784. gbinv928.seq - Invertebrate sequence entries, part 928. 1785. gbinv929.seq - Invertebrate sequence entries, part 929. 1786. gbinv93.seq - Invertebrate sequence entries, part 93. 1787. gbinv930.seq - Invertebrate sequence entries, part 930. 1788. gbinv931.seq - Invertebrate sequence entries, part 931. 1789. gbinv932.seq - Invertebrate sequence entries, part 932. 1790. gbinv933.seq - Invertebrate sequence entries, part 933. 1791. gbinv934.seq - Invertebrate sequence entries, part 934. 1792. gbinv935.seq - Invertebrate sequence entries, part 935. 1793. gbinv936.seq - Invertebrate sequence entries, part 936. 1794. gbinv937.seq - Invertebrate sequence entries, part 937. 1795. gbinv938.seq - Invertebrate sequence entries, part 938. 1796. gbinv939.seq - Invertebrate sequence entries, part 939. 1797. gbinv94.seq - Invertebrate sequence entries, part 94. 1798. gbinv940.seq - Invertebrate sequence entries, part 940. 1799. gbinv941.seq - Invertebrate sequence entries, part 941. 1800. gbinv942.seq - Invertebrate sequence entries, part 942. 1801. gbinv943.seq - Invertebrate sequence entries, part 943. 1802. gbinv944.seq - Invertebrate sequence entries, part 944. 1803. gbinv945.seq - Invertebrate sequence entries, part 945. 1804. gbinv946.seq - Invertebrate sequence entries, part 946. 1805. gbinv947.seq - Invertebrate sequence entries, part 947. 1806. gbinv948.seq - Invertebrate sequence entries, part 948. 1807. gbinv949.seq - Invertebrate sequence entries, part 949. 1808. gbinv95.seq - Invertebrate sequence entries, part 95. 1809. gbinv950.seq - Invertebrate sequence entries, part 950. 1810. gbinv951.seq - Invertebrate sequence entries, part 951. 1811. gbinv952.seq - Invertebrate sequence entries, part 952. 1812. gbinv953.seq - Invertebrate sequence entries, part 953. 1813. gbinv954.seq - Invertebrate sequence entries, part 954. 1814. gbinv955.seq - Invertebrate sequence entries, part 955. 1815. gbinv956.seq - Invertebrate sequence entries, part 956. 1816. gbinv957.seq - Invertebrate sequence entries, part 957. 1817. gbinv958.seq - Invertebrate sequence entries, part 958. 1818. gbinv959.seq - Invertebrate sequence entries, part 959. 1819. gbinv96.seq - Invertebrate sequence entries, part 96. 1820. gbinv960.seq - Invertebrate sequence entries, part 960. 1821. gbinv961.seq - Invertebrate sequence entries, part 961. 1822. gbinv962.seq - Invertebrate sequence entries, part 962. 1823. gbinv963.seq - Invertebrate sequence entries, part 963. 1824. gbinv964.seq - Invertebrate sequence entries, part 964. 1825. gbinv965.seq - Invertebrate sequence entries, part 965. 1826. gbinv966.seq - Invertebrate sequence entries, part 966. 1827. gbinv967.seq - Invertebrate sequence entries, part 967. 1828. gbinv968.seq - Invertebrate sequence entries, part 968. 1829. gbinv969.seq - Invertebrate sequence entries, part 969. 1830. gbinv97.seq - Invertebrate sequence entries, part 97. 1831. gbinv970.seq - Invertebrate sequence entries, part 970. 1832. gbinv971.seq - Invertebrate sequence entries, part 971. 1833. gbinv972.seq - Invertebrate sequence entries, part 972. 1834. gbinv973.seq - Invertebrate sequence entries, part 973. 1835. gbinv974.seq - Invertebrate sequence entries, part 974. 1836. gbinv975.seq - Invertebrate sequence entries, part 975. 1837. gbinv976.seq - Invertebrate sequence entries, part 976. 1838. gbinv977.seq - Invertebrate sequence entries, part 977. 1839. gbinv978.seq - Invertebrate sequence entries, part 978. 1840. gbinv979.seq - Invertebrate sequence entries, part 979. 1841. gbinv98.seq - Invertebrate sequence entries, part 98. 1842. gbinv980.seq - Invertebrate sequence entries, part 980. 1843. gbinv981.seq - Invertebrate sequence entries, part 981. 1844. gbinv982.seq - Invertebrate sequence entries, part 982. 1845. gbinv983.seq - Invertebrate sequence entries, part 983. 1846. gbinv984.seq - Invertebrate sequence entries, part 984. 1847. gbinv985.seq - Invertebrate sequence entries, part 985. 1848. gbinv986.seq - Invertebrate sequence entries, part 986. 1849. gbinv987.seq - Invertebrate sequence entries, part 987. 1850. gbinv988.seq - Invertebrate sequence entries, part 988. 1851. gbinv989.seq - Invertebrate sequence entries, part 989. 1852. gbinv99.seq - Invertebrate sequence entries, part 99. 1853. gbinv990.seq - Invertebrate sequence entries, part 990. 1854. gbinv991.seq - Invertebrate sequence entries, part 991. 1855. gbinv992.seq - Invertebrate sequence entries, part 992. 1856. gbinv993.seq - Invertebrate sequence entries, part 993. 1857. gbinv994.seq - Invertebrate sequence entries, part 994. 1858. gbinv995.seq - Invertebrate sequence entries, part 995. 1859. gbinv996.seq - Invertebrate sequence entries, part 996. 1860. gbinv997.seq - Invertebrate sequence entries, part 997. 1861. gbinv998.seq - Invertebrate sequence entries, part 998. 1862. gbinv999.seq - Invertebrate sequence entries, part 999. 1863. gbmam1.seq - Other mammalian sequence entries, part 1. 1864. gbmam10.seq - Other mammalian sequence entries, part 10. 1865. gbmam100.seq - Other mammalian sequence entries, part 100. 1866. gbmam101.seq - Other mammalian sequence entries, part 101. 1867. gbmam102.seq - Other mammalian sequence entries, part 102. 1868. gbmam103.seq - Other mammalian sequence entries, part 103. 1869. gbmam104.seq - Other mammalian sequence entries, part 104. 1870. gbmam105.seq - Other mammalian sequence entries, part 105. 1871. gbmam106.seq - Other mammalian sequence entries, part 106. 1872. gbmam107.seq - Other mammalian sequence entries, part 107. 1873. gbmam108.seq - Other mammalian sequence entries, part 108. 1874. gbmam109.seq - Other mammalian sequence entries, part 109. 1875. gbmam11.seq - Other mammalian sequence entries, part 11. 1876. gbmam110.seq - Other mammalian sequence entries, part 110. 1877. gbmam111.seq - Other mammalian sequence entries, part 111. 1878. gbmam112.seq - Other mammalian sequence entries, part 112. 1879. gbmam113.seq - Other mammalian sequence entries, part 113. 1880. gbmam114.seq - Other mammalian sequence entries, part 114. 1881. gbmam115.seq - Other mammalian sequence entries, part 115. 1882. gbmam116.seq - Other mammalian sequence entries, part 116. 1883. gbmam117.seq - Other mammalian sequence entries, part 117. 1884. gbmam118.seq - Other mammalian sequence entries, part 118. 1885. gbmam119.seq - Other mammalian sequence entries, part 119. 1886. gbmam12.seq - Other mammalian sequence entries, part 12. 1887. gbmam120.seq - Other mammalian sequence entries, part 120. 1888. gbmam121.seq - Other mammalian sequence entries, part 121. 1889. gbmam122.seq - Other mammalian sequence entries, part 122. 1890. gbmam123.seq - Other mammalian sequence entries, part 123. 1891. gbmam124.seq - Other mammalian sequence entries, part 124. 1892. gbmam125.seq - Other mammalian sequence entries, part 125. 1893. gbmam126.seq - Other mammalian sequence entries, part 126. 1894. gbmam127.seq - Other mammalian sequence entries, part 127. 1895. gbmam128.seq - Other mammalian sequence entries, part 128. 1896. gbmam129.seq - Other mammalian sequence entries, part 129. 1897. gbmam13.seq - Other mammalian sequence entries, part 13. 1898. gbmam130.seq - Other mammalian sequence entries, part 130. 1899. gbmam131.seq - Other mammalian sequence entries, part 131. 1900. gbmam132.seq - Other mammalian sequence entries, part 132. 1901. gbmam133.seq - Other mammalian sequence entries, part 133. 1902. gbmam134.seq - Other mammalian sequence entries, part 134. 1903. gbmam135.seq - Other mammalian sequence entries, part 135. 1904. gbmam136.seq - Other mammalian sequence entries, part 136. 1905. gbmam137.seq - Other mammalian sequence entries, part 137. 1906. gbmam138.seq - Other mammalian sequence entries, part 138. 1907. gbmam139.seq - Other mammalian sequence entries, part 139. 1908. gbmam14.seq - Other mammalian sequence entries, part 14. 1909. gbmam140.seq - Other mammalian sequence entries, part 140. 1910. gbmam141.seq - Other mammalian sequence entries, part 141. 1911. gbmam142.seq - Other mammalian sequence entries, part 142. 1912. gbmam143.seq - Other mammalian sequence entries, part 143. 1913. gbmam144.seq - Other mammalian sequence entries, part 144. 1914. gbmam145.seq - Other mammalian sequence entries, part 145. 1915. gbmam146.seq - Other mammalian sequence entries, part 146. 1916. gbmam147.seq - Other mammalian sequence entries, part 147. 1917. gbmam148.seq - Other mammalian sequence entries, part 148. 1918. gbmam149.seq - Other mammalian sequence entries, part 149. 1919. gbmam15.seq - Other mammalian sequence entries, part 15. 1920. gbmam150.seq - Other mammalian sequence entries, part 150. 1921. gbmam151.seq - Other mammalian sequence entries, part 151. 1922. gbmam152.seq - Other mammalian sequence entries, part 152. 1923. gbmam153.seq - Other mammalian sequence entries, part 153. 1924. gbmam154.seq - Other mammalian sequence entries, part 154. 1925. gbmam155.seq - Other mammalian sequence entries, part 155. 1926. gbmam156.seq - Other mammalian sequence entries, part 156. 1927. gbmam157.seq - Other mammalian sequence entries, part 157. 1928. gbmam158.seq - Other mammalian sequence entries, part 158. 1929. gbmam159.seq - Other mammalian sequence entries, part 159. 1930. gbmam16.seq - Other mammalian sequence entries, part 16. 1931. gbmam160.seq - Other mammalian sequence entries, part 160. 1932. gbmam161.seq - Other mammalian sequence entries, part 161. 1933. gbmam162.seq - Other mammalian sequence entries, part 162. 1934. gbmam163.seq - Other mammalian sequence entries, part 163. 1935. gbmam164.seq - Other mammalian sequence entries, part 164. 1936. gbmam165.seq - Other mammalian sequence entries, part 165. 1937. gbmam17.seq - Other mammalian sequence entries, part 17. 1938. gbmam18.seq - Other mammalian sequence entries, part 18. 1939. gbmam19.seq - Other mammalian sequence entries, part 19. 1940. gbmam2.seq - Other mammalian sequence entries, part 2. 1941. gbmam20.seq - Other mammalian sequence entries, part 20. 1942. gbmam21.seq - Other mammalian sequence entries, part 21. 1943. gbmam22.seq - Other mammalian sequence entries, part 22. 1944. gbmam23.seq - Other mammalian sequence entries, part 23. 1945. gbmam24.seq - Other mammalian sequence entries, part 24. 1946. gbmam25.seq - Other mammalian sequence entries, part 25. 1947. gbmam26.seq - Other mammalian sequence entries, part 26. 1948. gbmam27.seq - Other mammalian sequence entries, part 27. 1949. gbmam28.seq - Other mammalian sequence entries, part 28. 1950. gbmam29.seq - Other mammalian sequence entries, part 29. 1951. gbmam3.seq - Other mammalian sequence entries, part 3. 1952. gbmam30.seq - Other mammalian sequence entries, part 30. 1953. gbmam31.seq - Other mammalian sequence entries, part 31. 1954. gbmam32.seq - Other mammalian sequence entries, part 32. 1955. gbmam33.seq - Other mammalian sequence entries, part 33. 1956. gbmam34.seq - Other mammalian sequence entries, part 34. 1957. gbmam35.seq - Other mammalian sequence entries, part 35. 1958. gbmam36.seq - Other mammalian sequence entries, part 36. 1959. gbmam37.seq - Other mammalian sequence entries, part 37. 1960. gbmam38.seq - Other mammalian sequence entries, part 38. 1961. gbmam39.seq - Other mammalian sequence entries, part 39. 1962. gbmam4.seq - Other mammalian sequence entries, part 4. 1963. gbmam40.seq - Other mammalian sequence entries, part 40. 1964. gbmam41.seq - Other mammalian sequence entries, part 41. 1965. gbmam42.seq - Other mammalian sequence entries, part 42. 1966. gbmam43.seq - Other mammalian sequence entries, part 43. 1967. gbmam44.seq - Other mammalian sequence entries, part 44. 1968. gbmam45.seq - Other mammalian sequence entries, part 45. 1969. gbmam46.seq - Other mammalian sequence entries, part 46. 1970. gbmam47.seq - Other mammalian sequence entries, part 47. 1971. gbmam48.seq - Other mammalian sequence entries, part 48. 1972. gbmam49.seq - Other mammalian sequence entries, part 49. 1973. gbmam5.seq - Other mammalian sequence entries, part 5. 1974. gbmam50.seq - Other mammalian sequence entries, part 50. 1975. gbmam51.seq - Other mammalian sequence entries, part 51. 1976. gbmam52.seq - Other mammalian sequence entries, part 52. 1977. gbmam53.seq - Other mammalian sequence entries, part 53. 1978. gbmam54.seq - Other mammalian sequence entries, part 54. 1979. gbmam55.seq - Other mammalian sequence entries, part 55. 1980. gbmam56.seq - Other mammalian sequence entries, part 56. 1981. gbmam57.seq - Other mammalian sequence entries, part 57. 1982. gbmam58.seq - Other mammalian sequence entries, part 58. 1983. gbmam59.seq - Other mammalian sequence entries, part 59. 1984. gbmam6.seq - Other mammalian sequence entries, part 6. 1985. gbmam60.seq - Other mammalian sequence entries, part 60. 1986. gbmam61.seq - Other mammalian sequence entries, part 61. 1987. gbmam62.seq - Other mammalian sequence entries, part 62. 1988. gbmam63.seq - Other mammalian sequence entries, part 63. 1989. gbmam64.seq - Other mammalian sequence entries, part 64. 1990. gbmam65.seq - Other mammalian sequence entries, part 65. 1991. gbmam66.seq - Other mammalian sequence entries, part 66. 1992. gbmam67.seq - Other mammalian sequence entries, part 67. 1993. gbmam68.seq - Other mammalian sequence entries, part 68. 1994. gbmam69.seq - Other mammalian sequence entries, part 69. 1995. gbmam7.seq - Other mammalian sequence entries, part 7. 1996. gbmam70.seq - Other mammalian sequence entries, part 70. 1997. gbmam71.seq - Other mammalian sequence entries, part 71. 1998. gbmam72.seq - Other mammalian sequence entries, part 72. 1999. gbmam73.seq - Other mammalian sequence entries, part 73. 2000. gbmam74.seq - Other mammalian sequence entries, part 74. 2001. gbmam75.seq - Other mammalian sequence entries, part 75. 2002. gbmam76.seq - Other mammalian sequence entries, part 76. 2003. gbmam77.seq - Other mammalian sequence entries, part 77. 2004. gbmam78.seq - Other mammalian sequence entries, part 78. 2005. gbmam79.seq - Other mammalian sequence entries, part 79. 2006. gbmam8.seq - Other mammalian sequence entries, part 8. 2007. gbmam80.seq - Other mammalian sequence entries, part 80. 2008. gbmam81.seq - Other mammalian sequence entries, part 81. 2009. gbmam82.seq - Other mammalian sequence entries, part 82. 2010. gbmam83.seq - Other mammalian sequence entries, part 83. 2011. gbmam84.seq - Other mammalian sequence entries, part 84. 2012. gbmam85.seq - Other mammalian sequence entries, part 85. 2013. gbmam86.seq - Other mammalian sequence entries, part 86. 2014. gbmam87.seq - Other mammalian sequence entries, part 87. 2015. gbmam88.seq - Other mammalian sequence entries, part 88. 2016. gbmam89.seq - Other mammalian sequence entries, part 89. 2017. gbmam9.seq - Other mammalian sequence entries, part 9. 2018. gbmam90.seq - Other mammalian sequence entries, part 90. 2019. gbmam91.seq - Other mammalian sequence entries, part 91. 2020. gbmam92.seq - Other mammalian sequence entries, part 92. 2021. gbmam93.seq - Other mammalian sequence entries, part 93. 2022. gbmam94.seq - Other mammalian sequence entries, part 94. 2023. gbmam95.seq - Other mammalian sequence entries, part 95. 2024. gbmam96.seq - Other mammalian sequence entries, part 96. 2025. gbmam97.seq - Other mammalian sequence entries, part 97. 2026. gbmam98.seq - Other mammalian sequence entries, part 98. 2027. gbmam99.seq - Other mammalian sequence entries, part 99. 2028. gbnew.txt - Accession numbers of entries new since the previous release. 2029. gbpat1.seq - Patent sequence entries, part 1. 2030. gbpat10.seq - Patent sequence entries, part 10. 2031. gbpat11.seq - Patent sequence entries, part 11. 2032. gbpat12.seq - Patent sequence entries, part 12. 2033. gbpat13.seq - Patent sequence entries, part 13. 2034. gbpat14.seq - Patent sequence entries, part 14. 2035. gbpat15.seq - Patent sequence entries, part 15. 2036. gbpat16.seq - Patent sequence entries, part 16. 2037. gbpat17.seq - Patent sequence entries, part 17. 2038. gbpat18.seq - Patent sequence entries, part 18. 2039. gbpat19.seq - Patent sequence entries, part 19. 2040. gbpat2.seq - Patent sequence entries, part 2. 2041. gbpat20.seq - Patent sequence entries, part 20. 2042. gbpat21.seq - Patent sequence entries, part 21. 2043. gbpat22.seq - Patent sequence entries, part 22. 2044. gbpat23.seq - Patent sequence entries, part 23. 2045. gbpat24.seq - Patent sequence entries, part 24. 2046. gbpat25.seq - Patent sequence entries, part 25. 2047. gbpat26.seq - Patent sequence entries, part 26. 2048. gbpat27.seq - Patent sequence entries, part 27. 2049. gbpat28.seq - Patent sequence entries, part 28. 2050. gbpat29.seq - Patent sequence entries, part 29. 2051. gbpat3.seq - Patent sequence entries, part 3. 2052. gbpat30.seq - Patent sequence entries, part 30. 2053. gbpat31.seq - Patent sequence entries, part 31. 2054. gbpat32.seq - Patent sequence entries, part 32. 2055. gbpat33.seq - Patent sequence entries, part 33. 2056. gbpat34.seq - Patent sequence entries, part 34. 2057. gbpat35.seq - Patent sequence entries, part 35. 2058. gbpat36.seq - Patent sequence entries, part 36. 2059. gbpat37.seq - Patent sequence entries, part 37. 2060. gbpat38.seq - Patent sequence entries, part 38. 2061. gbpat39.seq - Patent sequence entries, part 39. 2062. gbpat4.seq - Patent sequence entries, part 4. 2063. gbpat40.seq - Patent sequence entries, part 40. 2064. gbpat41.seq - Patent sequence entries, part 41. 2065. gbpat42.seq - Patent sequence entries, part 42. 2066. gbpat43.seq - Patent sequence entries, part 43. 2067. gbpat44.seq - Patent sequence entries, part 44. 2068. gbpat45.seq - Patent sequence entries, part 45. 2069. gbpat46.seq - Patent sequence entries, part 46. 2070. gbpat47.seq - Patent sequence entries, part 47. 2071. gbpat48.seq - Patent sequence entries, part 48. 2072. gbpat49.seq - Patent sequence entries, part 49. 2073. gbpat5.seq - Patent sequence entries, part 5. 2074. gbpat50.seq - Patent sequence entries, part 50. 2075. gbpat51.seq - Patent sequence entries, part 51. 2076. gbpat52.seq - Patent sequence entries, part 52. 2077. gbpat53.seq - Patent sequence entries, part 53. 2078. gbpat54.seq - Patent sequence entries, part 54. 2079. gbpat55.seq - Patent sequence entries, part 55. 2080. gbpat56.seq - Patent sequence entries, part 56. 2081. gbpat57.seq - Patent sequence entries, part 57. 2082. gbpat58.seq - Patent sequence entries, part 58. 2083. gbpat59.seq - Patent sequence entries, part 59. 2084. gbpat6.seq - Patent sequence entries, part 6. 2085. gbpat60.seq - Patent sequence entries, part 60. 2086. gbpat61.seq - Patent sequence entries, part 61. 2087. gbpat62.seq - Patent sequence entries, part 62. 2088. gbpat63.seq - Patent sequence entries, part 63. 2089. gbpat64.seq - Patent sequence entries, part 64. 2090. gbpat65.seq - Patent sequence entries, part 65. 2091. gbpat66.seq - Patent sequence entries, part 66. 2092. gbpat67.seq - Patent sequence entries, part 67. 2093. gbpat68.seq - Patent sequence entries, part 68. 2094. gbpat69.seq - Patent sequence entries, part 69. 2095. gbpat7.seq - Patent sequence entries, part 7. 2096. gbpat70.seq - Patent sequence entries, part 70. 2097. gbpat71.seq - Patent sequence entries, part 71. 2098. gbpat72.seq - Patent sequence entries, part 72. 2099. gbpat73.seq - Patent sequence entries, part 73. 2100. gbpat74.seq - Patent sequence entries, part 74. 2101. gbpat75.seq - Patent sequence entries, part 75. 2102. gbpat76.seq - Patent sequence entries, part 76. 2103. gbpat77.seq - Patent sequence entries, part 77. 2104. gbpat78.seq - Patent sequence entries, part 78. 2105. gbpat79.seq - Patent sequence entries, part 79. 2106. gbpat8.seq - Patent sequence entries, part 8. 2107. gbpat80.seq - Patent sequence entries, part 80. 2108. gbpat9.seq - Patent sequence entries, part 9. 2109. gbphg1.seq - Phage sequence entries, part 1. 2110. gbphg2.seq - Phage sequence entries, part 2. 2111. gbphg3.seq - Phage sequence entries, part 3. 2112. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1. 2113. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10. 2114. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100. 2115. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000. 2116. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001. 2117. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002. 2118. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003. 2119. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004. 2120. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005. 2121. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006. 2122. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007. 2123. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008. 2124. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009. 2125. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101. 2126. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010. 2127. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011. 2128. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012. 2129. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013. 2130. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014. 2131. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015. 2132. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016. 2133. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017. 2134. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018. 2135. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019. 2136. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102. 2137. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020. 2138. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021. 2139. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022. 2140. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023. 2141. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024. 2142. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025. 2143. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026. 2144. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027. 2145. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028. 2146. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029. 2147. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103. 2148. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030. 2149. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031. 2150. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032. 2151. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033. 2152. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034. 2153. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035. 2154. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036. 2155. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037. 2156. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038. 2157. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039. 2158. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104. 2159. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040. 2160. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041. 2161. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042. 2162. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043. 2163. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044. 2164. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045. 2165. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046. 2166. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047. 2167. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048. 2168. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049. 2169. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105. 2170. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050. 2171. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051. 2172. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052. 2173. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053. 2174. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054. 2175. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055. 2176. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056. 2177. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057. 2178. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058. 2179. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059. 2180. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106. 2181. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060. 2182. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061. 2183. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062. 2184. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063. 2185. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064. 2186. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065. 2187. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066. 2188. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067. 2189. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068. 2190. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069. 2191. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107. 2192. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070. 2193. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071. 2194. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072. 2195. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073. 2196. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074. 2197. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075. 2198. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076. 2199. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077. 2200. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078. 2201. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079. 2202. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108. 2203. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080. 2204. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081. 2205. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082. 2206. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083. 2207. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084. 2208. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085. 2209. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086. 2210. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087. 2211. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088. 2212. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089. 2213. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109. 2214. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090. 2215. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091. 2216. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092. 2217. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093. 2218. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094. 2219. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095. 2220. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096. 2221. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097. 2222. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098. 2223. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099. 2224. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11. 2225. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110. 2226. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100. 2227. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101. 2228. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102. 2229. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103. 2230. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104. 2231. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105. 2232. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106. 2233. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107. 2234. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108. 2235. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109. 2236. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111. 2237. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110. 2238. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111. 2239. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112. 2240. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113. 2241. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114. 2242. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115. 2243. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116. 2244. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117. 2245. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118. 2246. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119. 2247. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112. 2248. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120. 2249. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121. 2250. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122. 2251. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123. 2252. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124. 2253. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125. 2254. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126. 2255. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127. 2256. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128. 2257. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129. 2258. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113. 2259. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130. 2260. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131. 2261. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132. 2262. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133. 2263. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134. 2264. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135. 2265. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136. 2266. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137. 2267. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138. 2268. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139. 2269. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114. 2270. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140. 2271. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141. 2272. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142. 2273. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143. 2274. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144. 2275. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145. 2276. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146. 2277. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147. 2278. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148. 2279. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149. 2280. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115. 2281. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150. 2282. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151. 2283. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152. 2284. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153. 2285. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154. 2286. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155. 2287. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156. 2288. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157. 2289. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158. 2290. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159. 2291. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116. 2292. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160. 2293. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161. 2294. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162. 2295. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163. 2296. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164. 2297. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165. 2298. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166. 2299. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167. 2300. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168. 2301. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169. 2302. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117. 2303. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170. 2304. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171. 2305. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172. 2306. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173. 2307. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174. 2308. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175. 2309. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176. 2310. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177. 2311. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178. 2312. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179. 2313. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118. 2314. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180. 2315. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181. 2316. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182. 2317. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183. 2318. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184. 2319. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185. 2320. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186. 2321. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187. 2322. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188. 2323. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189. 2324. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119. 2325. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190. 2326. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191. 2327. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192. 2328. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193. 2329. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194. 2330. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195. 2331. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196. 2332. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197. 2333. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198. 2334. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199. 2335. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12. 2336. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120. 2337. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200. 2338. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201. 2339. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202. 2340. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203. 2341. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204. 2342. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205. 2343. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206. 2344. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207. 2345. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208. 2346. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209. 2347. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121. 2348. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210. 2349. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211. 2350. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212. 2351. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213. 2352. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214. 2353. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215. 2354. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216. 2355. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217. 2356. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218. 2357. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219. 2358. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122. 2359. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220. 2360. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221. 2361. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222. 2362. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223. 2363. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224. 2364. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225. 2365. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226. 2366. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227. 2367. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228. 2368. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229. 2369. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123. 2370. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230. 2371. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231. 2372. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232. 2373. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233. 2374. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234. 2375. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235. 2376. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236. 2377. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237. 2378. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238. 2379. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239. 2380. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124. 2381. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240. 2382. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241. 2383. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242. 2384. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243. 2385. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244. 2386. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245. 2387. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246. 2388. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247. 2389. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248. 2390. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249. 2391. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125. 2392. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250. 2393. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251. 2394. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252. 2395. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253. 2396. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254. 2397. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255. 2398. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256. 2399. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257. 2400. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258. 2401. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259. 2402. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126. 2403. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260. 2404. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261. 2405. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262. 2406. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263. 2407. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264. 2408. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265. 2409. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266. 2410. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267. 2411. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268. 2412. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269. 2413. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127. 2414. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270. 2415. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271. 2416. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272. 2417. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273. 2418. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274. 2419. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275. 2420. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276. 2421. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277. 2422. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278. 2423. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279. 2424. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128. 2425. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280. 2426. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281. 2427. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282. 2428. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283. 2429. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284. 2430. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285. 2431. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286. 2432. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287. 2433. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288. 2434. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289. 2435. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129. 2436. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290. 2437. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291. 2438. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292. 2439. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293. 2440. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294. 2441. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295. 2442. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296. 2443. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297. 2444. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298. 2445. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299. 2446. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13. 2447. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130. 2448. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300. 2449. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301. 2450. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302. 2451. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303. 2452. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304. 2453. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305. 2454. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306. 2455. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307. 2456. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308. 2457. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309. 2458. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131. 2459. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310. 2460. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311. 2461. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312. 2462. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313. 2463. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314. 2464. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315. 2465. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316. 2466. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317. 2467. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318. 2468. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319. 2469. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132. 2470. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320. 2471. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321. 2472. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322. 2473. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323. 2474. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324. 2475. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325. 2476. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326. 2477. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327. 2478. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328. 2479. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329. 2480. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133. 2481. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330. 2482. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331. 2483. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332. 2484. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333. 2485. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334. 2486. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335. 2487. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336. 2488. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337. 2489. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338. 2490. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339. 2491. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134. 2492. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340. 2493. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341. 2494. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342. 2495. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343. 2496. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344. 2497. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345. 2498. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346. 2499. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347. 2500. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348. 2501. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349. 2502. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135. 2503. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350. 2504. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351. 2505. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352. 2506. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353. 2507. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354. 2508. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355. 2509. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356. 2510. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357. 2511. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358. 2512. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359. 2513. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136. 2514. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360. 2515. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361. 2516. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362. 2517. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363. 2518. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364. 2519. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365. 2520. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366. 2521. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367. 2522. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368. 2523. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369. 2524. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137. 2525. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370. 2526. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371. 2527. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372. 2528. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373. 2529. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374. 2530. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375. 2531. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376. 2532. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377. 2533. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378. 2534. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379. 2535. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138. 2536. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380. 2537. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381. 2538. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382. 2539. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383. 2540. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384. 2541. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385. 2542. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386. 2543. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387. 2544. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388. 2545. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389. 2546. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139. 2547. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390. 2548. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391. 2549. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392. 2550. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393. 2551. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394. 2552. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395. 2553. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396. 2554. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397. 2555. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398. 2556. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399. 2557. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14. 2558. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140. 2559. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400. 2560. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401. 2561. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402. 2562. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403. 2563. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404. 2564. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405. 2565. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406. 2566. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407. 2567. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408. 2568. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409. 2569. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141. 2570. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410. 2571. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411. 2572. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412. 2573. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413. 2574. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414. 2575. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415. 2576. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416. 2577. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417. 2578. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418. 2579. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419. 2580. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142. 2581. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420. 2582. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421. 2583. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422. 2584. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423. 2585. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424. 2586. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425. 2587. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426. 2588. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427. 2589. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428. 2590. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429. 2591. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143. 2592. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430. 2593. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431. 2594. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432. 2595. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433. 2596. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434. 2597. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435. 2598. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436. 2599. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437. 2600. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438. 2601. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439. 2602. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144. 2603. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440. 2604. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441. 2605. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442. 2606. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443. 2607. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444. 2608. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445. 2609. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446. 2610. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447. 2611. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448. 2612. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449. 2613. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145. 2614. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450. 2615. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451. 2616. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452. 2617. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453. 2618. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454. 2619. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455. 2620. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456. 2621. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457. 2622. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458. 2623. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459. 2624. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146. 2625. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460. 2626. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461. 2627. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462. 2628. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463. 2629. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464. 2630. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465. 2631. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466. 2632. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467. 2633. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468. 2634. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469. 2635. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147. 2636. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470. 2637. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471. 2638. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472. 2639. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473. 2640. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474. 2641. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475. 2642. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476. 2643. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477. 2644. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478. 2645. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479. 2646. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148. 2647. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480. 2648. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481. 2649. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482. 2650. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483. 2651. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484. 2652. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485. 2653. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486. 2654. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487. 2655. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488. 2656. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489. 2657. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149. 2658. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490. 2659. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491. 2660. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492. 2661. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493. 2662. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494. 2663. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495. 2664. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496. 2665. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497. 2666. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498. 2667. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499. 2668. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15. 2669. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150. 2670. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500. 2671. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501. 2672. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502. 2673. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503. 2674. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504. 2675. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505. 2676. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506. 2677. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507. 2678. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508. 2679. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509. 2680. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151. 2681. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510. 2682. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511. 2683. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512. 2684. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513. 2685. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514. 2686. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515. 2687. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516. 2688. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517. 2689. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518. 2690. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519. 2691. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152. 2692. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520. 2693. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521. 2694. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522. 2695. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523. 2696. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524. 2697. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525. 2698. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526. 2699. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527. 2700. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528. 2701. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529. 2702. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153. 2703. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530. 2704. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531. 2705. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532. 2706. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533. 2707. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534. 2708. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535. 2709. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536. 2710. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537. 2711. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538. 2712. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539. 2713. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154. 2714. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540. 2715. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541. 2716. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542. 2717. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543. 2718. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544. 2719. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545. 2720. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546. 2721. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547. 2722. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548. 2723. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549. 2724. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155. 2725. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550. 2726. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551. 2727. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552. 2728. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553. 2729. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554. 2730. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555. 2731. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556. 2732. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557. 2733. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558. 2734. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559. 2735. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156. 2736. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560. 2737. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561. 2738. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562. 2739. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563. 2740. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564. 2741. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565. 2742. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566. 2743. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567. 2744. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568. 2745. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569. 2746. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157. 2747. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570. 2748. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571. 2749. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572. 2750. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573. 2751. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574. 2752. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575. 2753. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576. 2754. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577. 2755. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578. 2756. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579. 2757. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158. 2758. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580. 2759. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581. 2760. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582. 2761. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583. 2762. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584. 2763. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585. 2764. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586. 2765. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587. 2766. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588. 2767. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589. 2768. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159. 2769. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590. 2770. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591. 2771. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592. 2772. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593. 2773. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594. 2774. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595. 2775. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596. 2776. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597. 2777. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598. 2778. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599. 2779. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16. 2780. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160. 2781. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600. 2782. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601. 2783. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602. 2784. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603. 2785. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604. 2786. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605. 2787. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606. 2788. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607. 2789. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608. 2790. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609. 2791. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161. 2792. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610. 2793. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611. 2794. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612. 2795. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613. 2796. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614. 2797. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615. 2798. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616. 2799. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617. 2800. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618. 2801. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619. 2802. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162. 2803. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620. 2804. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621. 2805. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622. 2806. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623. 2807. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624. 2808. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625. 2809. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626. 2810. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627. 2811. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628. 2812. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629. 2813. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163. 2814. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630. 2815. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631. 2816. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632. 2817. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633. 2818. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634. 2819. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635. 2820. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636. 2821. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637. 2822. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638. 2823. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639. 2824. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164. 2825. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640. 2826. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641. 2827. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642. 2828. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643. 2829. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644. 2830. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645. 2831. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646. 2832. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647. 2833. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648. 2834. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649. 2835. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165. 2836. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650. 2837. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651. 2838. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652. 2839. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653. 2840. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654. 2841. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655. 2842. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656. 2843. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657. 2844. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658. 2845. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659. 2846. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166. 2847. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660. 2848. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661. 2849. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662. 2850. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663. 2851. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664. 2852. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665. 2853. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666. 2854. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667. 2855. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668. 2856. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669. 2857. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167. 2858. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670. 2859. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671. 2860. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672. 2861. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673. 2862. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674. 2863. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675. 2864. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676. 2865. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677. 2866. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678. 2867. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679. 2868. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168. 2869. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680. 2870. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681. 2871. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682. 2872. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683. 2873. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684. 2874. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685. 2875. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686. 2876. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687. 2877. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688. 2878. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689. 2879. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169. 2880. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690. 2881. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691. 2882. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692. 2883. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693. 2884. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694. 2885. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695. 2886. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696. 2887. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697. 2888. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698. 2889. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699. 2890. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17. 2891. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170. 2892. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700. 2893. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701. 2894. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702. 2895. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703. 2896. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704. 2897. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705. 2898. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706. 2899. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707. 2900. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708. 2901. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709. 2902. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171. 2903. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710. 2904. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711. 2905. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712. 2906. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713. 2907. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714. 2908. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715. 2909. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716. 2910. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717. 2911. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718. 2912. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719. 2913. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172. 2914. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720. 2915. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721. 2916. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722. 2917. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723. 2918. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724. 2919. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725. 2920. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726. 2921. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727. 2922. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728. 2923. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729. 2924. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173. 2925. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730. 2926. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731. 2927. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732. 2928. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733. 2929. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734. 2930. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735. 2931. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736. 2932. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737. 2933. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738. 2934. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739. 2935. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174. 2936. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740. 2937. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741. 2938. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742. 2939. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743. 2940. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744. 2941. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745. 2942. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746. 2943. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747. 2944. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748. 2945. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749. 2946. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175. 2947. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750. 2948. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751. 2949. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752. 2950. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753. 2951. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754. 2952. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755. 2953. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756. 2954. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757. 2955. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758. 2956. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759. 2957. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176. 2958. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760. 2959. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761. 2960. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762. 2961. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763. 2962. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764. 2963. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765. 2964. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766. 2965. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767. 2966. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768. 2967. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769. 2968. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177. 2969. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770. 2970. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771. 2971. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772. 2972. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773. 2973. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774. 2974. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775. 2975. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776. 2976. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777. 2977. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778. 2978. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779. 2979. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178. 2980. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780. 2981. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781. 2982. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782. 2983. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783. 2984. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784. 2985. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785. 2986. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786. 2987. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787. 2988. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788. 2989. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789. 2990. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179. 2991. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790. 2992. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791. 2993. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792. 2994. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793. 2995. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794. 2996. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795. 2997. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796. 2998. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797. 2999. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798. 3000. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799. 3001. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18. 3002. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180. 3003. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800. 3004. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801. 3005. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802. 3006. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803. 3007. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804. 3008. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805. 3009. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806. 3010. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807. 3011. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808. 3012. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809. 3013. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181. 3014. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810. 3015. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811. 3016. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812. 3017. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813. 3018. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814. 3019. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815. 3020. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816. 3021. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817. 3022. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818. 3023. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819. 3024. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182. 3025. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820. 3026. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821. 3027. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822. 3028. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823. 3029. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824. 3030. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825. 3031. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826. 3032. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827. 3033. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828. 3034. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829. 3035. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183. 3036. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830. 3037. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831. 3038. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832. 3039. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833. 3040. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834. 3041. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835. 3042. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836. 3043. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837. 3044. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838. 3045. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839. 3046. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184. 3047. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840. 3048. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841. 3049. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842. 3050. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843. 3051. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844. 3052. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845. 3053. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846. 3054. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847. 3055. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848. 3056. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849. 3057. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185. 3058. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850. 3059. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851. 3060. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852. 3061. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853. 3062. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854. 3063. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855. 3064. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856. 3065. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857. 3066. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858. 3067. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859. 3068. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186. 3069. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860. 3070. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861. 3071. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862. 3072. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863. 3073. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864. 3074. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865. 3075. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866. 3076. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867. 3077. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868. 3078. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869. 3079. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187. 3080. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870. 3081. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871. 3082. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872. 3083. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873. 3084. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874. 3085. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875. 3086. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188. 3087. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189. 3088. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19. 3089. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190. 3090. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191. 3091. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192. 3092. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193. 3093. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194. 3094. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195. 3095. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196. 3096. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197. 3097. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198. 3098. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199. 3099. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2. 3100. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20. 3101. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200. 3102. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201. 3103. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202. 3104. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203. 3105. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204. 3106. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205. 3107. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206. 3108. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207. 3109. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208. 3110. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209. 3111. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21. 3112. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210. 3113. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211. 3114. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212. 3115. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213. 3116. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214. 3117. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215. 3118. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216. 3119. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217. 3120. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218. 3121. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219. 3122. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22. 3123. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220. 3124. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221. 3125. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222. 3126. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223. 3127. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224. 3128. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225. 3129. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226. 3130. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227. 3131. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228. 3132. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229. 3133. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23. 3134. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230. 3135. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231. 3136. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232. 3137. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233. 3138. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234. 3139. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235. 3140. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236. 3141. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237. 3142. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238. 3143. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239. 3144. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24. 3145. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240. 3146. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241. 3147. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242. 3148. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243. 3149. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244. 3150. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245. 3151. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246. 3152. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247. 3153. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248. 3154. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249. 3155. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25. 3156. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250. 3157. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251. 3158. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252. 3159. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253. 3160. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254. 3161. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255. 3162. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256. 3163. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257. 3164. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258. 3165. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259. 3166. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26. 3167. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260. 3168. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261. 3169. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262. 3170. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263. 3171. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264. 3172. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265. 3173. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266. 3174. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267. 3175. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268. 3176. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269. 3177. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27. 3178. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270. 3179. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271. 3180. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272. 3181. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273. 3182. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274. 3183. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275. 3184. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276. 3185. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277. 3186. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278. 3187. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279. 3188. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28. 3189. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280. 3190. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281. 3191. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282. 3192. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283. 3193. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284. 3194. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285. 3195. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286. 3196. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287. 3197. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288. 3198. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289. 3199. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29. 3200. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290. 3201. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291. 3202. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292. 3203. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293. 3204. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294. 3205. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295. 3206. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296. 3207. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297. 3208. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298. 3209. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299. 3210. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3. 3211. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30. 3212. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300. 3213. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301. 3214. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302. 3215. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303. 3216. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304. 3217. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305. 3218. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306. 3219. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307. 3220. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308. 3221. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309. 3222. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31. 3223. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310. 3224. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311. 3225. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312. 3226. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313. 3227. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314. 3228. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315. 3229. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316. 3230. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317. 3231. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318. 3232. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319. 3233. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32. 3234. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320. 3235. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321. 3236. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322. 3237. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323. 3238. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324. 3239. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325. 3240. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326. 3241. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327. 3242. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328. 3243. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329. 3244. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33. 3245. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330. 3246. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331. 3247. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332. 3248. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333. 3249. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334. 3250. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335. 3251. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336. 3252. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337. 3253. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338. 3254. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339. 3255. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34. 3256. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340. 3257. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341. 3258. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342. 3259. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343. 3260. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344. 3261. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345. 3262. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346. 3263. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347. 3264. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348. 3265. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349. 3266. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35. 3267. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350. 3268. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351. 3269. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352. 3270. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353. 3271. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354. 3272. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355. 3273. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356. 3274. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357. 3275. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358. 3276. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359. 3277. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36. 3278. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360. 3279. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361. 3280. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362. 3281. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363. 3282. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364. 3283. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365. 3284. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366. 3285. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367. 3286. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368. 3287. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369. 3288. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37. 3289. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370. 3290. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371. 3291. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372. 3292. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373. 3293. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374. 3294. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375. 3295. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376. 3296. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377. 3297. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378. 3298. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379. 3299. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38. 3300. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380. 3301. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381. 3302. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382. 3303. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383. 3304. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384. 3305. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385. 3306. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386. 3307. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387. 3308. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388. 3309. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389. 3310. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39. 3311. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390. 3312. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391. 3313. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392. 3314. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393. 3315. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394. 3316. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395. 3317. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396. 3318. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397. 3319. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398. 3320. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399. 3321. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4. 3322. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40. 3323. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400. 3324. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401. 3325. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402. 3326. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403. 3327. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404. 3328. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405. 3329. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406. 3330. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407. 3331. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408. 3332. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409. 3333. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41. 3334. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410. 3335. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411. 3336. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412. 3337. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413. 3338. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414. 3339. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415. 3340. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416. 3341. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417. 3342. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418. 3343. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419. 3344. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42. 3345. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420. 3346. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421. 3347. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422. 3348. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423. 3349. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424. 3350. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425. 3351. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426. 3352. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427. 3353. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428. 3354. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429. 3355. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43. 3356. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430. 3357. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431. 3358. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432. 3359. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433. 3360. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434. 3361. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435. 3362. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436. 3363. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437. 3364. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438. 3365. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439. 3366. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44. 3367. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440. 3368. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441. 3369. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442. 3370. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443. 3371. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444. 3372. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445. 3373. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446. 3374. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447. 3375. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448. 3376. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449. 3377. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45. 3378. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450. 3379. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451. 3380. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452. 3381. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453. 3382. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454. 3383. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455. 3384. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456. 3385. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457. 3386. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458. 3387. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459. 3388. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46. 3389. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460. 3390. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461. 3391. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462. 3392. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463. 3393. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464. 3394. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465. 3395. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466. 3396. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467. 3397. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468. 3398. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469. 3399. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47. 3400. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470. 3401. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471. 3402. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472. 3403. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473. 3404. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474. 3405. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475. 3406. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476. 3407. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477. 3408. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478. 3409. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479. 3410. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48. 3411. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480. 3412. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481. 3413. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482. 3414. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483. 3415. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484. 3416. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485. 3417. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486. 3418. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487. 3419. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488. 3420. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489. 3421. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49. 3422. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490. 3423. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491. 3424. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492. 3425. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493. 3426. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494. 3427. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495. 3428. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496. 3429. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497. 3430. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498. 3431. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499. 3432. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5. 3433. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50. 3434. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500. 3435. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501. 3436. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502. 3437. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503. 3438. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504. 3439. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505. 3440. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506. 3441. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507. 3442. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508. 3443. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509. 3444. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51. 3445. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510. 3446. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511. 3447. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512. 3448. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513. 3449. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514. 3450. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515. 3451. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516. 3452. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517. 3453. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518. 3454. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519. 3455. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52. 3456. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520. 3457. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521. 3458. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522. 3459. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523. 3460. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524. 3461. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525. 3462. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526. 3463. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527. 3464. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528. 3465. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529. 3466. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53. 3467. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530. 3468. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531. 3469. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532. 3470. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533. 3471. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534. 3472. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535. 3473. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536. 3474. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537. 3475. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538. 3476. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539. 3477. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54. 3478. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540. 3479. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541. 3480. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542. 3481. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543. 3482. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544. 3483. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545. 3484. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546. 3485. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547. 3486. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548. 3487. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549. 3488. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55. 3489. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550. 3490. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551. 3491. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552. 3492. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553. 3493. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554. 3494. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555. 3495. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556. 3496. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557. 3497. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558. 3498. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559. 3499. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56. 3500. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560. 3501. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561. 3502. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562. 3503. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563. 3504. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564. 3505. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565. 3506. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566. 3507. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567. 3508. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568. 3509. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569. 3510. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57. 3511. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570. 3512. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571. 3513. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572. 3514. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573. 3515. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574. 3516. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575. 3517. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576. 3518. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577. 3519. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578. 3520. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579. 3521. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58. 3522. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580. 3523. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581. 3524. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582. 3525. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583. 3526. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584. 3527. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585. 3528. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586. 3529. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587. 3530. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588. 3531. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589. 3532. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59. 3533. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590. 3534. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591. 3535. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592. 3536. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593. 3537. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594. 3538. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595. 3539. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596. 3540. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597. 3541. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598. 3542. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599. 3543. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6. 3544. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60. 3545. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600. 3546. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601. 3547. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602. 3548. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603. 3549. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604. 3550. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605. 3551. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606. 3552. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607. 3553. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608. 3554. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609. 3555. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61. 3556. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610. 3557. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611. 3558. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612. 3559. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613. 3560. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614. 3561. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615. 3562. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616. 3563. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617. 3564. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618. 3565. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619. 3566. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62. 3567. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620. 3568. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621. 3569. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622. 3570. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623. 3571. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624. 3572. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625. 3573. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626. 3574. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627. 3575. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628. 3576. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629. 3577. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63. 3578. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630. 3579. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631. 3580. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632. 3581. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633. 3582. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634. 3583. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635. 3584. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636. 3585. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637. 3586. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638. 3587. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639. 3588. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64. 3589. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640. 3590. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641. 3591. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642. 3592. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643. 3593. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644. 3594. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645. 3595. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646. 3596. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647. 3597. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648. 3598. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649. 3599. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65. 3600. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650. 3601. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651. 3602. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652. 3603. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653. 3604. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654. 3605. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655. 3606. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656. 3607. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657. 3608. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658. 3609. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659. 3610. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66. 3611. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660. 3612. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661. 3613. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662. 3614. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663. 3615. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664. 3616. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665. 3617. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666. 3618. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667. 3619. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668. 3620. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669. 3621. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67. 3622. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670. 3623. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671. 3624. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672. 3625. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673. 3626. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674. 3627. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675. 3628. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676. 3629. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677. 3630. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678. 3631. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679. 3632. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68. 3633. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680. 3634. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681. 3635. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682. 3636. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683. 3637. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684. 3638. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685. 3639. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686. 3640. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687. 3641. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688. 3642. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689. 3643. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69. 3644. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690. 3645. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691. 3646. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692. 3647. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693. 3648. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694. 3649. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695. 3650. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696. 3651. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697. 3652. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698. 3653. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699. 3654. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7. 3655. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70. 3656. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700. 3657. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701. 3658. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702. 3659. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703. 3660. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704. 3661. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705. 3662. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706. 3663. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707. 3664. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708. 3665. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709. 3666. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71. 3667. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710. 3668. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711. 3669. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712. 3670. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713. 3671. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714. 3672. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715. 3673. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716. 3674. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717. 3675. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718. 3676. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719. 3677. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72. 3678. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720. 3679. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721. 3680. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722. 3681. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723. 3682. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724. 3683. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725. 3684. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726. 3685. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727. 3686. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728. 3687. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729. 3688. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73. 3689. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730. 3690. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731. 3691. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732. 3692. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733. 3693. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734. 3694. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735. 3695. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736. 3696. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737. 3697. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738. 3698. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739. 3699. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74. 3700. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740. 3701. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741. 3702. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742. 3703. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743. 3704. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744. 3705. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745. 3706. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746. 3707. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747. 3708. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748. 3709. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749. 3710. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75. 3711. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750. 3712. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751. 3713. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752. 3714. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753. 3715. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754. 3716. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755. 3717. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756. 3718. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757. 3719. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758. 3720. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759. 3721. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76. 3722. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760. 3723. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761. 3724. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762. 3725. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763. 3726. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764. 3727. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765. 3728. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766. 3729. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767. 3730. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768. 3731. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769. 3732. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77. 3733. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770. 3734. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771. 3735. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772. 3736. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773. 3737. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774. 3738. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775. 3739. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776. 3740. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777. 3741. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778. 3742. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779. 3743. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78. 3744. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780. 3745. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781. 3746. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782. 3747. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783. 3748. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784. 3749. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785. 3750. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786. 3751. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787. 3752. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788. 3753. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789. 3754. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79. 3755. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790. 3756. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791. 3757. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792. 3758. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793. 3759. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794. 3760. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795. 3761. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796. 3762. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797. 3763. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798. 3764. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799. 3765. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8. 3766. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80. 3767. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800. 3768. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801. 3769. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802. 3770. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803. 3771. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804. 3772. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805. 3773. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806. 3774. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807. 3775. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808. 3776. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809. 3777. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81. 3778. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810. 3779. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811. 3780. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812. 3781. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813. 3782. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814. 3783. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815. 3784. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816. 3785. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817. 3786. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818. 3787. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819. 3788. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82. 3789. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820. 3790. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821. 3791. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822. 3792. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823. 3793. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824. 3794. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825. 3795. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826. 3796. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827. 3797. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828. 3798. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829. 3799. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83. 3800. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830. 3801. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831. 3802. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832. 3803. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833. 3804. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834. 3805. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835. 3806. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836. 3807. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837. 3808. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838. 3809. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839. 3810. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84. 3811. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840. 3812. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841. 3813. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842. 3814. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843. 3815. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844. 3816. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845. 3817. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846. 3818. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847. 3819. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848. 3820. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849. 3821. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85. 3822. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850. 3823. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851. 3824. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852. 3825. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853. 3826. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854. 3827. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855. 3828. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856. 3829. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857. 3830. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858. 3831. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859. 3832. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86. 3833. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860. 3834. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861. 3835. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862. 3836. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863. 3837. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864. 3838. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865. 3839. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866. 3840. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867. 3841. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868. 3842. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869. 3843. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87. 3844. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870. 3845. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871. 3846. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872. 3847. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873. 3848. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874. 3849. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875. 3850. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876. 3851. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877. 3852. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878. 3853. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879. 3854. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88. 3855. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880. 3856. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881. 3857. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882. 3858. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883. 3859. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884. 3860. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885. 3861. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886. 3862. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887. 3863. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888. 3864. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889. 3865. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89. 3866. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890. 3867. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891. 3868. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892. 3869. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893. 3870. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894. 3871. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895. 3872. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896. 3873. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897. 3874. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898. 3875. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899. 3876. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9. 3877. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90. 3878. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900. 3879. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901. 3880. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902. 3881. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903. 3882. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904. 3883. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905. 3884. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906. 3885. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907. 3886. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908. 3887. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909. 3888. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91. 3889. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910. 3890. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911. 3891. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912. 3892. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913. 3893. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914. 3894. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915. 3895. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916. 3896. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917. 3897. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918. 3898. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919. 3899. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92. 3900. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920. 3901. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921. 3902. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922. 3903. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923. 3904. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924. 3905. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925. 3906. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926. 3907. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927. 3908. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928. 3909. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929. 3910. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93. 3911. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930. 3912. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931. 3913. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932. 3914. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933. 3915. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934. 3916. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935. 3917. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936. 3918. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937. 3919. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938. 3920. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939. 3921. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94. 3922. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940. 3923. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941. 3924. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942. 3925. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943. 3926. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944. 3927. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945. 3928. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946. 3929. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947. 3930. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948. 3931. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949. 3932. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95. 3933. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950. 3934. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951. 3935. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952. 3936. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953. 3937. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954. 3938. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955. 3939. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956. 3940. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957. 3941. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958. 3942. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959. 3943. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96. 3944. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960. 3945. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961. 3946. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962. 3947. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963. 3948. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964. 3949. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965. 3950. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966. 3951. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967. 3952. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968. 3953. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969. 3954. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97. 3955. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970. 3956. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971. 3957. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972. 3958. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973. 3959. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974. 3960. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975. 3961. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976. 3962. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977. 3963. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978. 3964. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979. 3965. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98. 3966. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980. 3967. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981. 3968. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982. 3969. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983. 3970. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984. 3971. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985. 3972. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986. 3973. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987. 3974. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988. 3975. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989. 3976. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99. 3977. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990. 3978. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991. 3979. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992. 3980. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993. 3981. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994. 3982. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995. 3983. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996. 3984. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997. 3985. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998. 3986. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999. 3987. gbpri1.seq - Primate sequence entries, part 1. 3988. gbpri10.seq - Primate sequence entries, part 10. 3989. gbpri100.seq - Primate sequence entries, part 100. 3990. gbpri101.seq - Primate sequence entries, part 101. 3991. gbpri102.seq - Primate sequence entries, part 102. 3992. gbpri103.seq - Primate sequence entries, part 103. 3993. gbpri104.seq - Primate sequence entries, part 104. 3994. gbpri105.seq - Primate sequence entries, part 105. 3995. gbpri106.seq - Primate sequence entries, part 106. 3996. gbpri107.seq - Primate sequence entries, part 107. 3997. gbpri108.seq - Primate sequence entries, part 108. 3998. gbpri109.seq - Primate sequence entries, part 109. 3999. gbpri11.seq - Primate sequence entries, part 11. 4000. gbpri110.seq - Primate sequence entries, part 110. 4001. gbpri111.seq - Primate sequence entries, part 111. 4002. gbpri112.seq - Primate sequence entries, part 112. 4003. gbpri113.seq - Primate sequence entries, part 113. 4004. gbpri114.seq - Primate sequence entries, part 114. 4005. gbpri115.seq - Primate sequence entries, part 115. 4006. gbpri116.seq - Primate sequence entries, part 116. 4007. gbpri117.seq - Primate sequence entries, part 117. 4008. gbpri118.seq - Primate sequence entries, part 118. 4009. gbpri119.seq - Primate sequence entries, part 119. 4010. gbpri12.seq - Primate sequence entries, part 12. 4011. gbpri120.seq - Primate sequence entries, part 120. 4012. gbpri121.seq - Primate sequence entries, part 121. 4013. gbpri122.seq - Primate sequence entries, part 122. 4014. gbpri123.seq - Primate sequence entries, part 123. 4015. gbpri124.seq - Primate sequence entries, part 124. 4016. gbpri125.seq - Primate sequence entries, part 125. 4017. gbpri126.seq - Primate sequence entries, part 126. 4018. gbpri127.seq - Primate sequence entries, part 127. 4019. gbpri128.seq - Primate sequence entries, part 128. 4020. gbpri129.seq - Primate sequence entries, part 129. 4021. gbpri13.seq - Primate sequence entries, part 13. 4022. gbpri130.seq - Primate sequence entries, part 130. 4023. gbpri131.seq - Primate sequence entries, part 131. 4024. gbpri132.seq - Primate sequence entries, part 132. 4025. gbpri133.seq - Primate sequence entries, part 133. 4026. gbpri134.seq - Primate sequence entries, part 134. 4027. gbpri135.seq - Primate sequence entries, part 135. 4028. gbpri136.seq - Primate sequence entries, part 136. 4029. gbpri137.seq - Primate sequence entries, part 137. 4030. gbpri138.seq - Primate sequence entries, part 138. 4031. gbpri139.seq - Primate sequence entries, part 139. 4032. gbpri14.seq - Primate sequence entries, part 14. 4033. gbpri140.seq - Primate sequence entries, part 140. 4034. gbpri141.seq - Primate sequence entries, part 141. 4035. gbpri142.seq - Primate sequence entries, part 142. 4036. gbpri143.seq - Primate sequence entries, part 143. 4037. gbpri144.seq - Primate sequence entries, part 144. 4038. gbpri145.seq - Primate sequence entries, part 145. 4039. gbpri146.seq - Primate sequence entries, part 146. 4040. gbpri147.seq - Primate sequence entries, part 147. 4041. gbpri148.seq - Primate sequence entries, part 148. 4042. gbpri149.seq - Primate sequence entries, part 149. 4043. gbpri15.seq - Primate sequence entries, part 15. 4044. gbpri150.seq - Primate sequence entries, part 150. 4045. gbpri151.seq - Primate sequence entries, part 151. 4046. gbpri152.seq - Primate sequence entries, part 152. 4047. gbpri153.seq - Primate sequence entries, part 153. 4048. gbpri154.seq - Primate sequence entries, part 154. 4049. gbpri155.seq - Primate sequence entries, part 155. 4050. gbpri156.seq - Primate sequence entries, part 156. 4051. gbpri157.seq - Primate sequence entries, part 157. 4052. gbpri158.seq - Primate sequence entries, part 158. 4053. gbpri159.seq - Primate sequence entries, part 159. 4054. gbpri16.seq - Primate sequence entries, part 16. 4055. gbpri160.seq - Primate sequence entries, part 160. 4056. gbpri161.seq - Primate sequence entries, part 161. 4057. gbpri162.seq - Primate sequence entries, part 162. 4058. gbpri163.seq - Primate sequence entries, part 163. 4059. gbpri164.seq - Primate sequence entries, part 164. 4060. gbpri165.seq - Primate sequence entries, part 165. 4061. gbpri166.seq - Primate sequence entries, part 166. 4062. gbpri167.seq - Primate sequence entries, part 167. 4063. gbpri168.seq - Primate sequence entries, part 168. 4064. gbpri169.seq - Primate sequence entries, part 169. 4065. gbpri17.seq - Primate sequence entries, part 17. 4066. gbpri170.seq - Primate sequence entries, part 170. 4067. gbpri171.seq - Primate sequence entries, part 171. 4068. gbpri172.seq - Primate sequence entries, part 172. 4069. gbpri173.seq - Primate sequence entries, part 173. 4070. gbpri174.seq - Primate sequence entries, part 174. 4071. gbpri175.seq - Primate sequence entries, part 175. 4072. gbpri176.seq - Primate sequence entries, part 176. 4073. gbpri177.seq - Primate sequence entries, part 177. 4074. gbpri178.seq - Primate sequence entries, part 178. 4075. gbpri179.seq - Primate sequence entries, part 179. 4076. gbpri18.seq - Primate sequence entries, part 18. 4077. gbpri180.seq - Primate sequence entries, part 180. 4078. gbpri181.seq - Primate sequence entries, part 181. 4079. gbpri182.seq - Primate sequence entries, part 182. 4080. gbpri183.seq - Primate sequence entries, part 183. 4081. gbpri184.seq - Primate sequence entries, part 184. 4082. gbpri185.seq - Primate sequence entries, part 185. 4083. gbpri186.seq - Primate sequence entries, part 186. 4084. gbpri187.seq - Primate sequence entries, part 187. 4085. gbpri188.seq - Primate sequence entries, part 188. 4086. gbpri189.seq - Primate sequence entries, part 189. 4087. gbpri19.seq - Primate sequence entries, part 19. 4088. gbpri190.seq - Primate sequence entries, part 190. 4089. gbpri191.seq - Primate sequence entries, part 191. 4090. gbpri192.seq - Primate sequence entries, part 192. 4091. gbpri193.seq - Primate sequence entries, part 193. 4092. gbpri194.seq - Primate sequence entries, part 194. 4093. gbpri195.seq - Primate sequence entries, part 195. 4094. gbpri196.seq - Primate sequence entries, part 196. 4095. gbpri197.seq - Primate sequence entries, part 197. 4096. gbpri198.seq - Primate sequence entries, part 198. 4097. gbpri199.seq - Primate sequence entries, part 199. 4098. gbpri2.seq - Primate sequence entries, part 2. 4099. gbpri20.seq - Primate sequence entries, part 20. 4100. gbpri200.seq - Primate sequence entries, part 200. 4101. gbpri201.seq - Primate sequence entries, part 201. 4102. gbpri202.seq - Primate sequence entries, part 202. 4103. gbpri203.seq - Primate sequence entries, part 203. 4104. gbpri204.seq - Primate sequence entries, part 204. 4105. gbpri205.seq - Primate sequence entries, part 205. 4106. gbpri206.seq - Primate sequence entries, part 206. 4107. gbpri207.seq - Primate sequence entries, part 207. 4108. gbpri208.seq - Primate sequence entries, part 208. 4109. gbpri209.seq - Primate sequence entries, part 209. 4110. gbpri21.seq - Primate sequence entries, part 21. 4111. gbpri210.seq - Primate sequence entries, part 210. 4112. gbpri211.seq - Primate sequence entries, part 211. 4113. gbpri212.seq - Primate sequence entries, part 212. 4114. gbpri213.seq - Primate sequence entries, part 213. 4115. gbpri214.seq - Primate sequence entries, part 214. 4116. gbpri215.seq - Primate sequence entries, part 215. 4117. gbpri216.seq - Primate sequence entries, part 216. 4118. gbpri217.seq - Primate sequence entries, part 217. 4119. gbpri218.seq - Primate sequence entries, part 218. 4120. gbpri219.seq - Primate sequence entries, part 219. 4121. gbpri22.seq - Primate sequence entries, part 22. 4122. gbpri220.seq - Primate sequence entries, part 220. 4123. gbpri221.seq - Primate sequence entries, part 221. 4124. gbpri222.seq - Primate sequence entries, part 222. 4125. gbpri223.seq - Primate sequence entries, part 223. 4126. gbpri224.seq - Primate sequence entries, part 224. 4127. gbpri225.seq - Primate sequence entries, part 225. 4128. gbpri226.seq - Primate sequence entries, part 226. 4129. gbpri227.seq - Primate sequence entries, part 227. 4130. gbpri228.seq - Primate sequence entries, part 228. 4131. gbpri229.seq - Primate sequence entries, part 229. 4132. gbpri23.seq - Primate sequence entries, part 23. 4133. gbpri230.seq - Primate sequence entries, part 230. 4134. gbpri231.seq - Primate sequence entries, part 231. 4135. gbpri232.seq - Primate sequence entries, part 232. 4136. gbpri233.seq - Primate sequence entries, part 233. 4137. gbpri234.seq - Primate sequence entries, part 234. 4138. gbpri235.seq - Primate sequence entries, part 235. 4139. gbpri236.seq - Primate sequence entries, part 236. 4140. gbpri237.seq - Primate sequence entries, part 237. 4141. gbpri238.seq - Primate sequence entries, part 238. 4142. gbpri239.seq - Primate sequence entries, part 239. 4143. gbpri24.seq - Primate sequence entries, part 24. 4144. gbpri240.seq - Primate sequence entries, part 240. 4145. gbpri241.seq - Primate sequence entries, part 241. 4146. gbpri242.seq - Primate sequence entries, part 242. 4147. gbpri243.seq - Primate sequence entries, part 243. 4148. gbpri244.seq - Primate sequence entries, part 244. 4149. gbpri245.seq - Primate sequence entries, part 245. 4150. gbpri246.seq - Primate sequence entries, part 246. 4151. gbpri247.seq - Primate sequence entries, part 247. 4152. gbpri248.seq - Primate sequence entries, part 248. 4153. gbpri249.seq - Primate sequence entries, part 249. 4154. gbpri25.seq - Primate sequence entries, part 25. 4155. gbpri250.seq - Primate sequence entries, part 250. 4156. gbpri251.seq - Primate sequence entries, part 251. 4157. gbpri252.seq - Primate sequence entries, part 252. 4158. gbpri253.seq - Primate sequence entries, part 253. 4159. gbpri254.seq - Primate sequence entries, part 254. 4160. gbpri255.seq - Primate sequence entries, part 255. 4161. gbpri256.seq - Primate sequence entries, part 256. 4162. gbpri257.seq - Primate sequence entries, part 257. 4163. gbpri258.seq - Primate sequence entries, part 258. 4164. gbpri259.seq - Primate sequence entries, part 259. 4165. gbpri26.seq - Primate sequence entries, part 26. 4166. gbpri260.seq - Primate sequence entries, part 260. 4167. gbpri261.seq - Primate sequence entries, part 261. 4168. gbpri262.seq - Primate sequence entries, part 262. 4169. gbpri263.seq - Primate sequence entries, part 263. 4170. gbpri264.seq - Primate sequence entries, part 264. 4171. gbpri265.seq - Primate sequence entries, part 265. 4172. gbpri266.seq - Primate sequence entries, part 266. 4173. gbpri267.seq - Primate sequence entries, part 267. 4174. gbpri268.seq - Primate sequence entries, part 268. 4175. gbpri269.seq - Primate sequence entries, part 269. 4176. gbpri27.seq - Primate sequence entries, part 27. 4177. gbpri270.seq - Primate sequence entries, part 270. 4178. gbpri271.seq - Primate sequence entries, part 271. 4179. gbpri272.seq - Primate sequence entries, part 272. 4180. gbpri273.seq - Primate sequence entries, part 273. 4181. gbpri274.seq - Primate sequence entries, part 274. 4182. gbpri275.seq - Primate sequence entries, part 275. 4183. gbpri276.seq - Primate sequence entries, part 276. 4184. gbpri277.seq - Primate sequence entries, part 277. 4185. gbpri278.seq - Primate sequence entries, part 278. 4186. gbpri279.seq - Primate sequence entries, part 279. 4187. gbpri28.seq - Primate sequence entries, part 28. 4188. gbpri280.seq - Primate sequence entries, part 280. 4189. gbpri281.seq - Primate sequence entries, part 281. 4190. gbpri282.seq - Primate sequence entries, part 282. 4191. gbpri283.seq - Primate sequence entries, part 283. 4192. gbpri284.seq - Primate sequence entries, part 284. 4193. gbpri285.seq - Primate sequence entries, part 285. 4194. gbpri286.seq - Primate sequence entries, part 286. 4195. gbpri287.seq - Primate sequence entries, part 287. 4196. gbpri288.seq - Primate sequence entries, part 288. 4197. gbpri289.seq - Primate sequence entries, part 289. 4198. gbpri29.seq - Primate sequence entries, part 29. 4199. gbpri290.seq - Primate sequence entries, part 290. 4200. gbpri291.seq - Primate sequence entries, part 291. 4201. gbpri292.seq - Primate sequence entries, part 292. 4202. gbpri293.seq - Primate sequence entries, part 293. 4203. gbpri294.seq - Primate sequence entries, part 294. 4204. gbpri295.seq - Primate sequence entries, part 295. 4205. gbpri296.seq - Primate sequence entries, part 296. 4206. gbpri297.seq - Primate sequence entries, part 297. 4207. gbpri298.seq - Primate sequence entries, part 298. 4208. gbpri299.seq - Primate sequence entries, part 299. 4209. gbpri3.seq - Primate sequence entries, part 3. 4210. gbpri30.seq - Primate sequence entries, part 30. 4211. gbpri300.seq - Primate sequence entries, part 300. 4212. gbpri301.seq - Primate sequence entries, part 301. 4213. gbpri302.seq - Primate sequence entries, part 302. 4214. gbpri303.seq - Primate sequence entries, part 303. 4215. gbpri304.seq - Primate sequence entries, part 304. 4216. gbpri305.seq - Primate sequence entries, part 305. 4217. gbpri306.seq - Primate sequence entries, part 306. 4218. gbpri307.seq - Primate sequence entries, part 307. 4219. gbpri308.seq - Primate sequence entries, part 308. 4220. gbpri309.seq - Primate sequence entries, part 309. 4221. gbpri31.seq - Primate sequence entries, part 31. 4222. gbpri310.seq - Primate sequence entries, part 310. 4223. gbpri311.seq - Primate sequence entries, part 311. 4224. gbpri312.seq - Primate sequence entries, part 312. 4225. gbpri313.seq - Primate sequence entries, part 313. 4226. gbpri314.seq - Primate sequence entries, part 314. 4227. gbpri315.seq - Primate sequence entries, part 315. 4228. gbpri316.seq - Primate sequence entries, part 316. 4229. gbpri317.seq - Primate sequence entries, part 317. 4230. gbpri318.seq - Primate sequence entries, part 318. 4231. gbpri319.seq - Primate sequence entries, part 319. 4232. gbpri32.seq - Primate sequence entries, part 32. 4233. gbpri320.seq - Primate sequence entries, part 320. 4234. gbpri321.seq - Primate sequence entries, part 321. 4235. gbpri322.seq - Primate sequence entries, part 322. 4236. gbpri323.seq - Primate sequence entries, part 323. 4237. gbpri324.seq - Primate sequence entries, part 324. 4238. gbpri325.seq - Primate sequence entries, part 325. 4239. gbpri326.seq - Primate sequence entries, part 326. 4240. gbpri327.seq - Primate sequence entries, part 327. 4241. gbpri328.seq - Primate sequence entries, part 328. 4242. gbpri329.seq - Primate sequence entries, part 329. 4243. gbpri33.seq - Primate sequence entries, part 33. 4244. gbpri330.seq - Primate sequence entries, part 330. 4245. gbpri331.seq - Primate sequence entries, part 331. 4246. gbpri332.seq - Primate sequence entries, part 332. 4247. gbpri333.seq - Primate sequence entries, part 333. 4248. gbpri334.seq - Primate sequence entries, part 334. 4249. gbpri335.seq - Primate sequence entries, part 335. 4250. gbpri336.seq - Primate sequence entries, part 336. 4251. gbpri337.seq - Primate sequence entries, part 337. 4252. gbpri338.seq - Primate sequence entries, part 338. 4253. gbpri339.seq - Primate sequence entries, part 339. 4254. gbpri34.seq - Primate sequence entries, part 34. 4255. gbpri340.seq - Primate sequence entries, part 340. 4256. gbpri341.seq - Primate sequence entries, part 341. 4257. gbpri342.seq - Primate sequence entries, part 342. 4258. gbpri343.seq - Primate sequence entries, part 343. 4259. gbpri344.seq - Primate sequence entries, part 344. 4260. gbpri345.seq - Primate sequence entries, part 345. 4261. gbpri346.seq - Primate sequence entries, part 346. 4262. gbpri347.seq - Primate sequence entries, part 347. 4263. gbpri348.seq - Primate sequence entries, part 348. 4264. gbpri349.seq - Primate sequence entries, part 349. 4265. gbpri35.seq - Primate sequence entries, part 35. 4266. gbpri350.seq - Primate sequence entries, part 350. 4267. gbpri351.seq - Primate sequence entries, part 351. 4268. gbpri352.seq - Primate sequence entries, part 352. 4269. gbpri353.seq - Primate sequence entries, part 353. 4270. gbpri354.seq - Primate sequence entries, part 354. 4271. gbpri355.seq - Primate sequence entries, part 355. 4272. gbpri356.seq - Primate sequence entries, part 356. 4273. gbpri357.seq - Primate sequence entries, part 357. 4274. gbpri358.seq - Primate sequence entries, part 358. 4275. gbpri359.seq - Primate sequence entries, part 359. 4276. gbpri36.seq - Primate sequence entries, part 36. 4277. gbpri360.seq - Primate sequence entries, part 360. 4278. gbpri361.seq - Primate sequence entries, part 361. 4279. gbpri362.seq - Primate sequence entries, part 362. 4280. gbpri363.seq - Primate sequence entries, part 363. 4281. gbpri364.seq - Primate sequence entries, part 364. 4282. gbpri365.seq - Primate sequence entries, part 365. 4283. gbpri366.seq - Primate sequence entries, part 366. 4284. gbpri367.seq - Primate sequence entries, part 367. 4285. gbpri368.seq - Primate sequence entries, part 368. 4286. gbpri369.seq - Primate sequence entries, part 369. 4287. gbpri37.seq - Primate sequence entries, part 37. 4288. gbpri370.seq - Primate sequence entries, part 370. 4289. gbpri371.seq - Primate sequence entries, part 371. 4290. gbpri372.seq - Primate sequence entries, part 372. 4291. gbpri373.seq - Primate sequence entries, part 373. 4292. gbpri374.seq - Primate sequence entries, part 374. 4293. gbpri375.seq - Primate sequence entries, part 375. 4294. gbpri376.seq - Primate sequence entries, part 376. 4295. gbpri377.seq - Primate sequence entries, part 377. 4296. gbpri378.seq - Primate sequence entries, part 378. 4297. gbpri379.seq - Primate sequence entries, part 379. 4298. gbpri38.seq - Primate sequence entries, part 38. 4299. gbpri380.seq - Primate sequence entries, part 380. 4300. gbpri381.seq - Primate sequence entries, part 381. 4301. gbpri382.seq - Primate sequence entries, part 382. 4302. gbpri383.seq - Primate sequence entries, part 383. 4303. gbpri384.seq - Primate sequence entries, part 384. 4304. gbpri385.seq - Primate sequence entries, part 385. 4305. gbpri386.seq - Primate sequence entries, part 386. 4306. gbpri387.seq - Primate sequence entries, part 387. 4307. gbpri388.seq - Primate sequence entries, part 388. 4308. gbpri389.seq - Primate sequence entries, part 389. 4309. gbpri39.seq - Primate sequence entries, part 39. 4310. gbpri390.seq - Primate sequence entries, part 390. 4311. gbpri391.seq - Primate sequence entries, part 391. 4312. gbpri392.seq - Primate sequence entries, part 392. 4313. gbpri393.seq - Primate sequence entries, part 393. 4314. gbpri394.seq - Primate sequence entries, part 394. 4315. gbpri395.seq - Primate sequence entries, part 395. 4316. gbpri396.seq - Primate sequence entries, part 396. 4317. gbpri397.seq - Primate sequence entries, part 397. 4318. gbpri398.seq - Primate sequence entries, part 398. 4319. gbpri399.seq - Primate sequence entries, part 399. 4320. gbpri4.seq - Primate sequence entries, part 4. 4321. gbpri40.seq - Primate sequence entries, part 40. 4322. gbpri400.seq - Primate sequence entries, part 400. 4323. gbpri401.seq - Primate sequence entries, part 401. 4324. gbpri402.seq - Primate sequence entries, part 402. 4325. gbpri403.seq - Primate sequence entries, part 403. 4326. gbpri404.seq - Primate sequence entries, part 404. 4327. gbpri405.seq - Primate sequence entries, part 405. 4328. gbpri406.seq - Primate sequence entries, part 406. 4329. gbpri407.seq - Primate sequence entries, part 407. 4330. gbpri408.seq - Primate sequence entries, part 408. 4331. gbpri409.seq - Primate sequence entries, part 409. 4332. gbpri41.seq - Primate sequence entries, part 41. 4333. gbpri410.seq - Primate sequence entries, part 410. 4334. gbpri411.seq - Primate sequence entries, part 411. 4335. gbpri412.seq - Primate sequence entries, part 412. 4336. gbpri413.seq - Primate sequence entries, part 413. 4337. gbpri414.seq - Primate sequence entries, part 414. 4338. gbpri415.seq - Primate sequence entries, part 415. 4339. gbpri416.seq - Primate sequence entries, part 416. 4340. gbpri417.seq - Primate sequence entries, part 417. 4341. gbpri418.seq - Primate sequence entries, part 418. 4342. gbpri419.seq - Primate sequence entries, part 419. 4343. gbpri42.seq - Primate sequence entries, part 42. 4344. gbpri420.seq - Primate sequence entries, part 420. 4345. gbpri421.seq - Primate sequence entries, part 421. 4346. gbpri422.seq - Primate sequence entries, part 422. 4347. gbpri423.seq - Primate sequence entries, part 423. 4348. gbpri424.seq - Primate sequence entries, part 424. 4349. gbpri425.seq - Primate sequence entries, part 425. 4350. gbpri426.seq - Primate sequence entries, part 426. 4351. gbpri427.seq - Primate sequence entries, part 427. 4352. gbpri428.seq - Primate sequence entries, part 428. 4353. gbpri429.seq - Primate sequence entries, part 429. 4354. gbpri43.seq - Primate sequence entries, part 43. 4355. gbpri430.seq - Primate sequence entries, part 430. 4356. gbpri431.seq - Primate sequence entries, part 431. 4357. gbpri432.seq - Primate sequence entries, part 432. 4358. gbpri433.seq - Primate sequence entries, part 433. 4359. gbpri434.seq - Primate sequence entries, part 434. 4360. gbpri435.seq - Primate sequence entries, part 435. 4361. gbpri436.seq - Primate sequence entries, part 436. 4362. gbpri437.seq - Primate sequence entries, part 437. 4363. gbpri438.seq - Primate sequence entries, part 438. 4364. gbpri439.seq - Primate sequence entries, part 439. 4365. gbpri44.seq - Primate sequence entries, part 44. 4366. gbpri440.seq - Primate sequence entries, part 440. 4367. gbpri441.seq - Primate sequence entries, part 441. 4368. gbpri442.seq - Primate sequence entries, part 442. 4369. gbpri443.seq - Primate sequence entries, part 443. 4370. gbpri444.seq - Primate sequence entries, part 444. 4371. gbpri445.seq - Primate sequence entries, part 445. 4372. gbpri446.seq - Primate sequence entries, part 446. 4373. gbpri447.seq - Primate sequence entries, part 447. 4374. gbpri448.seq - Primate sequence entries, part 448. 4375. gbpri449.seq - Primate sequence entries, part 449. 4376. gbpri45.seq - Primate sequence entries, part 45. 4377. gbpri450.seq - Primate sequence entries, part 450. 4378. gbpri451.seq - Primate sequence entries, part 451. 4379. gbpri452.seq - Primate sequence entries, part 452. 4380. gbpri453.seq - Primate sequence entries, part 453. 4381. gbpri454.seq - Primate sequence entries, part 454. 4382. gbpri455.seq - Primate sequence entries, part 455. 4383. gbpri456.seq - Primate sequence entries, part 456. 4384. gbpri457.seq - Primate sequence entries, part 457. 4385. gbpri458.seq - Primate sequence entries, part 458. 4386. gbpri459.seq - Primate sequence entries, part 459. 4387. gbpri46.seq - Primate sequence entries, part 46. 4388. gbpri460.seq - Primate sequence entries, part 460. 4389. gbpri461.seq - Primate sequence entries, part 461. 4390. gbpri462.seq - Primate sequence entries, part 462. 4391. gbpri463.seq - Primate sequence entries, part 463. 4392. gbpri464.seq - Primate sequence entries, part 464. 4393. gbpri465.seq - Primate sequence entries, part 465. 4394. gbpri466.seq - Primate sequence entries, part 466. 4395. gbpri467.seq - Primate sequence entries, part 467. 4396. gbpri468.seq - Primate sequence entries, part 468. 4397. gbpri469.seq - Primate sequence entries, part 469. 4398. gbpri47.seq - Primate sequence entries, part 47. 4399. gbpri470.seq - Primate sequence entries, part 470. 4400. gbpri471.seq - Primate sequence entries, part 471. 4401. gbpri472.seq - Primate sequence entries, part 472. 4402. gbpri473.seq - Primate sequence entries, part 473. 4403. gbpri474.seq - Primate sequence entries, part 474. 4404. gbpri475.seq - Primate sequence entries, part 475. 4405. gbpri476.seq - Primate sequence entries, part 476. 4406. gbpri477.seq - Primate sequence entries, part 477. 4407. gbpri478.seq - Primate sequence entries, part 478. 4408. gbpri479.seq - Primate sequence entries, part 479. 4409. gbpri48.seq - Primate sequence entries, part 48. 4410. gbpri480.seq - Primate sequence entries, part 480. 4411. gbpri481.seq - Primate sequence entries, part 481. 4412. gbpri482.seq - Primate sequence entries, part 482. 4413. gbpri483.seq - Primate sequence entries, part 483. 4414. gbpri484.seq - Primate sequence entries, part 484. 4415. gbpri485.seq - Primate sequence entries, part 485. 4416. gbpri486.seq - Primate sequence entries, part 486. 4417. gbpri487.seq - Primate sequence entries, part 487. 4418. gbpri488.seq - Primate sequence entries, part 488. 4419. gbpri489.seq - Primate sequence entries, part 489. 4420. gbpri49.seq - Primate sequence entries, part 49. 4421. gbpri490.seq - Primate sequence entries, part 490. 4422. gbpri491.seq - Primate sequence entries, part 491. 4423. gbpri492.seq - Primate sequence entries, part 492. 4424. gbpri493.seq - Primate sequence entries, part 493. 4425. gbpri494.seq - Primate sequence entries, part 494. 4426. gbpri495.seq - Primate sequence entries, part 495. 4427. gbpri496.seq - Primate sequence entries, part 496. 4428. gbpri497.seq - Primate sequence entries, part 497. 4429. gbpri498.seq - Primate sequence entries, part 498. 4430. gbpri499.seq - Primate sequence entries, part 499. 4431. gbpri5.seq - Primate sequence entries, part 5. 4432. gbpri50.seq - Primate sequence entries, part 50. 4433. gbpri500.seq - Primate sequence entries, part 500. 4434. gbpri501.seq - Primate sequence entries, part 501. 4435. gbpri502.seq - Primate sequence entries, part 502. 4436. gbpri503.seq - Primate sequence entries, part 503. 4437. gbpri504.seq - Primate sequence entries, part 504. 4438. gbpri505.seq - Primate sequence entries, part 505. 4439. gbpri506.seq - Primate sequence entries, part 506. 4440. gbpri507.seq - Primate sequence entries, part 507. 4441. gbpri508.seq - Primate sequence entries, part 508. 4442. gbpri509.seq - Primate sequence entries, part 509. 4443. gbpri51.seq - Primate sequence entries, part 51. 4444. gbpri510.seq - Primate sequence entries, part 510. 4445. gbpri511.seq - Primate sequence entries, part 511. 4446. gbpri512.seq - Primate sequence entries, part 512. 4447. gbpri513.seq - Primate sequence entries, part 513. 4448. gbpri514.seq - Primate sequence entries, part 514. 4449. gbpri515.seq - Primate sequence entries, part 515. 4450. gbpri516.seq - Primate sequence entries, part 516. 4451. gbpri517.seq - Primate sequence entries, part 517. 4452. gbpri518.seq - Primate sequence entries, part 518. 4453. gbpri519.seq - Primate sequence entries, part 519. 4454. gbpri52.seq - Primate sequence entries, part 52. 4455. gbpri520.seq - Primate sequence entries, part 520. 4456. gbpri521.seq - Primate sequence entries, part 521. 4457. gbpri522.seq - Primate sequence entries, part 522. 4458. gbpri523.seq - Primate sequence entries, part 523. 4459. gbpri524.seq - Primate sequence entries, part 524. 4460. gbpri525.seq - Primate sequence entries, part 525. 4461. gbpri526.seq - Primate sequence entries, part 526. 4462. gbpri527.seq - Primate sequence entries, part 527. 4463. gbpri528.seq - Primate sequence entries, part 528. 4464. gbpri529.seq - Primate sequence entries, part 529. 4465. gbpri53.seq - Primate sequence entries, part 53. 4466. gbpri530.seq - Primate sequence entries, part 530. 4467. gbpri531.seq - Primate sequence entries, part 531. 4468. gbpri532.seq - Primate sequence entries, part 532. 4469. gbpri533.seq - Primate sequence entries, part 533. 4470. gbpri534.seq - Primate sequence entries, part 534. 4471. gbpri535.seq - Primate sequence entries, part 535. 4472. gbpri536.seq - Primate sequence entries, part 536. 4473. gbpri537.seq - Primate sequence entries, part 537. 4474. gbpri538.seq - Primate sequence entries, part 538. 4475. gbpri539.seq - Primate sequence entries, part 539. 4476. gbpri54.seq - Primate sequence entries, part 54. 4477. gbpri540.seq - Primate sequence entries, part 540. 4478. gbpri541.seq - Primate sequence entries, part 541. 4479. gbpri542.seq - Primate sequence entries, part 542. 4480. gbpri543.seq - Primate sequence entries, part 543. 4481. gbpri544.seq - Primate sequence entries, part 544. 4482. gbpri545.seq - Primate sequence entries, part 545. 4483. gbpri546.seq - Primate sequence entries, part 546. 4484. gbpri547.seq - Primate sequence entries, part 547. 4485. gbpri548.seq - Primate sequence entries, part 548. 4486. gbpri549.seq - Primate sequence entries, part 549. 4487. gbpri55.seq - Primate sequence entries, part 55. 4488. gbpri550.seq - Primate sequence entries, part 550. 4489. gbpri551.seq - Primate sequence entries, part 551. 4490. gbpri552.seq - Primate sequence entries, part 552. 4491. gbpri553.seq - Primate sequence entries, part 553. 4492. gbpri554.seq - Primate sequence entries, part 554. 4493. gbpri555.seq - Primate sequence entries, part 555. 4494. gbpri556.seq - Primate sequence entries, part 556. 4495. gbpri557.seq - Primate sequence entries, part 557. 4496. gbpri558.seq - Primate sequence entries, part 558. 4497. gbpri559.seq - Primate sequence entries, part 559. 4498. gbpri56.seq - Primate sequence entries, part 56. 4499. gbpri560.seq - Primate sequence entries, part 560. 4500. gbpri561.seq - Primate sequence entries, part 561. 4501. gbpri562.seq - Primate sequence entries, part 562. 4502. gbpri563.seq - Primate sequence entries, part 563. 4503. gbpri564.seq - Primate sequence entries, part 564. 4504. gbpri565.seq - Primate sequence entries, part 565. 4505. gbpri566.seq - Primate sequence entries, part 566. 4506. gbpri567.seq - Primate sequence entries, part 567. 4507. gbpri568.seq - Primate sequence entries, part 568. 4508. gbpri569.seq - Primate sequence entries, part 569. 4509. gbpri57.seq - Primate sequence entries, part 57. 4510. gbpri570.seq - Primate sequence entries, part 570. 4511. gbpri571.seq - Primate sequence entries, part 571. 4512. gbpri572.seq - Primate sequence entries, part 572. 4513. gbpri573.seq - Primate sequence entries, part 573. 4514. gbpri574.seq - Primate sequence entries, part 574. 4515. gbpri575.seq - Primate sequence entries, part 575. 4516. gbpri576.seq - Primate sequence entries, part 576. 4517. gbpri577.seq - Primate sequence entries, part 577. 4518. gbpri578.seq - Primate sequence entries, part 578. 4519. gbpri579.seq - Primate sequence entries, part 579. 4520. gbpri58.seq - Primate sequence entries, part 58. 4521. gbpri580.seq - Primate sequence entries, part 580. 4522. gbpri581.seq - Primate sequence entries, part 581. 4523. gbpri582.seq - Primate sequence entries, part 582. 4524. gbpri583.seq - Primate sequence entries, part 583. 4525. gbpri584.seq - Primate sequence entries, part 584. 4526. gbpri585.seq - Primate sequence entries, part 585. 4527. gbpri586.seq - Primate sequence entries, part 586. 4528. gbpri587.seq - Primate sequence entries, part 587. 4529. gbpri588.seq - Primate sequence entries, part 588. 4530. gbpri589.seq - Primate sequence entries, part 589. 4531. gbpri59.seq - Primate sequence entries, part 59. 4532. gbpri590.seq - Primate sequence entries, part 590. 4533. gbpri591.seq - Primate sequence entries, part 591. 4534. gbpri592.seq - Primate sequence entries, part 592. 4535. gbpri593.seq - Primate sequence entries, part 593. 4536. gbpri594.seq - Primate sequence entries, part 594. 4537. gbpri595.seq - Primate sequence entries, part 595. 4538. gbpri596.seq - Primate sequence entries, part 596. 4539. gbpri597.seq - Primate sequence entries, part 597. 4540. gbpri598.seq - Primate sequence entries, part 598. 4541. gbpri599.seq - Primate sequence entries, part 599. 4542. gbpri6.seq - Primate sequence entries, part 6. 4543. gbpri60.seq - Primate sequence entries, part 60. 4544. gbpri600.seq - Primate sequence entries, part 600. 4545. gbpri601.seq - Primate sequence entries, part 601. 4546. gbpri602.seq - Primate sequence entries, part 602. 4547. gbpri603.seq - Primate sequence entries, part 603. 4548. gbpri604.seq - Primate sequence entries, part 604. 4549. gbpri605.seq - Primate sequence entries, part 605. 4550. gbpri606.seq - Primate sequence entries, part 606. 4551. gbpri607.seq - Primate sequence entries, part 607. 4552. gbpri608.seq - Primate sequence entries, part 608. 4553. gbpri609.seq - Primate sequence entries, part 609. 4554. gbpri61.seq - Primate sequence entries, part 61. 4555. gbpri610.seq - Primate sequence entries, part 610. 4556. gbpri611.seq - Primate sequence entries, part 611. 4557. gbpri612.seq - Primate sequence entries, part 612. 4558. gbpri613.seq - Primate sequence entries, part 613. 4559. gbpri614.seq - Primate sequence entries, part 614. 4560. gbpri615.seq - Primate sequence entries, part 615. 4561. gbpri616.seq - Primate sequence entries, part 616. 4562. gbpri617.seq - Primate sequence entries, part 617. 4563. gbpri618.seq - Primate sequence entries, part 618. 4564. gbpri619.seq - Primate sequence entries, part 619. 4565. gbpri62.seq - Primate sequence entries, part 62. 4566. gbpri620.seq - Primate sequence entries, part 620. 4567. gbpri621.seq - Primate sequence entries, part 621. 4568. gbpri622.seq - Primate sequence entries, part 622. 4569. gbpri623.seq - Primate sequence entries, part 623. 4570. gbpri624.seq - Primate sequence entries, part 624. 4571. gbpri625.seq - Primate sequence entries, part 625. 4572. gbpri626.seq - Primate sequence entries, part 626. 4573. gbpri627.seq - Primate sequence entries, part 627. 4574. gbpri628.seq - Primate sequence entries, part 628. 4575. gbpri629.seq - Primate sequence entries, part 629. 4576. gbpri63.seq - Primate sequence entries, part 63. 4577. gbpri630.seq - Primate sequence entries, part 630. 4578. gbpri631.seq - Primate sequence entries, part 631. 4579. gbpri632.seq - Primate sequence entries, part 632. 4580. gbpri633.seq - Primate sequence entries, part 633. 4581. gbpri634.seq - Primate sequence entries, part 634. 4582. gbpri635.seq - Primate sequence entries, part 635. 4583. gbpri636.seq - Primate sequence entries, part 636. 4584. gbpri637.seq - Primate sequence entries, part 637. 4585. gbpri638.seq - Primate sequence entries, part 638. 4586. gbpri639.seq - Primate sequence entries, part 639. 4587. gbpri64.seq - Primate sequence entries, part 64. 4588. gbpri640.seq - Primate sequence entries, part 640. 4589. gbpri641.seq - Primate sequence entries, part 641. 4590. gbpri642.seq - Primate sequence entries, part 642. 4591. gbpri643.seq - Primate sequence entries, part 643. 4592. gbpri644.seq - Primate sequence entries, part 644. 4593. gbpri645.seq - Primate sequence entries, part 645. 4594. gbpri646.seq - Primate sequence entries, part 646. 4595. gbpri647.seq - Primate sequence entries, part 647. 4596. gbpri648.seq - Primate sequence entries, part 648. 4597. gbpri649.seq - Primate sequence entries, part 649. 4598. gbpri65.seq - Primate sequence entries, part 65. 4599. gbpri650.seq - Primate sequence entries, part 650. 4600. gbpri651.seq - Primate sequence entries, part 651. 4601. gbpri652.seq - Primate sequence entries, part 652. 4602. gbpri653.seq - Primate sequence entries, part 653. 4603. gbpri654.seq - Primate sequence entries, part 654. 4604. gbpri655.seq - Primate sequence entries, part 655. 4605. gbpri656.seq - Primate sequence entries, part 656. 4606. gbpri657.seq - Primate sequence entries, part 657. 4607. gbpri658.seq - Primate sequence entries, part 658. 4608. gbpri659.seq - Primate sequence entries, part 659. 4609. gbpri66.seq - Primate sequence entries, part 66. 4610. gbpri660.seq - Primate sequence entries, part 660. 4611. gbpri661.seq - Primate sequence entries, part 661. 4612. gbpri662.seq - Primate sequence entries, part 662. 4613. gbpri663.seq - Primate sequence entries, part 663. 4614. gbpri664.seq - Primate sequence entries, part 664. 4615. gbpri665.seq - Primate sequence entries, part 665. 4616. gbpri666.seq - Primate sequence entries, part 666. 4617. gbpri667.seq - Primate sequence entries, part 667. 4618. gbpri668.seq - Primate sequence entries, part 668. 4619. gbpri669.seq - Primate sequence entries, part 669. 4620. gbpri67.seq - Primate sequence entries, part 67. 4621. gbpri670.seq - Primate sequence entries, part 670. 4622. gbpri671.seq - Primate sequence entries, part 671. 4623. gbpri672.seq - Primate sequence entries, part 672. 4624. gbpri673.seq - Primate sequence entries, part 673. 4625. gbpri674.seq - Primate sequence entries, part 674. 4626. gbpri675.seq - Primate sequence entries, part 675. 4627. gbpri676.seq - Primate sequence entries, part 676. 4628. gbpri677.seq - Primate sequence entries, part 677. 4629. gbpri678.seq - Primate sequence entries, part 678. 4630. gbpri68.seq - Primate sequence entries, part 68. 4631. gbpri69.seq - Primate sequence entries, part 69. 4632. gbpri7.seq - Primate sequence entries, part 7. 4633. gbpri70.seq - Primate sequence entries, part 70. 4634. gbpri71.seq - Primate sequence entries, part 71. 4635. gbpri72.seq - Primate sequence entries, part 72. 4636. gbpri73.seq - Primate sequence entries, part 73. 4637. gbpri74.seq - Primate sequence entries, part 74. 4638. gbpri75.seq - Primate sequence entries, part 75. 4639. gbpri76.seq - Primate sequence entries, part 76. 4640. gbpri77.seq - Primate sequence entries, part 77. 4641. gbpri78.seq - Primate sequence entries, part 78. 4642. gbpri79.seq - Primate sequence entries, part 79. 4643. gbpri8.seq - Primate sequence entries, part 8. 4644. gbpri80.seq - Primate sequence entries, part 80. 4645. gbpri81.seq - Primate sequence entries, part 81. 4646. gbpri82.seq - Primate sequence entries, part 82. 4647. gbpri83.seq - Primate sequence entries, part 83. 4648. gbpri84.seq - Primate sequence entries, part 84. 4649. gbpri85.seq - Primate sequence entries, part 85. 4650. gbpri86.seq - Primate sequence entries, part 86. 4651. gbpri87.seq - Primate sequence entries, part 87. 4652. gbpri88.seq - Primate sequence entries, part 88. 4653. gbpri89.seq - Primate sequence entries, part 89. 4654. gbpri9.seq - Primate sequence entries, part 9. 4655. gbpri90.seq - Primate sequence entries, part 90. 4656. gbpri91.seq - Primate sequence entries, part 91. 4657. gbpri92.seq - Primate sequence entries, part 92. 4658. gbpri93.seq - Primate sequence entries, part 93. 4659. gbpri94.seq - Primate sequence entries, part 94. 4660. gbpri95.seq - Primate sequence entries, part 95. 4661. gbpri96.seq - Primate sequence entries, part 96. 4662. gbpri97.seq - Primate sequence entries, part 97. 4663. gbpri98.seq - Primate sequence entries, part 98. 4664. gbpri99.seq - Primate sequence entries, part 99. 4665. gbrel.txt - Release notes (this document). 4666. gbrod1.seq - Rodent sequence entries, part 1. 4667. gbrod10.seq - Rodent sequence entries, part 10. 4668. gbrod100.seq - Rodent sequence entries, part 100. 4669. gbrod101.seq - Rodent sequence entries, part 101. 4670. gbrod102.seq - Rodent sequence entries, part 102. 4671. gbrod103.seq - Rodent sequence entries, part 103. 4672. gbrod104.seq - Rodent sequence entries, part 104. 4673. gbrod105.seq - Rodent sequence entries, part 105. 4674. gbrod106.seq - Rodent sequence entries, part 106. 4675. gbrod107.seq - Rodent sequence entries, part 107. 4676. gbrod108.seq - Rodent sequence entries, part 108. 4677. gbrod109.seq - Rodent sequence entries, part 109. 4678. gbrod11.seq - Rodent sequence entries, part 11. 4679. gbrod110.seq - Rodent sequence entries, part 110. 4680. gbrod111.seq - Rodent sequence entries, part 111. 4681. gbrod112.seq - Rodent sequence entries, part 112. 4682. gbrod113.seq - Rodent sequence entries, part 113. 4683. gbrod114.seq - Rodent sequence entries, part 114. 4684. gbrod115.seq - Rodent sequence entries, part 115. 4685. gbrod12.seq - Rodent sequence entries, part 12. 4686. gbrod13.seq - Rodent sequence entries, part 13. 4687. gbrod14.seq - Rodent sequence entries, part 14. 4688. gbrod15.seq - Rodent sequence entries, part 15. 4689. gbrod16.seq - Rodent sequence entries, part 16. 4690. gbrod17.seq - Rodent sequence entries, part 17. 4691. gbrod18.seq - Rodent sequence entries, part 18. 4692. gbrod19.seq - Rodent sequence entries, part 19. 4693. gbrod2.seq - Rodent sequence entries, part 2. 4694. gbrod20.seq - Rodent sequence entries, part 20. 4695. gbrod21.seq - Rodent sequence entries, part 21. 4696. gbrod22.seq - Rodent sequence entries, part 22. 4697. gbrod23.seq - Rodent sequence entries, part 23. 4698. gbrod24.seq - Rodent sequence entries, part 24. 4699. gbrod25.seq - Rodent sequence entries, part 25. 4700. gbrod26.seq - Rodent sequence entries, part 26. 4701. gbrod27.seq - Rodent sequence entries, part 27. 4702. gbrod28.seq - Rodent sequence entries, part 28. 4703. gbrod29.seq - Rodent sequence entries, part 29. 4704. gbrod3.seq - Rodent sequence entries, part 3. 4705. gbrod30.seq - Rodent sequence entries, part 30. 4706. gbrod31.seq - Rodent sequence entries, part 31. 4707. gbrod32.seq - Rodent sequence entries, part 32. 4708. gbrod33.seq - Rodent sequence entries, part 33. 4709. gbrod34.seq - Rodent sequence entries, part 34. 4710. gbrod35.seq - Rodent sequence entries, part 35. 4711. gbrod36.seq - Rodent sequence entries, part 36. 4712. gbrod37.seq - Rodent sequence entries, part 37. 4713. gbrod38.seq - Rodent sequence entries, part 38. 4714. gbrod39.seq - Rodent sequence entries, part 39. 4715. gbrod4.seq - Rodent sequence entries, part 4. 4716. gbrod40.seq - Rodent sequence entries, part 40. 4717. gbrod41.seq - Rodent sequence entries, part 41. 4718. gbrod42.seq - Rodent sequence entries, part 42. 4719. gbrod43.seq - Rodent sequence entries, part 43. 4720. gbrod44.seq - Rodent sequence entries, part 44. 4721. gbrod45.seq - Rodent sequence entries, part 45. 4722. gbrod46.seq - Rodent sequence entries, part 46. 4723. gbrod47.seq - Rodent sequence entries, part 47. 4724. gbrod48.seq - Rodent sequence entries, part 48. 4725. gbrod49.seq - Rodent sequence entries, part 49. 4726. gbrod5.seq - Rodent sequence entries, part 5. 4727. gbrod50.seq - Rodent sequence entries, part 50. 4728. gbrod51.seq - Rodent sequence entries, part 51. 4729. gbrod52.seq - Rodent sequence entries, part 52. 4730. gbrod53.seq - Rodent sequence entries, part 53. 4731. gbrod54.seq - Rodent sequence entries, part 54. 4732. gbrod55.seq - Rodent sequence entries, part 55. 4733. gbrod56.seq - Rodent sequence entries, part 56. 4734. gbrod57.seq - Rodent sequence entries, part 57. 4735. gbrod58.seq - Rodent sequence entries, part 58. 4736. gbrod59.seq - Rodent sequence entries, part 59. 4737. gbrod6.seq - Rodent sequence entries, part 6. 4738. gbrod60.seq - Rodent sequence entries, part 60. 4739. gbrod61.seq - Rodent sequence entries, part 61. 4740. gbrod62.seq - Rodent sequence entries, part 62. 4741. gbrod63.seq - Rodent sequence entries, part 63. 4742. gbrod64.seq - Rodent sequence entries, part 64. 4743. gbrod65.seq - Rodent sequence entries, part 65. 4744. gbrod66.seq - Rodent sequence entries, part 66. 4745. gbrod67.seq - Rodent sequence entries, part 67. 4746. gbrod68.seq - Rodent sequence entries, part 68. 4747. gbrod69.seq - Rodent sequence entries, part 69. 4748. gbrod7.seq - Rodent sequence entries, part 7. 4749. gbrod70.seq - Rodent sequence entries, part 70. 4750. gbrod71.seq - Rodent sequence entries, part 71. 4751. gbrod72.seq - Rodent sequence entries, part 72. 4752. gbrod73.seq - Rodent sequence entries, part 73. 4753. gbrod74.seq - Rodent sequence entries, part 74. 4754. gbrod75.seq - Rodent sequence entries, part 75. 4755. gbrod76.seq - Rodent sequence entries, part 76. 4756. gbrod77.seq - Rodent sequence entries, part 77. 4757. gbrod78.seq - Rodent sequence entries, part 78. 4758. gbrod79.seq - Rodent sequence entries, part 79. 4759. gbrod8.seq - Rodent sequence entries, part 8. 4760. gbrod80.seq - Rodent sequence entries, part 80. 4761. gbrod81.seq - Rodent sequence entries, part 81. 4762. gbrod82.seq - Rodent sequence entries, part 82. 4763. gbrod83.seq - Rodent sequence entries, part 83. 4764. gbrod84.seq - Rodent sequence entries, part 84. 4765. gbrod85.seq - Rodent sequence entries, part 85. 4766. gbrod86.seq - Rodent sequence entries, part 86. 4767. gbrod87.seq - Rodent sequence entries, part 87. 4768. gbrod88.seq - Rodent sequence entries, part 88. 4769. gbrod89.seq - Rodent sequence entries, part 89. 4770. gbrod9.seq - Rodent sequence entries, part 9. 4771. gbrod90.seq - Rodent sequence entries, part 90. 4772. gbrod91.seq - Rodent sequence entries, part 91. 4773. gbrod92.seq - Rodent sequence entries, part 92. 4774. gbrod93.seq - Rodent sequence entries, part 93. 4775. gbrod94.seq - Rodent sequence entries, part 94. 4776. gbrod95.seq - Rodent sequence entries, part 95. 4777. gbrod96.seq - Rodent sequence entries, part 96. 4778. gbrod97.seq - Rodent sequence entries, part 97. 4779. gbrod98.seq - Rodent sequence entries, part 98. 4780. gbrod99.seq - Rodent sequence entries, part 99. 4781. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1. 4782. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2. 4783. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3. 4784. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1. 4785. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2. 4786. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3. 4787. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4. 4788. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5. 4789. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6. 4790. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7. 4791. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8. 4792. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9. 4793. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1. 4794. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10. 4795. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11. 4796. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12. 4797. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13. 4798. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14. 4799. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15. 4800. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16. 4801. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17. 4802. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18. 4803. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19. 4804. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2. 4805. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20. 4806. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21. 4807. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22. 4808. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23. 4809. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24. 4810. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25. 4811. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26. 4812. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27. 4813. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28. 4814. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29. 4815. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3. 4816. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30. 4817. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31. 4818. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32. 4819. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33. 4820. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34. 4821. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35. 4822. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36. 4823. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37. 4824. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4. 4825. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5. 4826. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6. 4827. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7. 4828. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8. 4829. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9. 4830. gbuna1.seq - Unannotated sequence entries, part 1. 4831. gbvrl1.seq - Viral sequence entries, part 1. 4832. gbvrl10.seq - Viral sequence entries, part 10. 4833. gbvrl100.seq - Viral sequence entries, part 100. 4834. gbvrl101.seq - Viral sequence entries, part 101. 4835. gbvrl102.seq - Viral sequence entries, part 102. 4836. gbvrl103.seq - Viral sequence entries, part 103. 4837. gbvrl104.seq - Viral sequence entries, part 104. 4838. gbvrl105.seq - Viral sequence entries, part 105. 4839. gbvrl106.seq - Viral sequence entries, part 106. 4840. gbvrl107.seq - Viral sequence entries, part 107. 4841. gbvrl108.seq - Viral sequence entries, part 108. 4842. gbvrl109.seq - Viral sequence entries, part 109. 4843. gbvrl11.seq - Viral sequence entries, part 11. 4844. gbvrl110.seq - Viral sequence entries, part 110. 4845. gbvrl111.seq - Viral sequence entries, part 111. 4846. gbvrl112.seq - Viral sequence entries, part 112. 4847. gbvrl113.seq - Viral sequence entries, part 113. 4848. gbvrl114.seq - Viral sequence entries, part 114. 4849. gbvrl115.seq - Viral sequence entries, part 115. 4850. gbvrl116.seq - Viral sequence entries, part 116. 4851. gbvrl117.seq - Viral sequence entries, part 117. 4852. gbvrl118.seq - Viral sequence entries, part 118. 4853. gbvrl119.seq - Viral sequence entries, part 119. 4854. gbvrl12.seq - Viral sequence entries, part 12. 4855. gbvrl120.seq - Viral sequence entries, part 120. 4856. gbvrl121.seq - Viral sequence entries, part 121. 4857. gbvrl122.seq - Viral sequence entries, part 122. 4858. gbvrl123.seq - Viral sequence entries, part 123. 4859. gbvrl124.seq - Viral sequence entries, part 124. 4860. gbvrl125.seq - Viral sequence entries, part 125. 4861. gbvrl126.seq - Viral sequence entries, part 126. 4862. gbvrl127.seq - Viral sequence entries, part 127. 4863. gbvrl128.seq - Viral sequence entries, part 128. 4864. gbvrl129.seq - Viral sequence entries, part 129. 4865. gbvrl13.seq - Viral sequence entries, part 13. 4866. gbvrl130.seq - Viral sequence entries, part 130. 4867. gbvrl131.seq - Viral sequence entries, part 131. 4868. gbvrl132.seq - Viral sequence entries, part 132. 4869. gbvrl133.seq - Viral sequence entries, part 133. 4870. gbvrl134.seq - Viral sequence entries, part 134. 4871. gbvrl135.seq - Viral sequence entries, part 135. 4872. gbvrl136.seq - Viral sequence entries, part 136. 4873. gbvrl137.seq - Viral sequence entries, part 137. 4874. gbvrl138.seq - Viral sequence entries, part 138. 4875. gbvrl139.seq - Viral sequence entries, part 139. 4876. gbvrl14.seq - Viral sequence entries, part 14. 4877. gbvrl140.seq - Viral sequence entries, part 140. 4878. gbvrl141.seq - Viral sequence entries, part 141. 4879. gbvrl142.seq - Viral sequence entries, part 142. 4880. gbvrl143.seq - Viral sequence entries, part 143. 4881. gbvrl144.seq - Viral sequence entries, part 144. 4882. gbvrl145.seq - Viral sequence entries, part 145. 4883. gbvrl146.seq - Viral sequence entries, part 146. 4884. gbvrl147.seq - Viral sequence entries, part 147. 4885. gbvrl148.seq - Viral sequence entries, part 148. 4886. gbvrl149.seq - Viral sequence entries, part 149. 4887. gbvrl15.seq - Viral sequence entries, part 15. 4888. gbvrl150.seq - Viral sequence entries, part 150. 4889. gbvrl151.seq - Viral sequence entries, part 151. 4890. gbvrl152.seq - Viral sequence entries, part 152. 4891. gbvrl153.seq - Viral sequence entries, part 153. 4892. gbvrl154.seq - Viral sequence entries, part 154. 4893. gbvrl155.seq - Viral sequence entries, part 155. 4894. gbvrl156.seq - Viral sequence entries, part 156. 4895. gbvrl157.seq - Viral sequence entries, part 157. 4896. gbvrl158.seq - Viral sequence entries, part 158. 4897. gbvrl159.seq - Viral sequence entries, part 159. 4898. gbvrl16.seq - Viral sequence entries, part 16. 4899. gbvrl160.seq - Viral sequence entries, part 160. 4900. gbvrl161.seq - Viral sequence entries, part 161. 4901. gbvrl162.seq - Viral sequence entries, part 162. 4902. gbvrl163.seq - Viral sequence entries, part 163. 4903. gbvrl164.seq - Viral sequence entries, part 164. 4904. gbvrl165.seq - Viral sequence entries, part 165. 4905. gbvrl166.seq - Viral sequence entries, part 166. 4906. gbvrl167.seq - Viral sequence entries, part 167. 4907. gbvrl168.seq - Viral sequence entries, part 168. 4908. gbvrl169.seq - Viral sequence entries, part 169. 4909. gbvrl17.seq - Viral sequence entries, part 17. 4910. gbvrl170.seq - Viral sequence entries, part 170. 4911. gbvrl171.seq - Viral sequence entries, part 171. 4912. gbvrl172.seq - Viral sequence entries, part 172. 4913. gbvrl173.seq - Viral sequence entries, part 173. 4914. gbvrl174.seq - Viral sequence entries, part 174. 4915. gbvrl175.seq - Viral sequence entries, part 175. 4916. gbvrl176.seq - Viral sequence entries, part 176. 4917. gbvrl177.seq - Viral sequence entries, part 177. 4918. gbvrl178.seq - Viral sequence entries, part 178. 4919. gbvrl179.seq - Viral sequence entries, part 179. 4920. gbvrl18.seq - Viral sequence entries, part 18. 4921. gbvrl180.seq - Viral sequence entries, part 180. 4922. gbvrl181.seq - Viral sequence entries, part 181. 4923. gbvrl182.seq - Viral sequence entries, part 182. 4924. gbvrl183.seq - Viral sequence entries, part 183. 4925. gbvrl184.seq - Viral sequence entries, part 184. 4926. gbvrl185.seq - Viral sequence entries, part 185. 4927. gbvrl186.seq - Viral sequence entries, part 186. 4928. gbvrl187.seq - Viral sequence entries, part 187. 4929. gbvrl188.seq - Viral sequence entries, part 188. 4930. gbvrl189.seq - Viral sequence entries, part 189. 4931. gbvrl19.seq - Viral sequence entries, part 19. 4932. gbvrl190.seq - Viral sequence entries, part 190. 4933. gbvrl191.seq - Viral sequence entries, part 191. 4934. gbvrl192.seq - Viral sequence entries, part 192. 4935. gbvrl193.seq - Viral sequence entries, part 193. 4936. gbvrl194.seq - Viral sequence entries, part 194. 4937. gbvrl195.seq - Viral sequence entries, part 195. 4938. gbvrl196.seq - Viral sequence entries, part 196. 4939. gbvrl197.seq - Viral sequence entries, part 197. 4940. gbvrl198.seq - Viral sequence entries, part 198. 4941. gbvrl199.seq - Viral sequence entries, part 199. 4942. gbvrl2.seq - Viral sequence entries, part 2. 4943. gbvrl20.seq - Viral sequence entries, part 20. 4944. gbvrl200.seq - Viral sequence entries, part 200. 4945. gbvrl201.seq - Viral sequence entries, part 201. 4946. gbvrl202.seq - Viral sequence entries, part 202. 4947. gbvrl203.seq - Viral sequence entries, part 203. 4948. gbvrl204.seq - Viral sequence entries, part 204. 4949. gbvrl205.seq - Viral sequence entries, part 205. 4950. gbvrl206.seq - Viral sequence entries, part 206. 4951. gbvrl207.seq - Viral sequence entries, part 207. 4952. gbvrl208.seq - Viral sequence entries, part 208. 4953. gbvrl209.seq - Viral sequence entries, part 209. 4954. gbvrl21.seq - Viral sequence entries, part 21. 4955. gbvrl210.seq - Viral sequence entries, part 210. 4956. gbvrl211.seq - Viral sequence entries, part 211. 4957. gbvrl212.seq - Viral sequence entries, part 212. 4958. gbvrl213.seq - Viral sequence entries, part 213. 4959. gbvrl214.seq - Viral sequence entries, part 214. 4960. gbvrl215.seq - Viral sequence entries, part 215. 4961. gbvrl216.seq - Viral sequence entries, part 216. 4962. gbvrl217.seq - Viral sequence entries, part 217. 4963. gbvrl218.seq - Viral sequence entries, part 218. 4964. gbvrl219.seq - Viral sequence entries, part 219. 4965. gbvrl22.seq - Viral sequence entries, part 22. 4966. gbvrl220.seq - Viral sequence entries, part 220. 4967. gbvrl221.seq - Viral sequence entries, part 221. 4968. gbvrl222.seq - Viral sequence entries, part 222. 4969. gbvrl223.seq - Viral sequence entries, part 223. 4970. gbvrl224.seq - Viral sequence entries, part 224. 4971. gbvrl225.seq - Viral sequence entries, part 225. 4972. gbvrl226.seq - Viral sequence entries, part 226. 4973. gbvrl227.seq - Viral sequence entries, part 227. 4974. gbvrl228.seq - Viral sequence entries, part 228. 4975. gbvrl229.seq - Viral sequence entries, part 229. 4976. gbvrl23.seq - Viral sequence entries, part 23. 4977. gbvrl230.seq - Viral sequence entries, part 230. 4978. gbvrl231.seq - Viral sequence entries, part 231. 4979. gbvrl232.seq - Viral sequence entries, part 232. 4980. gbvrl233.seq - Viral sequence entries, part 233. 4981. gbvrl234.seq - Viral sequence entries, part 234. 4982. gbvrl235.seq - Viral sequence entries, part 235. 4983. gbvrl236.seq - Viral sequence entries, part 236. 4984. gbvrl237.seq - Viral sequence entries, part 237. 4985. gbvrl238.seq - Viral sequence entries, part 238. 4986. gbvrl239.seq - Viral sequence entries, part 239. 4987. gbvrl24.seq - Viral sequence entries, part 24. 4988. gbvrl240.seq - Viral sequence entries, part 240. 4989. gbvrl241.seq - Viral sequence entries, part 241. 4990. gbvrl242.seq - Viral sequence entries, part 242. 4991. gbvrl243.seq - Viral sequence entries, part 243. 4992. gbvrl244.seq - Viral sequence entries, part 244. 4993. gbvrl245.seq - Viral sequence entries, part 245. 4994. gbvrl246.seq - Viral sequence entries, part 246. 4995. gbvrl247.seq - Viral sequence entries, part 247. 4996. gbvrl248.seq - Viral sequence entries, part 248. 4997. gbvrl249.seq - Viral sequence entries, part 249. 4998. gbvrl25.seq - Viral sequence entries, part 25. 4999. gbvrl250.seq - Viral sequence entries, part 250. 5000. gbvrl251.seq - Viral sequence entries, part 251. 5001. gbvrl252.seq - Viral sequence entries, part 252. 5002. gbvrl253.seq - Viral sequence entries, part 253. 5003. gbvrl254.seq - Viral sequence entries, part 254. 5004. gbvrl255.seq - Viral sequence entries, part 255. 5005. gbvrl256.seq - Viral sequence entries, part 256. 5006. gbvrl257.seq - Viral sequence entries, part 257. 5007. gbvrl258.seq - Viral sequence entries, part 258. 5008. gbvrl259.seq - Viral sequence entries, part 259. 5009. gbvrl26.seq - Viral sequence entries, part 26. 5010. gbvrl260.seq - Viral sequence entries, part 260. 5011. gbvrl261.seq - Viral sequence entries, part 261. 5012. gbvrl262.seq - Viral sequence entries, part 262. 5013. gbvrl263.seq - Viral sequence entries, part 263. 5014. gbvrl264.seq - Viral sequence entries, part 264. 5015. gbvrl265.seq - Viral sequence entries, part 265. 5016. gbvrl266.seq - Viral sequence entries, part 266. 5017. gbvrl267.seq - Viral sequence entries, part 267. 5018. gbvrl268.seq - Viral sequence entries, part 268. 5019. gbvrl269.seq - Viral sequence entries, part 269. 5020. gbvrl27.seq - Viral sequence entries, part 27. 5021. gbvrl270.seq - Viral sequence entries, part 270. 5022. gbvrl271.seq - Viral sequence entries, part 271. 5023. gbvrl272.seq - Viral sequence entries, part 272. 5024. gbvrl273.seq - Viral sequence entries, part 273. 5025. gbvrl274.seq - Viral sequence entries, part 274. 5026. gbvrl275.seq - Viral sequence entries, part 275. 5027. gbvrl276.seq - Viral sequence entries, part 276. 5028. gbvrl277.seq - Viral sequence entries, part 277. 5029. gbvrl278.seq - Viral sequence entries, part 278. 5030. gbvrl279.seq - Viral sequence entries, part 279. 5031. gbvrl28.seq - Viral sequence entries, part 28. 5032. gbvrl280.seq - Viral sequence entries, part 280. 5033. gbvrl281.seq - Viral sequence entries, part 281. 5034. gbvrl282.seq - Viral sequence entries, part 282. 5035. gbvrl283.seq - Viral sequence entries, part 283. 5036. gbvrl284.seq - Viral sequence entries, part 284. 5037. gbvrl285.seq - Viral sequence entries, part 285. 5038. gbvrl286.seq - Viral sequence entries, part 286. 5039. gbvrl287.seq - Viral sequence entries, part 287. 5040. gbvrl288.seq - Viral sequence entries, part 288. 5041. gbvrl289.seq - Viral sequence entries, part 289. 5042. gbvrl29.seq - Viral sequence entries, part 29. 5043. gbvrl290.seq - Viral sequence entries, part 290. 5044. gbvrl291.seq - Viral sequence entries, part 291. 5045. gbvrl292.seq - Viral sequence entries, part 292. 5046. gbvrl293.seq - Viral sequence entries, part 293. 5047. gbvrl294.seq - Viral sequence entries, part 294. 5048. gbvrl295.seq - Viral sequence entries, part 295. 5049. gbvrl296.seq - Viral sequence entries, part 296. 5050. gbvrl297.seq - Viral sequence entries, part 297. 5051. gbvrl298.seq - Viral sequence entries, part 298. 5052. gbvrl299.seq - Viral sequence entries, part 299. 5053. gbvrl3.seq - Viral sequence entries, part 3. 5054. gbvrl30.seq - Viral sequence entries, part 30. 5055. gbvrl300.seq - Viral sequence entries, part 300. 5056. gbvrl301.seq - Viral sequence entries, part 301. 5057. gbvrl302.seq - Viral sequence entries, part 302. 5058. gbvrl303.seq - Viral sequence entries, part 303. 5059. gbvrl304.seq - Viral sequence entries, part 304. 5060. gbvrl305.seq - Viral sequence entries, part 305. 5061. gbvrl306.seq - Viral sequence entries, part 306. 5062. gbvrl307.seq - Viral sequence entries, part 307. 5063. gbvrl308.seq - Viral sequence entries, part 308. 5064. gbvrl309.seq - Viral sequence entries, part 309. 5065. gbvrl31.seq - Viral sequence entries, part 31. 5066. gbvrl310.seq - Viral sequence entries, part 310. 5067. gbvrl311.seq - Viral sequence entries, part 311. 5068. gbvrl312.seq - Viral sequence entries, part 312. 5069. gbvrl313.seq - Viral sequence entries, part 313. 5070. gbvrl314.seq - Viral sequence entries, part 314. 5071. gbvrl315.seq - Viral sequence entries, part 315. 5072. gbvrl316.seq - Viral sequence entries, part 316. 5073. gbvrl317.seq - Viral sequence entries, part 317. 5074. gbvrl318.seq - Viral sequence entries, part 318. 5075. gbvrl319.seq - Viral sequence entries, part 319. 5076. gbvrl32.seq - Viral sequence entries, part 32. 5077. gbvrl320.seq - Viral sequence entries, part 320. 5078. gbvrl321.seq - Viral sequence entries, part 321. 5079. gbvrl322.seq - Viral sequence entries, part 322. 5080. gbvrl323.seq - Viral sequence entries, part 323. 5081. gbvrl324.seq - Viral sequence entries, part 324. 5082. gbvrl325.seq - Viral sequence entries, part 325. 5083. gbvrl326.seq - Viral sequence entries, part 326. 5084. gbvrl327.seq - Viral sequence entries, part 327. 5085. gbvrl328.seq - Viral sequence entries, part 328. 5086. gbvrl329.seq - Viral sequence entries, part 329. 5087. gbvrl33.seq - Viral sequence entries, part 33. 5088. gbvrl330.seq - Viral sequence entries, part 330. 5089. gbvrl331.seq - Viral sequence entries, part 331. 5090. gbvrl332.seq - Viral sequence entries, part 332. 5091. gbvrl333.seq - Viral sequence entries, part 333. 5092. gbvrl34.seq - Viral sequence entries, part 34. 5093. gbvrl35.seq - Viral sequence entries, part 35. 5094. gbvrl36.seq - Viral sequence entries, part 36. 5095. gbvrl37.seq - Viral sequence entries, part 37. 5096. gbvrl38.seq - Viral sequence entries, part 38. 5097. gbvrl39.seq - Viral sequence entries, part 39. 5098. gbvrl4.seq - Viral sequence entries, part 4. 5099. gbvrl40.seq - Viral sequence entries, part 40. 5100. gbvrl41.seq - Viral sequence entries, part 41. 5101. gbvrl42.seq - Viral sequence entries, part 42. 5102. gbvrl43.seq - Viral sequence entries, part 43. 5103. gbvrl44.seq - Viral sequence entries, part 44. 5104. gbvrl45.seq - Viral sequence entries, part 45. 5105. gbvrl46.seq - Viral sequence entries, part 46. 5106. gbvrl47.seq - Viral sequence entries, part 47. 5107. gbvrl48.seq - Viral sequence entries, part 48. 5108. gbvrl49.seq - Viral sequence entries, part 49. 5109. gbvrl5.seq - Viral sequence entries, part 5. 5110. gbvrl50.seq - Viral sequence entries, part 50. 5111. gbvrl51.seq - Viral sequence entries, part 51. 5112. gbvrl52.seq - Viral sequence entries, part 52. 5113. gbvrl53.seq - Viral sequence entries, part 53. 5114. gbvrl54.seq - Viral sequence entries, part 54. 5115. gbvrl55.seq - Viral sequence entries, part 55. 5116. gbvrl56.seq - Viral sequence entries, part 56. 5117. gbvrl57.seq - Viral sequence entries, part 57. 5118. gbvrl58.seq - Viral sequence entries, part 58. 5119. gbvrl59.seq - Viral sequence entries, part 59. 5120. gbvrl6.seq - Viral sequence entries, part 6. 5121. gbvrl60.seq - Viral sequence entries, part 60. 5122. gbvrl61.seq - Viral sequence entries, part 61. 5123. gbvrl62.seq - Viral sequence entries, part 62. 5124. gbvrl63.seq - Viral sequence entries, part 63. 5125. gbvrl64.seq - Viral sequence entries, part 64. 5126. gbvrl65.seq - Viral sequence entries, part 65. 5127. gbvrl66.seq - Viral sequence entries, part 66. 5128. gbvrl67.seq - Viral sequence entries, part 67. 5129. gbvrl68.seq - Viral sequence entries, part 68. 5130. gbvrl69.seq - Viral sequence entries, part 69. 5131. gbvrl7.seq - Viral sequence entries, part 7. 5132. gbvrl70.seq - Viral sequence entries, part 70. 5133. gbvrl71.seq - Viral sequence entries, part 71. 5134. gbvrl72.seq - Viral sequence entries, part 72. 5135. gbvrl73.seq - Viral sequence entries, part 73. 5136. gbvrl74.seq - Viral sequence entries, part 74. 5137. gbvrl75.seq - Viral sequence entries, part 75. 5138. gbvrl76.seq - Viral sequence entries, part 76. 5139. gbvrl77.seq - Viral sequence entries, part 77. 5140. gbvrl78.seq - Viral sequence entries, part 78. 5141. gbvrl79.seq - Viral sequence entries, part 79. 5142. gbvrl8.seq - Viral sequence entries, part 8. 5143. gbvrl80.seq - Viral sequence entries, part 80. 5144. gbvrl81.seq - Viral sequence entries, part 81. 5145. gbvrl82.seq - Viral sequence entries, part 82. 5146. gbvrl83.seq - Viral sequence entries, part 83. 5147. gbvrl84.seq - Viral sequence entries, part 84. 5148. gbvrl85.seq - Viral sequence entries, part 85. 5149. gbvrl86.seq - Viral sequence entries, part 86. 5150. gbvrl87.seq - Viral sequence entries, part 87. 5151. gbvrl88.seq - Viral sequence entries, part 88. 5152. gbvrl89.seq - Viral sequence entries, part 89. 5153. gbvrl9.seq - Viral sequence entries, part 9. 5154. gbvrl90.seq - Viral sequence entries, part 90. 5155. gbvrl91.seq - Viral sequence entries, part 91. 5156. gbvrl92.seq - Viral sequence entries, part 92. 5157. gbvrl93.seq - Viral sequence entries, part 93. 5158. gbvrl94.seq - Viral sequence entries, part 94. 5159. gbvrl95.seq - Viral sequence entries, part 95. 5160. gbvrl96.seq - Viral sequence entries, part 96. 5161. gbvrl97.seq - Viral sequence entries, part 97. 5162. gbvrl98.seq - Viral sequence entries, part 98. 5163. gbvrl99.seq - Viral sequence entries, part 99. 5164. gbvrt1.seq - Other vertebrate sequence entries, part 1. 5165. gbvrt10.seq - Other vertebrate sequence entries, part 10. 5166. gbvrt100.seq - Other vertebrate sequence entries, part 100. 5167. gbvrt101.seq - Other vertebrate sequence entries, part 101. 5168. gbvrt102.seq - Other vertebrate sequence entries, part 102. 5169. gbvrt103.seq - Other vertebrate sequence entries, part 103. 5170. gbvrt104.seq - Other vertebrate sequence entries, part 104. 5171. gbvrt105.seq - Other vertebrate sequence entries, part 105. 5172. gbvrt106.seq - Other vertebrate sequence entries, part 106. 5173. gbvrt107.seq - Other vertebrate sequence entries, part 107. 5174. gbvrt108.seq - Other vertebrate sequence entries, part 108. 5175. gbvrt109.seq - Other vertebrate sequence entries, part 109. 5176. gbvrt11.seq - Other vertebrate sequence entries, part 11. 5177. gbvrt110.seq - Other vertebrate sequence entries, part 110. 5178. gbvrt111.seq - Other vertebrate sequence entries, part 111. 5179. gbvrt112.seq - Other vertebrate sequence entries, part 112. 5180. gbvrt113.seq - Other vertebrate sequence entries, part 113. 5181. gbvrt114.seq - Other vertebrate sequence entries, part 114. 5182. gbvrt115.seq - Other vertebrate sequence entries, part 115. 5183. gbvrt116.seq - Other vertebrate sequence entries, part 116. 5184. gbvrt117.seq - Other vertebrate sequence entries, part 117. 5185. gbvrt118.seq - Other vertebrate sequence entries, part 118. 5186. gbvrt119.seq - Other vertebrate sequence entries, part 119. 5187. gbvrt12.seq - Other vertebrate sequence entries, part 12. 5188. gbvrt120.seq - Other vertebrate sequence entries, part 120. 5189. gbvrt121.seq - Other vertebrate sequence entries, part 121. 5190. gbvrt122.seq - Other vertebrate sequence entries, part 122. 5191. gbvrt123.seq - Other vertebrate sequence entries, part 123. 5192. gbvrt124.seq - Other vertebrate sequence entries, part 124. 5193. gbvrt125.seq - Other vertebrate sequence entries, part 125. 5194. gbvrt126.seq - Other vertebrate sequence entries, part 126. 5195. gbvrt127.seq - Other vertebrate sequence entries, part 127. 5196. gbvrt128.seq - Other vertebrate sequence entries, part 128. 5197. gbvrt129.seq - Other vertebrate sequence entries, part 129. 5198. gbvrt13.seq - Other vertebrate sequence entries, part 13. 5199. gbvrt130.seq - Other vertebrate sequence entries, part 130. 5200. gbvrt131.seq - Other vertebrate sequence entries, part 131. 5201. gbvrt132.seq - Other vertebrate sequence entries, part 132. 5202. gbvrt133.seq - Other vertebrate sequence entries, part 133. 5203. gbvrt134.seq - Other vertebrate sequence entries, part 134. 5204. gbvrt135.seq - Other vertebrate sequence entries, part 135. 5205. gbvrt136.seq - Other vertebrate sequence entries, part 136. 5206. gbvrt137.seq - Other vertebrate sequence entries, part 137. 5207. gbvrt138.seq - Other vertebrate sequence entries, part 138. 5208. gbvrt139.seq - Other vertebrate sequence entries, part 139. 5209. gbvrt14.seq - Other vertebrate sequence entries, part 14. 5210. gbvrt140.seq - Other vertebrate sequence entries, part 140. 5211. gbvrt141.seq - Other vertebrate sequence entries, part 141. 5212. gbvrt142.seq - Other vertebrate sequence entries, part 142. 5213. gbvrt143.seq - Other vertebrate sequence entries, part 143. 5214. gbvrt144.seq - Other vertebrate sequence entries, part 144. 5215. gbvrt145.seq - Other vertebrate sequence entries, part 145. 5216. gbvrt146.seq - Other vertebrate sequence entries, part 146. 5217. gbvrt147.seq - Other vertebrate sequence entries, part 147. 5218. gbvrt148.seq - Other vertebrate sequence entries, part 148. 5219. gbvrt149.seq - Other vertebrate sequence entries, part 149. 5220. gbvrt15.seq - Other vertebrate sequence entries, part 15. 5221. gbvrt150.seq - Other vertebrate sequence entries, part 150. 5222. gbvrt151.seq - Other vertebrate sequence entries, part 151. 5223. gbvrt152.seq - Other vertebrate sequence entries, part 152. 5224. gbvrt153.seq - Other vertebrate sequence entries, part 153. 5225. gbvrt154.seq - Other vertebrate sequence entries, part 154. 5226. gbvrt155.seq - Other vertebrate sequence entries, part 155. 5227. gbvrt156.seq - Other vertebrate sequence entries, part 156. 5228. gbvrt157.seq - Other vertebrate sequence entries, part 157. 5229. gbvrt158.seq - Other vertebrate sequence entries, part 158. 5230. gbvrt159.seq - Other vertebrate sequence entries, part 159. 5231. gbvrt16.seq - Other vertebrate sequence entries, part 16. 5232. gbvrt160.seq - Other vertebrate sequence entries, part 160. 5233. gbvrt161.seq - Other vertebrate sequence entries, part 161. 5234. gbvrt162.seq - Other vertebrate sequence entries, part 162. 5235. gbvrt163.seq - Other vertebrate sequence entries, part 163. 5236. gbvrt164.seq - Other vertebrate sequence entries, part 164. 5237. gbvrt165.seq - Other vertebrate sequence entries, part 165. 5238. gbvrt166.seq - Other vertebrate sequence entries, part 166. 5239. gbvrt167.seq - Other vertebrate sequence entries, part 167. 5240. gbvrt168.seq - Other vertebrate sequence entries, part 168. 5241. gbvrt169.seq - Other vertebrate sequence entries, part 169. 5242. gbvrt17.seq - Other vertebrate sequence entries, part 17. 5243. gbvrt170.seq - Other vertebrate sequence entries, part 170. 5244. gbvrt171.seq - Other vertebrate sequence entries, part 171. 5245. gbvrt172.seq - Other vertebrate sequence entries, part 172. 5246. gbvrt173.seq - Other vertebrate sequence entries, part 173. 5247. gbvrt174.seq - Other vertebrate sequence entries, part 174. 5248. gbvrt175.seq - Other vertebrate sequence entries, part 175. 5249. gbvrt176.seq - Other vertebrate sequence entries, part 176. 5250. gbvrt177.seq - Other vertebrate sequence entries, part 177. 5251. gbvrt178.seq - Other vertebrate sequence entries, part 178. 5252. gbvrt179.seq - Other vertebrate sequence entries, part 179. 5253. gbvrt18.seq - Other vertebrate sequence entries, part 18. 5254. gbvrt180.seq - Other vertebrate sequence entries, part 180. 5255. gbvrt181.seq - Other vertebrate sequence entries, part 181. 5256. gbvrt182.seq - Other vertebrate sequence entries, part 182. 5257. gbvrt183.seq - Other vertebrate sequence entries, part 183. 5258. gbvrt184.seq - Other vertebrate sequence entries, part 184. 5259. gbvrt185.seq - Other vertebrate sequence entries, part 185. 5260. gbvrt186.seq - Other vertebrate sequence entries, part 186. 5261. gbvrt187.seq - Other vertebrate sequence entries, part 187. 5262. gbvrt188.seq - Other vertebrate sequence entries, part 188. 5263. gbvrt189.seq - Other vertebrate sequence entries, part 189. 5264. gbvrt19.seq - Other vertebrate sequence entries, part 19. 5265. gbvrt190.seq - Other vertebrate sequence entries, part 190. 5266. gbvrt191.seq - Other vertebrate sequence entries, part 191. 5267. gbvrt192.seq - Other vertebrate sequence entries, part 192. 5268. gbvrt193.seq - Other vertebrate sequence entries, part 193. 5269. gbvrt194.seq - Other vertebrate sequence entries, part 194. 5270. gbvrt195.seq - Other vertebrate sequence entries, part 195. 5271. gbvrt196.seq - Other vertebrate sequence entries, part 196. 5272. gbvrt197.seq - Other vertebrate sequence entries, part 197. 5273. gbvrt198.seq - Other vertebrate sequence entries, part 198. 5274. gbvrt199.seq - Other vertebrate sequence entries, part 199. 5275. gbvrt2.seq - Other vertebrate sequence entries, part 2. 5276. gbvrt20.seq - Other vertebrate sequence entries, part 20. 5277. gbvrt200.seq - Other vertebrate sequence entries, part 200. 5278. gbvrt201.seq - Other vertebrate sequence entries, part 201. 5279. gbvrt202.seq - Other vertebrate sequence entries, part 202. 5280. gbvrt203.seq - Other vertebrate sequence entries, part 203. 5281. gbvrt204.seq - Other vertebrate sequence entries, part 204. 5282. gbvrt205.seq - Other vertebrate sequence entries, part 205. 5283. gbvrt206.seq - Other vertebrate sequence entries, part 206. 5284. gbvrt207.seq - Other vertebrate sequence entries, part 207. 5285. gbvrt208.seq - Other vertebrate sequence entries, part 208. 5286. gbvrt209.seq - Other vertebrate sequence entries, part 209. 5287. gbvrt21.seq - Other vertebrate sequence entries, part 21. 5288. gbvrt210.seq - Other vertebrate sequence entries, part 210. 5289. gbvrt211.seq - Other vertebrate sequence entries, part 211. 5290. gbvrt212.seq - Other vertebrate sequence entries, part 212. 5291. gbvrt213.seq - Other vertebrate sequence entries, part 213. 5292. gbvrt214.seq - Other vertebrate sequence entries, part 214. 5293. gbvrt215.seq - Other vertebrate sequence entries, part 215. 5294. gbvrt216.seq - Other vertebrate sequence entries, part 216. 5295. gbvrt217.seq - Other vertebrate sequence entries, part 217. 5296. gbvrt218.seq - Other vertebrate sequence entries, part 218. 5297. gbvrt219.seq - Other vertebrate sequence entries, part 219. 5298. gbvrt22.seq - Other vertebrate sequence entries, part 22. 5299. gbvrt220.seq - Other vertebrate sequence entries, part 220. 5300. gbvrt221.seq - Other vertebrate sequence entries, part 221. 5301. gbvrt222.seq - Other vertebrate sequence entries, part 222. 5302. gbvrt223.seq - Other vertebrate sequence entries, part 223. 5303. gbvrt224.seq - Other vertebrate sequence entries, part 224. 5304. gbvrt225.seq - Other vertebrate sequence entries, part 225. 5305. gbvrt226.seq - Other vertebrate sequence entries, part 226. 5306. gbvrt227.seq - Other vertebrate sequence entries, part 227. 5307. gbvrt228.seq - Other vertebrate sequence entries, part 228. 5308. gbvrt229.seq - Other vertebrate sequence entries, part 229. 5309. gbvrt23.seq - Other vertebrate sequence entries, part 23. 5310. gbvrt230.seq - Other vertebrate sequence entries, part 230. 5311. gbvrt231.seq - Other vertebrate sequence entries, part 231. 5312. gbvrt232.seq - Other vertebrate sequence entries, part 232. 5313. gbvrt233.seq - Other vertebrate sequence entries, part 233. 5314. gbvrt234.seq - Other vertebrate sequence entries, part 234. 5315. gbvrt235.seq - Other vertebrate sequence entries, part 235. 5316. gbvrt236.seq - Other vertebrate sequence entries, part 236. 5317. gbvrt237.seq - Other vertebrate sequence entries, part 237. 5318. gbvrt238.seq - Other vertebrate sequence entries, part 238. 5319. gbvrt239.seq - Other vertebrate sequence entries, part 239. 5320. gbvrt24.seq - Other vertebrate sequence entries, part 24. 5321. gbvrt240.seq - Other vertebrate sequence entries, part 240. 5322. gbvrt241.seq - Other vertebrate sequence entries, part 241. 5323. gbvrt242.seq - Other vertebrate sequence entries, part 242. 5324. gbvrt243.seq - Other vertebrate sequence entries, part 243. 5325. gbvrt244.seq - Other vertebrate sequence entries, part 244. 5326. gbvrt245.seq - Other vertebrate sequence entries, part 245. 5327. gbvrt246.seq - Other vertebrate sequence entries, part 246. 5328. gbvrt247.seq - Other vertebrate sequence entries, part 247. 5329. gbvrt248.seq - Other vertebrate sequence entries, part 248. 5330. gbvrt249.seq - Other vertebrate sequence entries, part 249. 5331. gbvrt25.seq - Other vertebrate sequence entries, part 25. 5332. gbvrt250.seq - Other vertebrate sequence entries, part 250. 5333. gbvrt251.seq - Other vertebrate sequence entries, part 251. 5334. gbvrt252.seq - Other vertebrate sequence entries, part 252. 5335. gbvrt253.seq - Other vertebrate sequence entries, part 253. 5336. gbvrt254.seq - Other vertebrate sequence entries, part 254. 5337. gbvrt255.seq - Other vertebrate sequence entries, part 255. 5338. gbvrt256.seq - Other vertebrate sequence entries, part 256. 5339. gbvrt257.seq - Other vertebrate sequence entries, part 257. 5340. gbvrt258.seq - Other vertebrate sequence entries, part 258. 5341. gbvrt259.seq - Other vertebrate sequence entries, part 259. 5342. gbvrt26.seq - Other vertebrate sequence entries, part 26. 5343. gbvrt260.seq - Other vertebrate sequence entries, part 260. 5344. gbvrt261.seq - Other vertebrate sequence entries, part 261. 5345. gbvrt262.seq - Other vertebrate sequence entries, part 262. 5346. gbvrt263.seq - Other vertebrate sequence entries, part 263. 5347. gbvrt264.seq - Other vertebrate sequence entries, part 264. 5348. gbvrt265.seq - Other vertebrate sequence entries, part 265. 5349. gbvrt266.seq - Other vertebrate sequence entries, part 266. 5350. gbvrt267.seq - Other vertebrate sequence entries, part 267. 5351. gbvrt268.seq - Other vertebrate sequence entries, part 268. 5352. gbvrt269.seq - Other vertebrate sequence entries, part 269. 5353. gbvrt27.seq - Other vertebrate sequence entries, part 27. 5354. gbvrt270.seq - Other vertebrate sequence entries, part 270. 5355. gbvrt271.seq - Other vertebrate sequence entries, part 271. 5356. gbvrt272.seq - Other vertebrate sequence entries, part 272. 5357. gbvrt273.seq - Other vertebrate sequence entries, part 273. 5358. gbvrt274.seq - Other vertebrate sequence entries, part 274. 5359. gbvrt275.seq - Other vertebrate sequence entries, part 275. 5360. gbvrt276.seq - Other vertebrate sequence entries, part 276. 5361. gbvrt277.seq - Other vertebrate sequence entries, part 277. 5362. gbvrt278.seq - Other vertebrate sequence entries, part 278. 5363. gbvrt279.seq - Other vertebrate sequence entries, part 279. 5364. gbvrt28.seq - Other vertebrate sequence entries, part 28. 5365. gbvrt280.seq - Other vertebrate sequence entries, part 280. 5366. gbvrt281.seq - Other vertebrate sequence entries, part 281. 5367. gbvrt282.seq - Other vertebrate sequence entries, part 282. 5368. gbvrt283.seq - Other vertebrate sequence entries, part 283. 5369. gbvrt284.seq - Other vertebrate sequence entries, part 284. 5370. gbvrt285.seq - Other vertebrate sequence entries, part 285. 5371. gbvrt286.seq - Other vertebrate sequence entries, part 286. 5372. gbvrt287.seq - Other vertebrate sequence entries, part 287. 5373. gbvrt288.seq - Other vertebrate sequence entries, part 288. 5374. gbvrt289.seq - Other vertebrate sequence entries, part 289. 5375. gbvrt29.seq - Other vertebrate sequence entries, part 29. 5376. gbvrt290.seq - Other vertebrate sequence entries, part 290. 5377. gbvrt291.seq - Other vertebrate sequence entries, part 291. 5378. gbvrt292.seq - Other vertebrate sequence entries, part 292. 5379. gbvrt293.seq - Other vertebrate sequence entries, part 293. 5380. gbvrt294.seq - Other vertebrate sequence entries, part 294. 5381. gbvrt295.seq - Other vertebrate sequence entries, part 295. 5382. gbvrt296.seq - Other vertebrate sequence entries, part 296. 5383. gbvrt297.seq - Other vertebrate sequence entries, part 297. 5384. gbvrt298.seq - Other vertebrate sequence entries, part 298. 5385. gbvrt299.seq - Other vertebrate sequence entries, part 299. 5386. gbvrt3.seq - Other vertebrate sequence entries, part 3. 5387. gbvrt30.seq - Other vertebrate sequence entries, part 30. 5388. gbvrt300.seq - Other vertebrate sequence entries, part 300. 5389. gbvrt301.seq - Other vertebrate sequence entries, part 301. 5390. gbvrt302.seq - Other vertebrate sequence entries, part 302. 5391. gbvrt303.seq - Other vertebrate sequence entries, part 303. 5392. gbvrt304.seq - Other vertebrate sequence entries, part 304. 5393. gbvrt305.seq - Other vertebrate sequence entries, part 305. 5394. gbvrt306.seq - Other vertebrate sequence entries, part 306. 5395. gbvrt307.seq - Other vertebrate sequence entries, part 307. 5396. gbvrt308.seq - Other vertebrate sequence entries, part 308. 5397. gbvrt309.seq - Other vertebrate sequence entries, part 309. 5398. gbvrt31.seq - Other vertebrate sequence entries, part 31. 5399. gbvrt310.seq - Other vertebrate sequence entries, part 310. 5400. gbvrt311.seq - Other vertebrate sequence entries, part 311. 5401. gbvrt312.seq - Other vertebrate sequence entries, part 312. 5402. gbvrt313.seq - Other vertebrate sequence entries, part 313. 5403. gbvrt314.seq - Other vertebrate sequence entries, part 314. 5404. gbvrt315.seq - Other vertebrate sequence entries, part 315. 5405. gbvrt316.seq - Other vertebrate sequence entries, part 316. 5406. gbvrt317.seq - Other vertebrate sequence entries, part 317. 5407. gbvrt32.seq - Other vertebrate sequence entries, part 32. 5408. gbvrt33.seq - Other vertebrate sequence entries, part 33. 5409. gbvrt34.seq - Other vertebrate sequence entries, part 34. 5410. gbvrt35.seq - Other vertebrate sequence entries, part 35. 5411. gbvrt36.seq - Other vertebrate sequence entries, part 36. 5412. gbvrt37.seq - Other vertebrate sequence entries, part 37. 5413. gbvrt38.seq - Other vertebrate sequence entries, part 38. 5414. gbvrt39.seq - Other vertebrate sequence entries, part 39. 5415. gbvrt4.seq - Other vertebrate sequence entries, part 4. 5416. gbvrt40.seq - Other vertebrate sequence entries, part 40. 5417. gbvrt41.seq - Other vertebrate sequence entries, part 41. 5418. gbvrt42.seq - Other vertebrate sequence entries, part 42. 5419. gbvrt43.seq - Other vertebrate sequence entries, part 43. 5420. gbvrt44.seq - Other vertebrate sequence entries, part 44. 5421. gbvrt45.seq - Other vertebrate sequence entries, part 45. 5422. gbvrt46.seq - Other vertebrate sequence entries, part 46. 5423. gbvrt47.seq - Other vertebrate sequence entries, part 47. 5424. gbvrt48.seq - Other vertebrate sequence entries, part 48. 5425. gbvrt49.seq - Other vertebrate sequence entries, part 49. 5426. gbvrt5.seq - Other vertebrate sequence entries, part 5. 5427. gbvrt50.seq - Other vertebrate sequence entries, part 50. 5428. gbvrt51.seq - Other vertebrate sequence entries, part 51. 5429. gbvrt52.seq - Other vertebrate sequence entries, part 52. 5430. gbvrt53.seq - Other vertebrate sequence entries, part 53. 5431. gbvrt54.seq - Other vertebrate sequence entries, part 54. 5432. gbvrt55.seq - Other vertebrate sequence entries, part 55. 5433. gbvrt56.seq - Other vertebrate sequence entries, part 56. 5434. gbvrt57.seq - Other vertebrate sequence entries, part 57. 5435. gbvrt58.seq - Other vertebrate sequence entries, part 58. 5436. gbvrt59.seq - Other vertebrate sequence entries, part 59. 5437. gbvrt6.seq - Other vertebrate sequence entries, part 6. 5438. gbvrt60.seq - Other vertebrate sequence entries, part 60. 5439. gbvrt61.seq - Other vertebrate sequence entries, part 61. 5440. gbvrt62.seq - Other vertebrate sequence entries, part 62. 5441. gbvrt63.seq - Other vertebrate sequence entries, part 63. 5442. gbvrt64.seq - Other vertebrate sequence entries, part 64. 5443. gbvrt65.seq - Other vertebrate sequence entries, part 65. 5444. gbvrt66.seq - Other vertebrate sequence entries, part 66. 5445. gbvrt67.seq - Other vertebrate sequence entries, part 67. 5446. gbvrt68.seq - Other vertebrate sequence entries, part 68. 5447. gbvrt69.seq - Other vertebrate sequence entries, part 69. 5448. gbvrt7.seq - Other vertebrate sequence entries, part 7. 5449. gbvrt70.seq - Other vertebrate sequence entries, part 70. 5450. gbvrt71.seq - Other vertebrate sequence entries, part 71. 5451. gbvrt72.seq - Other vertebrate sequence entries, part 72. 5452. gbvrt73.seq - Other vertebrate sequence entries, part 73. 5453. gbvrt74.seq - Other vertebrate sequence entries, part 74. 5454. gbvrt75.seq - Other vertebrate sequence entries, part 75. 5455. gbvrt76.seq - Other vertebrate sequence entries, part 76. 5456. gbvrt77.seq - Other vertebrate sequence entries, part 77. 5457. gbvrt78.seq - Other vertebrate sequence entries, part 78. 5458. gbvrt79.seq - Other vertebrate sequence entries, part 79. 5459. gbvrt8.seq - Other vertebrate sequence entries, part 8. 5460. gbvrt80.seq - Other vertebrate sequence entries, part 80. 5461. gbvrt81.seq - Other vertebrate sequence entries, part 81. 5462. gbvrt82.seq - Other vertebrate sequence entries, part 82. 5463. gbvrt83.seq - Other vertebrate sequence entries, part 83. 5464. gbvrt84.seq - Other vertebrate sequence entries, part 84. 5465. gbvrt85.seq - Other vertebrate sequence entries, part 85. 5466. gbvrt86.seq - Other vertebrate sequence entries, part 86. 5467. gbvrt87.seq - Other vertebrate sequence entries, part 87. 5468. gbvrt88.seq - Other vertebrate sequence entries, part 88. 5469. gbvrt89.seq - Other vertebrate sequence entries, part 89. 5470. gbvrt9.seq - Other vertebrate sequence entries, part 9. 5471. gbvrt90.seq - Other vertebrate sequence entries, part 90. 5472. gbvrt91.seq - Other vertebrate sequence entries, part 91. 5473. gbvrt92.seq - Other vertebrate sequence entries, part 92. 5474. gbvrt93.seq - Other vertebrate sequence entries, part 93. 5475. gbvrt94.seq - Other vertebrate sequence entries, part 94. 5476. gbvrt95.seq - Other vertebrate sequence entries, part 95. 5477. gbvrt96.seq - Other vertebrate sequence entries, part 96. 5478. gbvrt97.seq - Other vertebrate sequence entries, part 97. 5479. gbvrt98.seq - Other vertebrate sequence entries, part 98. 5480. gbvrt99.seq - Other vertebrate sequence entries, part 99. Sequences in the CON division data files (gbcon*.seq) are constructed from other "traditional" sequence records, and are represented in a unique way. CON records do not contain any sequence data; instead, they utilize a CONTIG linetype with a join() statement which describes how component sequences can be assembled to form the larger constructed sequence. Records in the CON division do not contribute to GenBank Release statistics (Sections 2.2.6, 2.2.7, and 2.2.8), or to the overall release statistics presented in the header of these release notes. The GenBank README describes the CON division of GenBank in more detail: ftp://ftp.ncbi.nih.gov/genbank/README.genbank 2.2.5 File Sizes Uncompressed, the Release 264.0 flatfiles require roughly 7452 GB, including the sequence files and the *.txt files. The following table contains the approximate sizes of the individual files in this release. Since minor changes to some of the files might have occurred after these release notes were written, these sizes should not be used to determine file integrity; they are provided as an aid to planning only. File Size File Name 1499991869 gbbct1.seq 1487790277 gbbct10.seq 1492393028 gbbct100.seq 1488981425 gbbct101.seq 1498668595 gbbct102.seq 1496122177 gbbct103.seq 1498363972 gbbct104.seq 1493888109 gbbct105.seq 1494831054 gbbct106.seq 1494723201 gbbct107.seq 1493870254 gbbct108.seq 1491653729 gbbct109.seq 1497575741 gbbct11.seq 1496432003 gbbct110.seq 1495645843 gbbct111.seq 1496660825 gbbct112.seq 1498767136 gbbct113.seq 1492707250 gbbct114.seq 1490532510 gbbct115.seq 1494346056 gbbct116.seq 1483124661 gbbct117.seq 1499797992 gbbct118.seq 1497221920 gbbct119.seq 1496301198 gbbct12.seq 1498594907 gbbct120.seq 1496393414 gbbct121.seq 1490797251 gbbct122.seq 1499596955 gbbct123.seq 1489935511 gbbct124.seq 1490160313 gbbct125.seq 1493957836 gbbct126.seq 1499601074 gbbct127.seq 1490209379 gbbct128.seq 1494014443 gbbct129.seq 1496572781 gbbct13.seq 1497250448 gbbct130.seq 1499626417 gbbct131.seq 1499409158 gbbct132.seq 1497301210 gbbct133.seq 1495903339 gbbct134.seq 1487372001 gbbct135.seq 1499462153 gbbct136.seq 1495049444 gbbct137.seq 1493799088 gbbct138.seq 1494219674 gbbct139.seq 1497338006 gbbct14.seq 1499269924 gbbct140.seq 1499591958 gbbct141.seq 1495375490 gbbct142.seq 1499161702 gbbct143.seq 1498571880 gbbct144.seq 1493598576 gbbct145.seq 1494420175 gbbct146.seq 1496759297 gbbct147.seq 1498244217 gbbct148.seq 1494304168 gbbct149.seq 1493015264 gbbct15.seq 1497347180 gbbct150.seq 1494746298 gbbct151.seq 1497992849 gbbct152.seq 1499985992 gbbct153.seq 1498438812 gbbct154.seq 1499680408 gbbct155.seq 1499784050 gbbct156.seq 1493822393 gbbct157.seq 1497383802 gbbct158.seq 1496884538 gbbct159.seq 1498158731 gbbct16.seq 1495972925 gbbct160.seq 1498329534 gbbct161.seq 1488046386 gbbct162.seq 1489886301 gbbct163.seq 1492271442 gbbct164.seq 1498407773 gbbct165.seq 1499133848 gbbct166.seq 1493474749 gbbct167.seq 1497454140 gbbct168.seq 1495827549 gbbct169.seq 1497678491 gbbct17.seq 1499950874 gbbct170.seq 1487314866 gbbct171.seq 1491772405 gbbct172.seq 1493771983 gbbct173.seq 1496815309 gbbct174.seq 1489149308 gbbct175.seq 1494711438 gbbct176.seq 1491237097 gbbct177.seq 1498666574 gbbct178.seq 1489977048 gbbct179.seq 1496651012 gbbct18.seq 1499823466 gbbct180.seq 1499274310 gbbct181.seq 1495487313 gbbct182.seq 1498906721 gbbct183.seq 1499740579 gbbct184.seq 1494865519 gbbct185.seq 1489314500 gbbct186.seq 1496885183 gbbct187.seq 1499765257 gbbct188.seq 1489871258 gbbct189.seq 1496055097 gbbct19.seq 1482586254 gbbct190.seq 1490104064 gbbct191.seq 1492006531 gbbct192.seq 1496066878 gbbct193.seq 1488330152 gbbct194.seq 1498886382 gbbct195.seq 1497272352 gbbct196.seq 1498656846 gbbct197.seq 1498457984 gbbct198.seq 1498317027 gbbct199.seq 1497192988 gbbct2.seq 1492331108 gbbct20.seq 1499993760 gbbct200.seq 1499922928 gbbct201.seq 1495566217 gbbct202.seq 1498464173 gbbct203.seq 1499763434 gbbct204.seq 1498716756 gbbct205.seq 1492828956 gbbct206.seq 1492837358 gbbct207.seq 1488126937 gbbct208.seq 1491024839 gbbct209.seq 1493205355 gbbct21.seq 1493981039 gbbct210.seq 1496298897 gbbct211.seq 1494118762 gbbct212.seq 1497056808 gbbct213.seq 1492195329 gbbct214.seq 1498710356 gbbct215.seq 1493127201 gbbct216.seq 1491931058 gbbct217.seq 1489158532 gbbct218.seq 1488964895 gbbct219.seq 1499606791 gbbct22.seq 1499719093 gbbct220.seq 1494545573 gbbct221.seq 1499611291 gbbct222.seq 1494834044 gbbct223.seq 1497964945 gbbct224.seq 1495531699 gbbct225.seq 1497465792 gbbct226.seq 1490431252 gbbct227.seq 1491740014 gbbct228.seq 1491437361 gbbct229.seq 1499939208 gbbct23.seq 1497357751 gbbct230.seq 1497233793 gbbct231.seq 1498771606 gbbct232.seq 1499662223 gbbct233.seq 1490340457 gbbct234.seq 1497741740 gbbct235.seq 1485250835 gbbct236.seq 1493398068 gbbct237.seq 1496853966 gbbct238.seq 1499017471 gbbct239.seq 1493173791 gbbct24.seq 1494293466 gbbct240.seq 1499117462 gbbct241.seq 1499234233 gbbct242.seq 1492022489 gbbct243.seq 1494418348 gbbct244.seq 1489912155 gbbct245.seq 1499971701 gbbct246.seq 1495405022 gbbct247.seq 1494874824 gbbct248.seq 1496658228 gbbct249.seq 1499825401 gbbct25.seq 1496788941 gbbct250.seq 1493626197 gbbct251.seq 1493659816 gbbct252.seq 1494512318 gbbct253.seq 1499975695 gbbct254.seq 1493782517 gbbct255.seq 1491840888 gbbct256.seq 1493973066 gbbct257.seq 1499081830 gbbct258.seq 1498143058 gbbct259.seq 1495850295 gbbct26.seq 1490785411 gbbct260.seq 1491155576 gbbct261.seq 1482170454 gbbct262.seq 1491592395 gbbct263.seq 1486348885 gbbct264.seq 1491471960 gbbct265.seq 1487836285 gbbct266.seq 1495360623 gbbct267.seq 1486694742 gbbct268.seq 1496956717 gbbct269.seq 1493414620 gbbct27.seq 1488524743 gbbct270.seq 1493951291 gbbct271.seq 1495568302 gbbct272.seq 1495010245 gbbct273.seq 1494312123 gbbct274.seq 1496261373 gbbct275.seq 1493503695 gbbct276.seq 1498291403 gbbct277.seq 1494715153 gbbct278.seq 1489444922 gbbct279.seq 1492345629 gbbct28.seq 1495633898 gbbct280.seq 1493443969 gbbct281.seq 1489644094 gbbct282.seq 1488866306 gbbct283.seq 1490292170 gbbct284.seq 1494750657 gbbct285.seq 1492795263 gbbct286.seq 1499115536 gbbct287.seq 1496530120 gbbct288.seq 1492094279 gbbct289.seq 1492990117 gbbct29.seq 1488840704 gbbct290.seq 1495436058 gbbct291.seq 1496510891 gbbct292.seq 1497576331 gbbct293.seq 1494271208 gbbct294.seq 1496947935 gbbct295.seq 1498984653 gbbct296.seq 1493566051 gbbct297.seq 1491310914 gbbct298.seq 1492085325 gbbct299.seq 1490889670 gbbct3.seq 1496433877 gbbct30.seq 1498139285 gbbct300.seq 1494638166 gbbct301.seq 1498690522 gbbct302.seq 1499854615 gbbct303.seq 1498847764 gbbct304.seq 1490649203 gbbct305.seq 1497399134 gbbct306.seq 1492409955 gbbct307.seq 1495695929 gbbct308.seq 1489047698 gbbct309.seq 1497698147 gbbct31.seq 1484341351 gbbct310.seq 1497478820 gbbct311.seq 1497754857 gbbct312.seq 1499982593 gbbct313.seq 1498155647 gbbct314.seq 1490201411 gbbct315.seq 1492923771 gbbct316.seq 1496342014 gbbct317.seq 1490947165 gbbct318.seq 1484074225 gbbct319.seq 1497048963 gbbct32.seq 1488062910 gbbct320.seq 1495767709 gbbct321.seq 1498256914 gbbct322.seq 1498644204 gbbct323.seq 1494418095 gbbct324.seq 1498705000 gbbct325.seq 1494232125 gbbct326.seq 1495693908 gbbct327.seq 1495504064 gbbct328.seq 1493787463 gbbct329.seq 1499368729 gbbct33.seq 1490712979 gbbct330.seq 1495293726 gbbct331.seq 1496584890 gbbct332.seq 1498598047 gbbct333.seq 1496789195 gbbct334.seq 1490701054 gbbct335.seq 1498041883 gbbct336.seq 1495231071 gbbct337.seq 1498425949 gbbct338.seq 1499817770 gbbct339.seq 1495540250 gbbct34.seq 1493143288 gbbct340.seq 1485008741 gbbct341.seq 1496749706 gbbct342.seq 1496228541 gbbct343.seq 1494074950 gbbct344.seq 1497259121 gbbct345.seq 1498816516 gbbct346.seq 1491647493 gbbct347.seq 1492208170 gbbct348.seq 1499303142 gbbct349.seq 1489770768 gbbct35.seq 1490456542 gbbct350.seq 1496634495 gbbct351.seq 1497713161 gbbct352.seq 1491484705 gbbct353.seq 1499898136 gbbct354.seq 1497856384 gbbct355.seq 1488949961 gbbct356.seq 1485639848 gbbct357.seq 1486564453 gbbct358.seq 1489348853 gbbct359.seq 1491278462 gbbct36.seq 1488971100 gbbct360.seq 1498881992 gbbct361.seq 1496508042 gbbct362.seq 1499003000 gbbct363.seq 1493853866 gbbct364.seq 1490654098 gbbct365.seq 1496854427 gbbct366.seq 1491251887 gbbct367.seq 1498643261 gbbct368.seq 1493883510 gbbct369.seq 1491795876 gbbct37.seq 1495682121 gbbct370.seq 1498713095 gbbct371.seq 1497485858 gbbct372.seq 1490969894 gbbct373.seq 1494562426 gbbct374.seq 1497107788 gbbct375.seq 1498838978 gbbct376.seq 1498294675 gbbct377.seq 1497960343 gbbct378.seq 1498030964 gbbct379.seq 1497342266 gbbct38.seq 1499999197 gbbct380.seq 1499512846 gbbct381.seq 1498239711 gbbct382.seq 1499999555 gbbct383.seq 1499999637 gbbct384.seq 1499891832 gbbct385.seq 1494474965 gbbct386.seq 1491282957 gbbct387.seq 1487131972 gbbct388.seq 1496637270 gbbct389.seq 1499428856 gbbct39.seq 1494110580 gbbct390.seq 1497725628 gbbct391.seq 1497851769 gbbct392.seq 1499926507 gbbct393.seq 1498252460 gbbct394.seq 1499054700 gbbct395.seq 1496363173 gbbct396.seq 1499999147 gbbct397.seq 1499998756 gbbct398.seq 1499997243 gbbct399.seq 1482821060 gbbct4.seq 1493993204 gbbct40.seq 1495467826 gbbct400.seq 1494215576 gbbct401.seq 1492367099 gbbct402.seq 1490351662 gbbct403.seq 1495858380 gbbct404.seq 1489055856 gbbct405.seq 1496739126 gbbct406.seq 1499399261 gbbct407.seq 1496989097 gbbct408.seq 1499635011 gbbct409.seq 1493035406 gbbct41.seq 1499572426 gbbct410.seq 1498227185 gbbct411.seq 835421259 gbbct412.seq 1498544557 gbbct42.seq 1495406424 gbbct43.seq 1497798655 gbbct44.seq 1495516754 gbbct45.seq 1490164640 gbbct46.seq 1492307250 gbbct47.seq 1496739531 gbbct48.seq 1499181128 gbbct49.seq 1493306525 gbbct5.seq 1499650241 gbbct50.seq 1490857917 gbbct51.seq 1480039143 gbbct52.seq 1498919191 gbbct53.seq 1495404622 gbbct54.seq 1499600870 gbbct55.seq 1499959044 gbbct56.seq 1490730112 gbbct57.seq 1499517701 gbbct58.seq 1497143354 gbbct59.seq 1491759546 gbbct6.seq 1490343340 gbbct60.seq 1498640025 gbbct61.seq 1496244319 gbbct62.seq 1494818011 gbbct63.seq 1498899266 gbbct64.seq 1493123114 gbbct65.seq 1499701097 gbbct66.seq 1496529632 gbbct67.seq 1497915348 gbbct68.seq 1487616173 gbbct69.seq 1499264087 gbbct7.seq 1493748227 gbbct70.seq 1497470366 gbbct71.seq 1491537866 gbbct72.seq 1499879269 gbbct73.seq 1497956581 gbbct74.seq 1492336447 gbbct75.seq 1489801692 gbbct76.seq 1497044782 gbbct77.seq 1482294688 gbbct78.seq 1497825340 gbbct79.seq 1497380243 gbbct8.seq 1496691236 gbbct80.seq 1494505005 gbbct81.seq 1499918423 gbbct82.seq 1494562034 gbbct83.seq 1498983413 gbbct84.seq 1497144785 gbbct85.seq 1487327500 gbbct86.seq 1494960845 gbbct87.seq 1492018788 gbbct88.seq 1495757348 gbbct89.seq 1496114660 gbbct9.seq 1493352144 gbbct90.seq 1490290949 gbbct91.seq 1494169874 gbbct92.seq 1496289604 gbbct93.seq 1499049044 gbbct94.seq 1493033036 gbbct95.seq 1490985469 gbbct96.seq 1495464053 gbbct97.seq 1488756023 gbbct98.seq 1487689456 gbbct99.seq 579305 gbchg.txt 1499996382 gbcon1.seq 1499997618 gbcon10.seq 1499999887 gbcon11.seq 1499999912 gbcon12.seq 1499997942 gbcon13.seq 1499995775 gbcon14.seq 1499997987 gbcon15.seq 1499997192 gbcon16.seq 1499996790 gbcon17.seq 1499998552 gbcon18.seq 1499996927 gbcon19.seq 1496681544 gbcon2.seq 1499999038 gbcon20.seq 1499995313 gbcon21.seq 1499998381 gbcon22.seq 1499790794 gbcon23.seq 1499986050 gbcon24.seq 1499961101 gbcon25.seq 1499995819 gbcon26.seq 1500000221 gbcon27.seq 1499987365 gbcon28.seq 1499989090 gbcon29.seq 1499718267 gbcon3.seq 1499948457 gbcon30.seq 1499949545 gbcon31.seq 1499998681 gbcon32.seq 1499998800 gbcon33.seq 1499998461 gbcon34.seq 1499999198 gbcon35.seq 1499999164 gbcon36.seq 1499986308 gbcon37.seq 1499994733 gbcon38.seq 1499999935 gbcon39.seq 1495139491 gbcon4.seq 1499998118 gbcon40.seq 1499999093 gbcon41.seq 1499998738 gbcon42.seq 1499994863 gbcon43.seq 1499996641 gbcon44.seq 1499667850 gbcon45.seq 1499949602 gbcon46.seq 1499995208 gbcon47.seq 1499950785 gbcon48.seq 1499930858 gbcon49.seq 1492420851 gbcon5.seq 1499997998 gbcon50.seq 1499998963 gbcon51.seq 1499998144 gbcon52.seq 1499403418 gbcon53.seq 1499997195 gbcon54.seq 1500000248 gbcon55.seq 1499999661 gbcon56.seq 1499999440 gbcon57.seq 1499994242 gbcon58.seq 1500000026 gbcon59.seq 1498712135 gbcon6.seq 1499959306 gbcon60.seq 1499784389 gbcon61.seq 1500000171 gbcon62.seq 1499973621 gbcon63.seq 1499972253 gbcon64.seq 1499997073 gbcon65.seq 1499978307 gbcon66.seq 1499966228 gbcon67.seq 629519678 gbcon68.seq 1499998977 gbcon7.seq 1500000027 gbcon8.seq 1498975272 gbcon9.seq 194637 gbdel.txt 1491107451 gbenv1.seq 1499998897 gbenv10.seq 1499999849 gbenv11.seq 1499996070 gbenv12.seq 1499998364 gbenv13.seq 1499998245 gbenv14.seq 1499998306 gbenv15.seq 1499999676 gbenv16.seq 1500000149 gbenv17.seq 1499997787 gbenv18.seq 1499997979 gbenv19.seq 1494453274 gbenv2.seq 1500000181 gbenv20.seq 1500000084 gbenv21.seq 1499945537 gbenv22.seq 1499998836 gbenv23.seq 1498389651 gbenv24.seq 1496821654 gbenv25.seq 1499250109 gbenv26.seq 775109168 gbenv27.seq 1499379526 gbenv3.seq 1495722937 gbenv4.seq 1499999261 gbenv5.seq 1499998853 gbenv6.seq 1499999787 gbenv7.seq 1500000215 gbenv8.seq 1499997536 gbenv9.seq 1500000091 gbest1.seq 1499998152 gbest10.seq 1499997291 gbest100.seq 1500000103 gbest101.seq 1499999594 gbest102.seq 1499997467 gbest103.seq 1499997840 gbest104.seq 1499998267 gbest105.seq 1499998107 gbest106.seq 1499998396 gbest107.seq 1499997665 gbest108.seq 1499997812 gbest109.seq 1499998524 gbest11.seq 1499999458 gbest110.seq 1499997599 gbest111.seq 1499995462 gbest112.seq 1499996635 gbest113.seq 1499997639 gbest114.seq 1499999694 gbest115.seq 1499998775 gbest116.seq 1499999705 gbest117.seq 1499996132 gbest118.seq 1499999871 gbest119.seq 1499996962 gbest12.seq 1499999870 gbest120.seq 1499998346 gbest121.seq 1499997631 gbest122.seq 1499999170 gbest123.seq 1499998002 gbest124.seq 1499999171 gbest125.seq 1499999005 gbest126.seq 1499997406 gbest127.seq 1499998762 gbest128.seq 1499997198 gbest129.seq 1499995934 gbest13.seq 1500000011 gbest130.seq 1500000242 gbest131.seq 1499997096 gbest132.seq 1499999114 gbest133.seq 1499999011 gbest134.seq 1499996583 gbest135.seq 1499998638 gbest136.seq 1499998571 gbest137.seq 1499999486 gbest138.seq 1499996338 gbest139.seq 1499999082 gbest14.seq 1499996973 gbest140.seq 1499998742 gbest141.seq 1499998432 gbest142.seq 1499996336 gbest143.seq 1499999480 gbest144.seq 1499997085 gbest145.seq 1499997526 gbest146.seq 1499998928 gbest147.seq 1499997720 gbest148.seq 1499997618 gbest149.seq 1499999902 gbest15.seq 1499997613 gbest150.seq 1499998735 gbest151.seq 1500000225 gbest152.seq 1500000190 gbest153.seq 1499999886 gbest154.seq 1499998169 gbest155.seq 1499999642 gbest156.seq 1499997955 gbest157.seq 1499999604 gbest158.seq 1499997851 gbest159.seq 1499999473 gbest16.seq 1500000231 gbest160.seq 1499997940 gbest161.seq 1499999320 gbest162.seq 1499999816 gbest163.seq 513938848 gbest164.seq 1500000122 gbest17.seq 1499999232 gbest18.seq 1499995599 gbest19.seq 1499999413 gbest2.seq 1499999113 gbest20.seq 1499999457 gbest21.seq 1499997156 gbest22.seq 1499999372 gbest23.seq 1499999033 gbest24.seq 1499998834 gbest25.seq 1499996330 gbest26.seq 1499998686 gbest27.seq 1499999420 gbest28.seq 1499999838 gbest29.seq 1499999019 gbest3.seq 1499997491 gbest30.seq 1499999804 gbest31.seq 1499999202 gbest32.seq 1499998884 gbest33.seq 1499999744 gbest34.seq 1499999000 gbest35.seq 1499996804 gbest36.seq 1499998249 gbest37.seq 1499998473 gbest38.seq 1499998765 gbest39.seq 1499999796 gbest4.seq 1499998537 gbest40.seq 1499999479 gbest41.seq 1499998117 gbest42.seq 1499999309 gbest43.seq 1499998093 gbest44.seq 1499999434 gbest45.seq 1499998270 gbest46.seq 1499997718 gbest47.seq 1499997361 gbest48.seq 1499997685 gbest49.seq 1499998133 gbest5.seq 1499999407 gbest50.seq 1499999999 gbest51.seq 1500000147 gbest52.seq 1499998827 gbest53.seq 1499999978 gbest54.seq 1499998804 gbest55.seq 1499999669 gbest56.seq 1499999875 gbest57.seq 1499998623 gbest58.seq 1499998445 gbest59.seq 1499999751 gbest6.seq 1499998581 gbest60.seq 1499998748 gbest61.seq 1499998139 gbest62.seq 1499999233 gbest63.seq 1499997233 gbest64.seq 1500000082 gbest65.seq 1499999290 gbest66.seq 1499999411 gbest67.seq 1499998029 gbest68.seq 1499997478 gbest69.seq 1499999180 gbest7.seq 1499997469 gbest70.seq 1500000141 gbest71.seq 1499999476 gbest72.seq 1499998922 gbest73.seq 1499998459 gbest74.seq 1499997572 gbest75.seq 1499998656 gbest76.seq 1499998675 gbest77.seq 1499997712 gbest78.seq 1499999146 gbest79.seq 1499998463 gbest8.seq 1499999371 gbest80.seq 1499997380 gbest81.seq 1499996686 gbest82.seq 1499998137 gbest83.seq 1499996163 gbest84.seq 1499998782 gbest85.seq 1499999186 gbest86.seq 1500000172 gbest87.seq 1499997522 gbest88.seq 1499996945 gbest89.seq 1500000163 gbest9.seq 1499998776 gbest90.seq 1499997974 gbest91.seq 1499999394 gbest92.seq 1499999492 gbest93.seq 1499997148 gbest94.seq 1499998678 gbest95.seq 1499999178 gbest96.seq 1499997610 gbest97.seq 1499999622 gbest98.seq 1499999008 gbest99.seq 1499999166 gbgss1.seq 1499998511 gbgss10.seq 1499999568 gbgss11.seq 1499998818 gbgss12.seq 1499999883 gbgss13.seq 1499998269 gbgss14.seq 1499998459 gbgss15.seq 1500000237 gbgss16.seq 1499997776 gbgss17.seq 1499998560 gbgss18.seq 1499999998 gbgss19.seq 1499997825 gbgss2.seq 1500000044 gbgss20.seq 1499998104 gbgss21.seq 1499997068 gbgss22.seq 1499999725 gbgss23.seq 1499998729 gbgss24.seq 1499999493 gbgss25.seq 1499998431 gbgss26.seq 1499999661 gbgss27.seq 1499998373 gbgss28.seq 1499997959 gbgss29.seq 1499997910 gbgss3.seq 1499997863 gbgss30.seq 1499998246 gbgss31.seq 1499997366 gbgss32.seq 1499997630 gbgss33.seq 1499998304 gbgss34.seq 1499998850 gbgss35.seq 1499999698 gbgss36.seq 1499998783 gbgss37.seq 1499999628 gbgss38.seq 1499999407 gbgss39.seq 1499999260 gbgss4.seq 1499997914 gbgss40.seq 1500000023 gbgss41.seq 1499998339 gbgss42.seq 1499996728 gbgss43.seq 1499998719 gbgss44.seq 1499999664 gbgss45.seq 1499997017 gbgss46.seq 1499999591 gbgss47.seq 1499999531 gbgss48.seq 1499999400 gbgss49.seq 1500000208 gbgss5.seq 1499999169 gbgss50.seq 1499998816 gbgss51.seq 1499998950 gbgss52.seq 1499998428 gbgss53.seq 1499999313 gbgss54.seq 1499999996 gbgss55.seq 1499997362 gbgss56.seq 1499998142 gbgss57.seq 1500000113 gbgss58.seq 1499997561 gbgss59.seq 1499999706 gbgss6.seq 1499999621 gbgss60.seq 1499997128 gbgss61.seq 1499997510 gbgss62.seq 1499999315 gbgss63.seq 1499999588 gbgss64.seq 1499999592 gbgss65.seq 1500000076 gbgss66.seq 1499999693 gbgss67.seq 1499998782 gbgss68.seq 1499999340 gbgss69.seq 1499997198 gbgss7.seq 1499999957 gbgss70.seq 1499998897 gbgss71.seq 1499997628 gbgss72.seq 1499999926 gbgss73.seq 1499998457 gbgss74.seq 1499999127 gbgss75.seq 1499998738 gbgss76.seq 1500000103 gbgss77.seq 1500000256 gbgss78.seq 430264615 gbgss79.seq 1499997889 gbgss8.seq 1499999134 gbgss9.seq 1499996974 gbhtc1.seq 1499996282 gbhtc2.seq 487233644 gbhtc3.seq 1499970679 gbhtg1.seq 1499829019 gbhtg10.seq 1499872343 gbhtg11.seq 1499884544 gbhtg12.seq 1499861752 gbhtg13.seq 1499897929 gbhtg14.seq 1499835864 gbhtg15.seq 1499690417 gbhtg16.seq 1499782068 gbhtg17.seq 1499852511 gbhtg18.seq 1499876752 gbhtg19.seq 1499830411 gbhtg2.seq 1499945647 gbhtg20.seq 1499944231 gbhtg21.seq 1499853450 gbhtg22.seq 1499789537 gbhtg23.seq 1499904773 gbhtg24.seq 780495549 gbhtg25.seq 1499902231 gbhtg3.seq 1499865254 gbhtg4.seq 1499916236 gbhtg5.seq 1499781411 gbhtg6.seq 1499713912 gbhtg7.seq 1499983844 gbhtg8.seq 1499942611 gbhtg9.seq 1499999562 gbinv1.seq 1490190112 gbinv10.seq 1456781561 gbinv100.seq 1498717006 gbinv1000.se 1487994288 gbinv1001.se 1469308457 gbinv1002.se 1425481446 gbinv1003.se 1480826974 gbinv1004.se 1497284905 gbinv1005.se 1424397420 gbinv1006.se 1497510880 gbinv1007.se 1479959544 gbinv1008.se 1496934524 gbinv1009.se 1487918436 gbinv101.seq 1499563247 gbinv1010.se 1499862687 gbinv1011.se 1476819586 gbinv1012.se 1479922716 gbinv1013.se 1498249855 gbinv1014.se 1474219413 gbinv1015.se 1486564580 gbinv1016.se 1497936217 gbinv1017.se 1482863470 gbinv1018.se 1496481428 gbinv1019.se 1498003367 gbinv102.seq 1495804076 gbinv1020.se 1497704655 gbinv1021.se 1435297230 gbinv1022.se 1480297535 gbinv1023.se 1440549582 gbinv1024.se 1359602883 gbinv1025.se 1426066925 gbinv1026.se 1483939418 gbinv1027.se 1415029251 gbinv1028.se 1493129558 gbinv1029.se 1495227925 gbinv103.seq 1494873086 gbinv1030.se 1409542342 gbinv1031.se 1391285952 gbinv1032.se 1495951990 gbinv1033.se 1482188219 gbinv1034.se 1483778998 gbinv1035.se 1497789572 gbinv1036.se 1499207712 gbinv1037.se 1491922333 gbinv1038.se 1486301700 gbinv1039.se 1498961891 gbinv104.seq 1478759681 gbinv1040.se 1458747397 gbinv1041.se 1484045296 gbinv1042.se 1491144891 gbinv1043.se 1444006372 gbinv1044.se 1374242976 gbinv1045.se 1382612499 gbinv1046.se 1374417242 gbinv1047.se 1467511216 gbinv1048.se 1426475869 gbinv1049.se 1485607287 gbinv105.seq 1479962499 gbinv1050.se 1364248913 gbinv1051.se 1480009668 gbinv1052.se 1488611562 gbinv1053.se 1497586601 gbinv1054.se 1430173354 gbinv1055.se 1497408649 gbinv1056.se 1453700015 gbinv1057.se 1493769524 gbinv1058.se 1484381582 gbinv1059.se 1487531032 gbinv106.seq 1473900470 gbinv1060.se 1495262645 gbinv1061.se 1489066335 gbinv1062.se 1497506226 gbinv1063.se 1490095236 gbinv1064.se 1486653915 gbinv1065.se 1485592782 gbinv1066.se 1412205571 gbinv1067.se 1390832704 gbinv1068.se 1488087580 gbinv1069.se 1489229078 gbinv107.seq 1478129189 gbinv1070.se 1474974122 gbinv1071.se 1491109411 gbinv1072.se 1497459124 gbinv1073.se 1354374983 gbinv1074.se 1469722899 gbinv1075.se 1437653463 gbinv1076.se 1485028925 gbinv1077.se 1486963335 gbinv1078.se 1371059316 gbinv1079.se 1465838102 gbinv108.seq 1409654376 gbinv1080.se 1494928557 gbinv1081.se 996912719 gbinv1082.se 1486297182 gbinv109.seq 1434492519 gbinv11.seq 1499999319 gbinv110.seq 1499998287 gbinv111.seq 1499996548 gbinv112.seq 1499999172 gbinv113.seq 1499999178 gbinv114.seq 1499985921 gbinv115.seq 1500000212 gbinv116.seq 1499848342 gbinv117.seq 1499964754 gbinv118.seq 1499775522 gbinv119.seq 1431807980 gbinv12.seq 1499999408 gbinv120.seq 1499966819 gbinv121.seq 1499627632 gbinv122.seq 1499988035 gbinv123.seq 1499999430 gbinv124.seq 1499999486 gbinv125.seq 1499894870 gbinv126.seq 1500000208 gbinv127.seq 1499998228 gbinv128.seq 1499997002 gbinv129.seq 1454705177 gbinv13.seq 1500000083 gbinv130.seq 1494760767 gbinv131.seq 1329587549 gbinv132.seq 1355115367 gbinv133.seq 1494295272 gbinv134.seq 1490465909 gbinv135.seq 1493396208 gbinv136.seq 1474813193 gbinv137.seq 1362747974 gbinv138.seq 1488380318 gbinv139.seq 1321009833 gbinv14.seq 1493323723 gbinv140.seq 1498364387 gbinv141.seq 1485226037 gbinv142.seq 1486419544 gbinv143.seq 1488565082 gbinv144.seq 1406701259 gbinv145.seq 1491796589 gbinv146.seq 1464476152 gbinv147.seq 1494003799 gbinv148.seq 1398044186 gbinv149.seq 1483462462 gbinv15.seq 1484591726 gbinv150.seq 1490496973 gbinv151.seq 1350074646 gbinv152.seq 1469549148 gbinv153.seq 1489342596 gbinv154.seq 1469565358 gbinv155.seq 1491703639 gbinv156.seq 1497978109 gbinv157.seq 1475443766 gbinv158.seq 1493746945 gbinv159.seq 1496255136 gbinv16.seq 1486725769 gbinv160.seq 1474245370 gbinv161.seq 1490171823 gbinv162.seq 1415940595 gbinv163.seq 1476437097 gbinv164.seq 1492039285 gbinv165.seq 1486989889 gbinv166.seq 1391566748 gbinv167.seq 1497850731 gbinv168.seq 1486856363 gbinv169.seq 1463827178 gbinv17.seq 1473461745 gbinv170.seq 1457783743 gbinv171.seq 1432295701 gbinv172.seq 1476859107 gbinv173.seq 1478810991 gbinv174.seq 1470253222 gbinv175.seq 1449415343 gbinv176.seq 1496880191 gbinv177.seq 1456326631 gbinv178.seq 1430905253 gbinv179.seq 1488992096 gbinv18.seq 1347201702 gbinv180.seq 1495706167 gbinv181.seq 1491112830 gbinv182.seq 1441042971 gbinv183.seq 1497192059 gbinv184.seq 1392117025 gbinv185.seq 1413055833 gbinv186.seq 1478247791 gbinv187.seq 1499359194 gbinv188.seq 1444083953 gbinv189.seq 1468329157 gbinv19.seq 1433502188 gbinv190.seq 1491334103 gbinv191.seq 1499090744 gbinv192.seq 1474205648 gbinv193.seq 1352324854 gbinv194.seq 1452357984 gbinv195.seq 1326135021 gbinv196.seq 1474729500 gbinv197.seq 1479215552 gbinv198.seq 1491741492 gbinv199.seq 1484945562 gbinv2.seq 1448894932 gbinv20.seq 1393950408 gbinv200.seq 1494310694 gbinv201.seq 1498810799 gbinv202.seq 1468825102 gbinv203.seq 1475656757 gbinv204.seq 1491813915 gbinv205.seq 1481776571 gbinv206.seq 1483128844 gbinv207.seq 1347544723 gbinv208.seq 1493605679 gbinv209.seq 1481218227 gbinv21.seq 1483808360 gbinv210.seq 1442433573 gbinv211.seq 1483663747 gbinv212.seq 1495736706 gbinv213.seq 1253874201 gbinv214.seq 1494058793 gbinv215.seq 1373457953 gbinv216.seq 1456333883 gbinv217.seq 1484792520 gbinv218.seq 1251829555 gbinv219.seq 1498623648 gbinv22.seq 1496348692 gbinv220.seq 1357064376 gbinv221.seq 1414953531 gbinv222.seq 1400151225 gbinv223.seq 1466945524 gbinv224.seq 1478383808 gbinv225.seq 1496412220 gbinv226.seq 1467309158 gbinv227.seq 1487856483 gbinv228.seq 1487920343 gbinv229.seq 1499542591 gbinv23.seq 1489288989 gbinv230.seq 1487693141 gbinv231.seq 1288775238 gbinv232.seq 1382524196 gbinv233.seq 1357845048 gbinv234.seq 1486585874 gbinv235.seq 1486937267 gbinv236.seq 1488381993 gbinv237.seq 1476145037 gbinv238.seq 1438012610 gbinv239.seq 1497207676 gbinv24.seq 1477110064 gbinv240.seq 1498672461 gbinv241.seq 1473777568 gbinv242.seq 1462092039 gbinv243.seq 1333371159 gbinv244.seq 1385396260 gbinv245.seq 1369192781 gbinv246.seq 1499860066 gbinv247.seq 1475265022 gbinv248.seq 1425069576 gbinv249.seq 1471486214 gbinv25.seq 1420464715 gbinv250.seq 1495216681 gbinv251.seq 1455206750 gbinv252.seq 1472299211 gbinv253.seq 1493240415 gbinv254.seq 1438071355 gbinv255.seq 1352328131 gbinv256.seq 1481801525 gbinv257.seq 1417458943 gbinv258.seq 1498587547 gbinv259.seq 1476133992 gbinv26.seq 1474622826 gbinv260.seq 1469629928 gbinv261.seq 1389695051 gbinv262.seq 1454625956 gbinv263.seq 1473986511 gbinv264.seq 1492283405 gbinv265.seq 1463168127 gbinv266.seq 1391973732 gbinv267.seq 1456232875 gbinv268.seq 1437755108 gbinv269.seq 1476172668 gbinv27.seq 1492924934 gbinv270.seq 1325973548 gbinv271.seq 1499332945 gbinv272.seq 1445909632 gbinv273.seq 1495816197 gbinv274.seq 1443202585 gbinv275.seq 1480225589 gbinv276.seq 1442908071 gbinv277.seq 1478166345 gbinv278.seq 1489195348 gbinv279.seq 1471525090 gbinv28.seq 1480031166 gbinv280.seq 1499676154 gbinv281.seq 1485192064 gbinv282.seq 1372921321 gbinv283.seq 1416726958 gbinv284.seq 1447728294 gbinv285.seq 1439652819 gbinv286.seq 1442618626 gbinv287.seq 1426894153 gbinv288.seq 1447226340 gbinv289.seq 1490892049 gbinv29.seq 1487195331 gbinv290.seq 1483792235 gbinv291.seq 1490454343 gbinv292.seq 1383487701 gbinv293.seq 1488575579 gbinv294.seq 1495179183 gbinv295.seq 1464715247 gbinv296.seq 1493913805 gbinv297.seq 1489979595 gbinv298.seq 1427512355 gbinv299.seq 1496070030 gbinv3.seq 1491031005 gbinv30.seq 1457194355 gbinv300.seq 1489488513 gbinv301.seq 1495947464 gbinv302.seq 1325794030 gbinv303.seq 1494136720 gbinv304.seq 1477159575 gbinv305.seq 1467829201 gbinv306.seq 1454855814 gbinv307.seq 1493852374 gbinv308.seq 1498242095 gbinv309.seq 1496551664 gbinv31.seq 1485124639 gbinv310.seq 1423569097 gbinv311.seq 1476156793 gbinv312.seq 1494695775 gbinv313.seq 1442638155 gbinv314.seq 546209869 gbinv315.seq 2729769834 gbinv316.seq 1951209797 gbinv317.seq 1255792905 gbinv318.seq 898357564 gbinv319.seq 1346512123 gbinv32.seq 1390359247 gbinv320.seq 1466020132 gbinv321.seq 1443272573 gbinv322.seq 1475387842 gbinv323.seq 1497205510 gbinv324.seq 1467101040 gbinv325.seq 1496389311 gbinv326.seq 1499117653 gbinv327.seq 1462931194 gbinv328.seq 1487873497 gbinv329.seq 1393262298 gbinv33.seq 1277578135 gbinv330.seq 1487639321 gbinv331.seq 1456188446 gbinv332.seq 1499002056 gbinv333.seq 1480066049 gbinv334.seq 1454211592 gbinv335.seq 1222756177 gbinv336.seq 1477554828 gbinv337.seq 1486108915 gbinv338.seq 1427447559 gbinv339.seq 1477889088 gbinv34.seq 1483162232 gbinv340.seq 1485243570 gbinv341.seq 1410776048 gbinv342.seq 1475127917 gbinv343.seq 1479038418 gbinv344.seq 1425853319 gbinv345.seq 1481373985 gbinv346.seq 1490243609 gbinv347.seq 1483879579 gbinv348.seq 1414434060 gbinv349.seq 1491191417 gbinv35.seq 1457292205 gbinv350.seq 1477018477 gbinv351.seq 1409025156 gbinv352.seq 1474794456 gbinv353.seq 1494012052 gbinv354.seq 1465696815 gbinv355.seq 1494483077 gbinv356.seq 1459440397 gbinv357.seq 1494957101 gbinv358.seq 1491910109 gbinv359.seq 1429887417 gbinv36.seq 1481624627 gbinv360.seq 1479042031 gbinv361.seq 1495864056 gbinv362.seq 1479577884 gbinv363.seq 1494515876 gbinv364.seq 1364399555 gbinv365.seq 1448613839 gbinv366.seq 1492450027 gbinv367.seq 1481797904 gbinv368.seq 1448615210 gbinv369.seq 1482775396 gbinv37.seq 1497318133 gbinv370.seq 1482942294 gbinv371.seq 1491980118 gbinv372.seq 1474614077 gbinv373.seq 1493902565 gbinv374.seq 1278522756 gbinv375.seq 1482901794 gbinv376.seq 1456649541 gbinv377.seq 1433938244 gbinv378.seq 1484220657 gbinv379.seq 1485006015 gbinv38.seq 1480269708 gbinv380.seq 1477251799 gbinv381.seq 1488642106 gbinv382.seq 1464325796 gbinv383.seq 1338568836 gbinv384.seq 1490699998 gbinv385.seq 1419620460 gbinv386.seq 1476857168 gbinv387.seq 1483484812 gbinv388.seq 1491577966 gbinv389.seq 1325350655 gbinv39.seq 1491112499 gbinv390.seq 1479699030 gbinv391.seq 1480538403 gbinv392.seq 1472167723 gbinv393.seq 1486100359 gbinv394.seq 1481117526 gbinv395.seq 1492071757 gbinv396.seq 1499340126 gbinv397.seq 1497229819 gbinv398.seq 1479610041 gbinv399.seq 1492635630 gbinv4.seq 1264663267 gbinv40.seq 1483481633 gbinv400.seq 1474121526 gbinv401.seq 1490369993 gbinv402.seq 1405673874 gbinv403.seq 1458938909 gbinv404.seq 1349464140 gbinv405.seq 1495749208 gbinv406.seq 1476876176 gbinv407.seq 1473968850 gbinv408.seq 1323353583 gbinv409.seq 1331002479 gbinv41.seq 1491101509 gbinv410.seq 1484946141 gbinv411.seq 1470944398 gbinv412.seq 1472332405 gbinv413.seq 1481542660 gbinv414.seq 1492837082 gbinv415.seq 1479414174 gbinv416.seq 1466552136 gbinv417.seq 1431499002 gbinv418.seq 1485071634 gbinv419.seq 1258736348 gbinv42.seq 1494313967 gbinv420.seq 1493657170 gbinv421.seq 1480261094 gbinv422.seq 1483044191 gbinv423.seq 1445615250 gbinv424.seq 1497887640 gbinv425.seq 1471083260 gbinv426.seq 1497577480 gbinv427.seq 1499666284 gbinv428.seq 1460233365 gbinv429.seq 1458619342 gbinv43.seq 1496183446 gbinv430.seq 1498835879 gbinv431.seq 1473136630 gbinv432.seq 1479632452 gbinv433.seq 1208341643 gbinv434.seq 1475939186 gbinv435.seq 1492673455 gbinv436.seq 1461443834 gbinv437.seq 1499017367 gbinv438.seq 1480639218 gbinv439.seq 1386885295 gbinv44.seq 1489253829 gbinv440.seq 1499684437 gbinv441.seq 1498373944 gbinv442.seq 1477680980 gbinv443.seq 1469115028 gbinv444.seq 1486876777 gbinv445.seq 1494514455 gbinv446.seq 1419644627 gbinv447.seq 1498250624 gbinv448.seq 1487133459 gbinv449.seq 1431698617 gbinv45.seq 1393203164 gbinv450.seq 1408820705 gbinv451.seq 1497592776 gbinv452.seq 1478543833 gbinv453.seq 1392852049 gbinv454.seq 1499169382 gbinv455.seq 1466213638 gbinv456.seq 1469972842 gbinv457.seq 1457228715 gbinv458.seq 1497717270 gbinv459.seq 1431750372 gbinv46.seq 1494988855 gbinv460.seq 1278804881 gbinv461.seq 1380109384 gbinv462.seq 1386694032 gbinv463.seq 1420319566 gbinv464.seq 1318232257 gbinv465.seq 1488909769 gbinv466.seq 1481543720 gbinv467.seq 1481572537 gbinv468.seq 1479361265 gbinv469.seq 1344444822 gbinv47.seq 1401152941 gbinv470.seq 1496970085 gbinv471.seq 1478315198 gbinv472.seq 1429811506 gbinv473.seq 1376843258 gbinv474.seq 1465003259 gbinv475.seq 1497423367 gbinv476.seq 1346892194 gbinv477.seq 1454126994 gbinv478.seq 1487412138 gbinv479.seq 1444379504 gbinv48.seq 1483868694 gbinv480.seq 1473633031 gbinv481.seq 1482689248 gbinv482.seq 1452173892 gbinv483.seq 1499910356 gbinv484.seq 1464467532 gbinv485.seq 1485513855 gbinv486.seq 1482623541 gbinv487.seq 1494124998 gbinv488.seq 1497608690 gbinv489.seq 1425942927 gbinv49.seq 1457065445 gbinv490.seq 1311857016 gbinv491.seq 1474908251 gbinv492.seq 882426802 gbinv493.seq 1391549013 gbinv494.seq 1469092788 gbinv495.seq 1473448155 gbinv496.seq 1478007974 gbinv497.seq 1483031812 gbinv498.seq 1499113062 gbinv499.seq 1495542399 gbinv5.seq 1280180275 gbinv50.seq 1414071112 gbinv500.seq 1488672225 gbinv501.seq 1436891465 gbinv502.seq 1470426165 gbinv503.seq 994114412 gbinv504.seq 1495303361 gbinv505.seq 1489955112 gbinv506.seq 1463095666 gbinv507.seq 1444565030 gbinv508.seq 1476941483 gbinv509.seq 1313437692 gbinv51.seq 1476771081 gbinv510.seq 1383246824 gbinv511.seq 1452869539 gbinv512.seq 1478517605 gbinv513.seq 1495371589 gbinv514.seq 1467297527 gbinv515.seq 1460534329 gbinv516.seq 1461098798 gbinv517.seq 1414146754 gbinv518.seq 1468601310 gbinv519.seq 1326432934 gbinv52.seq 1496553038 gbinv520.seq 1481179326 gbinv521.seq 1496915445 gbinv522.seq 1400120857 gbinv523.seq 1489117723 gbinv524.seq 1489917827 gbinv525.seq 1472324703 gbinv526.seq 1484543524 gbinv527.seq 1497533122 gbinv528.seq 1498095048 gbinv529.seq 1146288120 gbinv53.seq 1485800779 gbinv530.seq 1451959467 gbinv531.seq 1339662122 gbinv532.seq 1285411718 gbinv533.seq 1403179825 gbinv534.seq 1463090834 gbinv535.seq 1487090635 gbinv536.seq 1413426091 gbinv537.seq 1313629197 gbinv538.seq 1478845791 gbinv539.seq 1386619309 gbinv54.seq 1422907245 gbinv540.seq 1482655612 gbinv541.seq 1358286202 gbinv542.seq 1442882432 gbinv543.seq 1494791321 gbinv544.seq 1474942351 gbinv545.seq 1439290780 gbinv546.seq 1449238385 gbinv547.seq 1477198309 gbinv548.seq 1366129901 gbinv549.seq 1370389051 gbinv55.seq 1493069824 gbinv550.seq 1491415882 gbinv551.seq 1473668442 gbinv552.seq 1386898604 gbinv553.seq 1347917131 gbinv554.seq 1309168704 gbinv555.seq 1436243774 gbinv556.seq 1389671116 gbinv557.seq 1449300137 gbinv558.seq 1492678269 gbinv559.seq 1500000250 gbinv56.seq 1458594377 gbinv560.seq 1492844340 gbinv561.seq 1452199723 gbinv562.seq 1476212405 gbinv563.seq 1486194223 gbinv564.seq 1495140895 gbinv565.seq 1287096563 gbinv566.seq 1374386504 gbinv567.seq 1468997307 gbinv568.seq 1494920149 gbinv569.seq 1488166542 gbinv57.seq 1495343415 gbinv570.seq 1490343966 gbinv571.seq 1489624021 gbinv572.seq 1487080559 gbinv573.seq 1498747450 gbinv574.seq 1395302798 gbinv575.seq 1485284949 gbinv576.seq 1435694157 gbinv577.seq 1470723522 gbinv578.seq 1484916015 gbinv579.seq 1497843538 gbinv58.seq 1483150132 gbinv580.seq 1331454162 gbinv581.seq 1356210496 gbinv582.seq 1416749796 gbinv583.seq 1452284984 gbinv584.seq 1488148955 gbinv585.seq 1495268123 gbinv586.seq 1461920210 gbinv587.seq 1490950525 gbinv588.seq 1372238232 gbinv589.seq 1486951187 gbinv59.seq 1390606238 gbinv590.seq 1458894443 gbinv591.seq 1493654155 gbinv592.seq 1499866432 gbinv593.seq 1462171534 gbinv594.seq 1470312188 gbinv595.seq 1491213345 gbinv596.seq 1200607082 gbinv597.seq 1474599992 gbinv598.seq 1226521611 gbinv599.seq 1484462816 gbinv6.seq 1384806830 gbinv60.seq 1438661071 gbinv600.seq 1489193064 gbinv601.seq 1211826488 gbinv602.seq 1440385609 gbinv603.seq 1477656292 gbinv604.seq 1499291058 gbinv605.seq 1499137795 gbinv606.seq 1474254297 gbinv607.seq 1437961059 gbinv608.seq 1465982476 gbinv609.seq 1466490036 gbinv61.seq 1476362632 gbinv610.seq 1353205190 gbinv611.seq 1461561561 gbinv612.seq 1480265953 gbinv613.seq 1477136556 gbinv614.seq 1413880691 gbinv615.seq 1493749227 gbinv616.seq 1489227625 gbinv617.seq 1127804764 gbinv618.seq 1467406139 gbinv619.seq 1497913038 gbinv62.seq 1349338312 gbinv620.seq 1466084609 gbinv621.seq 1499595036 gbinv622.seq 1493518373 gbinv623.seq 1482408313 gbinv624.seq 1489972607 gbinv625.seq 1457477267 gbinv626.seq 1498514187 gbinv627.seq 1484260363 gbinv628.seq 1313458207 gbinv629.seq 1485543135 gbinv63.seq 1489473064 gbinv630.seq 1467231749 gbinv631.seq 1496514080 gbinv632.seq 1476538751 gbinv633.seq 1466376780 gbinv634.seq 1462399182 gbinv635.seq 1477737198 gbinv636.seq 1424791995 gbinv637.seq 1468769087 gbinv638.seq 1497913605 gbinv639.seq 1489822428 gbinv64.seq 1271418322 gbinv640.seq 1301564944 gbinv641.seq 1471879735 gbinv642.seq 1053677687 gbinv643.seq 1380265120 gbinv644.seq 1396131978 gbinv645.seq 1489554947 gbinv646.seq 1433410472 gbinv647.seq 1351353812 gbinv648.seq 1242394563 gbinv649.seq 1489866376 gbinv65.seq 1499324418 gbinv650.seq 1473661888 gbinv651.seq 1449356018 gbinv652.seq 1475967180 gbinv653.seq 1493682979 gbinv654.seq 1495997887 gbinv655.seq 1469126947 gbinv656.seq 1296705383 gbinv657.seq 1466230627 gbinv658.seq 1343924683 gbinv659.seq 1490711516 gbinv66.seq 1496203289 gbinv660.seq 1484700308 gbinv661.seq 1188685701 gbinv662.seq 1441258603 gbinv663.seq 1462772577 gbinv664.seq 1495266184 gbinv665.seq 1494695214 gbinv666.seq 1391522890 gbinv667.seq 1470077879 gbinv668.seq 1294029204 gbinv669.seq 1497689069 gbinv67.seq 1274422615 gbinv670.seq 1205408689 gbinv671.seq 1104142746 gbinv672.seq 1036632038 gbinv673.seq 1332903523 gbinv674.seq 1190138460 gbinv675.seq 1381167273 gbinv676.seq 1482941221 gbinv677.seq 1334265164 gbinv678.seq 1420388772 gbinv679.seq 1475025659 gbinv68.seq 1404385349 gbinv680.seq 1460306287 gbinv681.seq 1462226610 gbinv682.seq 1436988710 gbinv683.seq 1491802675 gbinv684.seq 1492108404 gbinv685.seq 1367921076 gbinv686.seq 1494199652 gbinv687.seq 1123984168 gbinv688.seq 874599051 gbinv689.seq 1474966608 gbinv69.seq 872525010 gbinv690.seq 810605264 gbinv691.seq 791733648 gbinv692.seq 789407447 gbinv693.seq 782472280 gbinv694.seq 1478877159 gbinv695.seq 1425054466 gbinv696.seq 1232428257 gbinv697.seq 1449091071 gbinv698.seq 1494178824 gbinv699.seq 1489984834 gbinv7.seq 1481790507 gbinv70.seq 1451306539 gbinv700.seq 1446725042 gbinv701.seq 1492012562 gbinv702.seq 1485251352 gbinv703.seq 1440797550 gbinv704.seq 1489644341 gbinv705.seq 1129926582 gbinv706.seq 1478985096 gbinv707.seq 1436917067 gbinv708.seq 1304573259 gbinv709.seq 1484232844 gbinv71.seq 1447912985 gbinv710.seq 1477159679 gbinv711.seq 1441002488 gbinv712.seq 1358342669 gbinv713.seq 1495926001 gbinv714.seq 1489540966 gbinv715.seq 1385541461 gbinv716.seq 1490668437 gbinv717.seq 1498773544 gbinv718.seq 1494280310 gbinv719.seq 1476309587 gbinv72.seq 1478659130 gbinv720.seq 1490369912 gbinv721.seq 1454124707 gbinv722.seq 1480065591 gbinv723.seq 1477473627 gbinv724.seq 1458431340 gbinv725.seq 1267258270 gbinv726.seq 1499431451 gbinv727.seq 1384116066 gbinv728.seq 1474301866 gbinv729.seq 1491769496 gbinv73.seq 1204760525 gbinv730.seq 1460137155 gbinv731.seq 1476820917 gbinv732.seq 1353805130 gbinv733.seq 1413692605 gbinv734.seq 1470780301 gbinv735.seq 1484656775 gbinv736.seq 1469691984 gbinv737.seq 1495706071 gbinv738.seq 1297579350 gbinv739.seq 1490188557 gbinv74.seq 1375758712 gbinv740.seq 1454532764 gbinv741.seq 1497622251 gbinv742.seq 1370789184 gbinv743.seq 1487438153 gbinv744.seq 1492926956 gbinv745.seq 1492982005 gbinv746.seq 1447577144 gbinv747.seq 1431751206 gbinv748.seq 1489605332 gbinv749.seq 1495854749 gbinv75.seq 1473901953 gbinv750.seq 1460311830 gbinv751.seq 1453756526 gbinv752.seq 1382808281 gbinv753.seq 1482348831 gbinv754.seq 1487170658 gbinv755.seq 1059460203 gbinv756.seq 1191529685 gbinv757.seq 1176457428 gbinv758.seq 1118724487 gbinv759.seq 1487028202 gbinv76.seq 1448943866 gbinv760.seq 1436999462 gbinv761.seq 1484686767 gbinv762.seq 1440414567 gbinv763.seq 1462302632 gbinv764.seq 1488222097 gbinv765.seq 1477654772 gbinv766.seq 1489253061 gbinv767.seq 1461105919 gbinv768.seq 1476470435 gbinv769.seq 1499999673 gbinv77.seq 1456148858 gbinv770.seq 1414082664 gbinv771.seq 1496084666 gbinv772.seq 1489435912 gbinv773.seq 1434779449 gbinv774.seq 1490169327 gbinv775.seq 1436479661 gbinv776.seq 1443656233 gbinv777.seq 1497278333 gbinv778.seq 1482389324 gbinv779.seq 1499999588 gbinv78.seq 1475136219 gbinv780.seq 1372239389 gbinv781.seq 1391999152 gbinv782.seq 1453801378 gbinv783.seq 1497276181 gbinv784.seq 1488917458 gbinv785.seq 1343377212 gbinv786.seq 1431137590 gbinv787.seq 1470649030 gbinv788.seq 1495673684 gbinv789.seq 1499998624 gbinv79.seq 1484392436 gbinv790.seq 1370380432 gbinv791.seq 1271919212 gbinv792.seq 1302247251 gbinv793.seq 1373305750 gbinv794.seq 1375693754 gbinv795.seq 1464671547 gbinv796.seq 1459541391 gbinv797.seq 1489406014 gbinv798.seq 1490586273 gbinv799.seq 1414297602 gbinv8.seq 1499998570 gbinv80.seq 1493837031 gbinv800.seq 1400217161 gbinv801.seq 1413210457 gbinv802.seq 1490609103 gbinv803.seq 1497732234 gbinv804.seq 1219453804 gbinv805.seq 1264302105 gbinv806.seq 1485822787 gbinv807.seq 1418685694 gbinv808.seq 1482216219 gbinv809.seq 1499998337 gbinv81.seq 1417478148 gbinv810.seq 1494543420 gbinv811.seq 1417238152 gbinv812.seq 1366812572 gbinv813.seq 1494164508 gbinv814.seq 999979249 gbinv815.seq 1368086882 gbinv816.seq 1408574610 gbinv817.seq 1498538060 gbinv818.seq 1397635787 gbinv819.seq 1499995750 gbinv82.seq 1081620411 gbinv820.seq 1431826102 gbinv821.seq 1401372891 gbinv822.seq 1448756584 gbinv823.seq 1488109642 gbinv824.seq 1489078785 gbinv825.seq 1460733085 gbinv826.seq 1474715637 gbinv827.seq 1472124950 gbinv828.seq 1423732997 gbinv829.seq 1499999761 gbinv83.seq 1431479439 gbinv830.seq 1414088464 gbinv831.seq 1427352077 gbinv832.seq 1486209499 gbinv833.seq 1439790711 gbinv834.seq 1345947195 gbinv835.seq 1409851510 gbinv836.seq 1497428187 gbinv837.seq 1491627673 gbinv838.seq 1407776038 gbinv839.seq 1499998118 gbinv84.seq 1486091565 gbinv840.seq 1447417163 gbinv841.seq 1424173333 gbinv842.seq 1471376235 gbinv843.seq 1483914009 gbinv844.seq 1476924389 gbinv845.seq 1495375621 gbinv846.seq 1482546700 gbinv847.seq 1477023133 gbinv848.seq 1484489275 gbinv849.seq 1499996749 gbinv85.seq 1364991275 gbinv850.seq 1327457514 gbinv851.seq 1445905313 gbinv852.seq 1480024427 gbinv853.seq 1492427545 gbinv854.seq 1483237802 gbinv855.seq 1334750785 gbinv856.seq 1340130480 gbinv857.seq 1428711159 gbinv858.seq 1292257015 gbinv859.seq 1499998393 gbinv86.seq 1453904599 gbinv860.seq 1490727749 gbinv861.seq 1479824478 gbinv862.seq 1446168967 gbinv863.seq 1483787681 gbinv864.seq 1234619110 gbinv865.seq 1489639731 gbinv866.seq 1478350948 gbinv867.seq 1472613421 gbinv868.seq 1314863017 gbinv869.seq 1497947958 gbinv87.seq 1492845810 gbinv870.seq 1482657208 gbinv871.seq 1490433581 gbinv872.seq 1491351228 gbinv873.seq 1459189685 gbinv874.seq 1438910128 gbinv875.seq 1165149605 gbinv876.seq 1443358202 gbinv877.seq 1231751195 gbinv878.seq 1465887213 gbinv879.seq 1452778340 gbinv88.seq 1427380300 gbinv880.seq 1498007467 gbinv881.seq 1492780193 gbinv882.seq 1310752098 gbinv883.seq 1491528231 gbinv884.seq 1372427027 gbinv885.seq 1429260753 gbinv886.seq 1491982766 gbinv887.seq 1499828325 gbinv888.seq 1489546318 gbinv889.seq 1497328201 gbinv89.seq 1450002164 gbinv890.seq 1432656175 gbinv891.seq 1492803541 gbinv892.seq 1483685180 gbinv893.seq 1494338837 gbinv894.seq 1489389384 gbinv895.seq 1486778058 gbinv896.seq 1434934286 gbinv897.seq 1455774368 gbinv898.seq 1486106218 gbinv899.seq 1424906729 gbinv9.seq 1489332493 gbinv90.seq 1499848546 gbinv900.seq 1473633903 gbinv901.seq 1482973725 gbinv902.seq 1484222044 gbinv903.seq 1488305213 gbinv904.seq 1341678524 gbinv905.seq 1442932031 gbinv906.seq 1495746307 gbinv907.seq 1498425116 gbinv908.seq 1439194314 gbinv909.seq 1499217229 gbinv91.seq 1478270733 gbinv910.seq 1494920288 gbinv911.seq 1460584282 gbinv912.seq 1487364619 gbinv913.seq 1497676087 gbinv914.seq 1479051946 gbinv915.seq 1487083952 gbinv916.seq 1497354730 gbinv917.seq 1455384863 gbinv918.seq 1481656710 gbinv919.seq 1499961716 gbinv92.seq 1422592874 gbinv920.seq 1486259454 gbinv921.seq 1496078122 gbinv922.seq 1494276352 gbinv923.seq 1497275821 gbinv924.seq 1457705968 gbinv925.seq 1452771475 gbinv926.seq 1337144687 gbinv927.seq 1492176983 gbinv928.seq 1485150868 gbinv929.seq 1457178803 gbinv93.seq 1495278047 gbinv930.seq 1475008435 gbinv931.seq 1498947149 gbinv932.seq 1472536133 gbinv933.seq 1498507310 gbinv934.seq 1499942165 gbinv935.seq 1466341042 gbinv936.seq 1472044394 gbinv937.seq 1492159701 gbinv938.seq 1495894532 gbinv939.seq 1497991080 gbinv94.seq 1496016829 gbinv940.seq 1475317343 gbinv941.seq 1474568294 gbinv942.seq 1438072296 gbinv943.seq 1494607055 gbinv944.seq 1490886729 gbinv945.seq 1479101082 gbinv946.seq 1402632874 gbinv947.seq 1478348328 gbinv948.seq 1445542854 gbinv949.seq 1471704374 gbinv95.seq 1493783690 gbinv950.seq 1494864231 gbinv951.seq 1456882204 gbinv952.seq 1498195733 gbinv953.seq 1481786457 gbinv954.seq 1484032756 gbinv955.seq 1485547351 gbinv956.seq 1486001132 gbinv957.seq 1488420372 gbinv958.seq 1442129992 gbinv959.seq 1490373598 gbinv96.seq 1466077407 gbinv960.seq 1499748615 gbinv961.seq 1451014090 gbinv962.seq 1491533135 gbinv963.seq 1474040893 gbinv964.seq 1377730255 gbinv965.seq 1396391863 gbinv966.seq 1476640185 gbinv967.seq 1489968019 gbinv968.seq 1487861140 gbinv969.seq 1490766577 gbinv97.seq 1485537198 gbinv970.seq 1499625751 gbinv971.seq 1484465404 gbinv972.seq 1426415254 gbinv973.seq 1475823352 gbinv974.seq 1493390820 gbinv975.seq 1454462171 gbinv976.seq 1352129141 gbinv977.seq 1481827757 gbinv978.seq 1485321858 gbinv979.seq 1499567309 gbinv98.seq 1491490205 gbinv980.seq 1473282801 gbinv981.seq 1474812334 gbinv982.seq 1455288730 gbinv983.seq 1460050941 gbinv984.seq 1321445242 gbinv985.seq 1289149103 gbinv986.seq 1295409175 gbinv987.seq 1314219184 gbinv988.seq 1326818662 gbinv989.seq 1490250205 gbinv99.seq 1432750157 gbinv990.seq 1499348985 gbinv991.seq 1402001737 gbinv992.seq 1489762578 gbinv993.seq 1495800702 gbinv994.seq 1499680770 gbinv995.seq 1482267935 gbinv996.seq 1451247651 gbinv997.seq 1489797911 gbinv998.seq 1434543185 gbinv999.seq 1299929280 gbmam1.seq 1433374449 gbmam10.seq 1306087104 gbmam100.seq 1430476511 gbmam101.seq 1449916654 gbmam102.seq 1364157134 gbmam103.seq 1382213566 gbmam104.seq 1498676378 gbmam105.seq 1438757409 gbmam106.seq 1384358697 gbmam107.seq 1344501950 gbmam108.seq 1356418005 gbmam109.seq 1452368889 gbmam11.seq 1450451476 gbmam110.seq 1481466561 gbmam111.seq 1435707480 gbmam112.seq 1421504246 gbmam113.seq 1438731831 gbmam114.seq 1385607504 gbmam115.seq 1446529752 gbmam116.seq 1480279188 gbmam117.seq 1289027473 gbmam118.seq 1383998815 gbmam119.seq 1440036034 gbmam12.seq 1371963584 gbmam120.seq 1408704474 gbmam121.seq 1417170244 gbmam122.seq 1476795247 gbmam123.seq 1393897162 gbmam124.seq 1494577002 gbmam125.seq 1318911633 gbmam126.seq 1475290767 gbmam127.seq 1485363650 gbmam128.seq 1476657140 gbmam129.seq 1497426774 gbmam13.seq 1370959145 gbmam130.seq 1435239182 gbmam131.seq 1421963565 gbmam132.seq 1265661494 gbmam133.seq 1322489185 gbmam134.seq 1498720323 gbmam135.seq 1468071162 gbmam136.seq 1482316458 gbmam137.seq 1406515127 gbmam138.seq 1468808675 gbmam139.seq 1487057346 gbmam14.seq 1486469699 gbmam140.seq 1419745399 gbmam141.seq 1379376566 gbmam142.seq 1392387812 gbmam143.seq 1498621108 gbmam144.seq 1424747897 gbmam145.seq 1444039328 gbmam146.seq 1495905279 gbmam147.seq 1431972134 gbmam148.seq 1453650462 gbmam149.seq 1433300115 gbmam15.seq 1466469937 gbmam150.seq 1359653884 gbmam151.seq 1486040441 gbmam152.seq 1476612439 gbmam153.seq 1250005791 gbmam154.seq 1428977181 gbmam155.seq 1466316389 gbmam156.seq 1440958642 gbmam157.seq 1398606775 gbmam158.seq 1429174374 gbmam159.seq 1485894617 gbmam16.seq 1307257965 gbmam160.seq 1318147645 gbmam161.seq 1407278050 gbmam162.seq 1320959487 gbmam163.seq 1474063572 gbmam164.seq 962782132 gbmam165.seq 1345861608 gbmam17.seq 1404073848 gbmam18.seq 1315922420 gbmam19.seq 1490951841 gbmam2.seq 1367843978 gbmam20.seq 1468252034 gbmam21.seq 1393139762 gbmam22.seq 1466817553 gbmam23.seq 1488080656 gbmam24.seq 1483917563 gbmam25.seq 1434132825 gbmam26.seq 1485351268 gbmam27.seq 1453128998 gbmam28.seq 1494333882 gbmam29.seq 1141243686 gbmam3.seq 1464519465 gbmam30.seq 1441977794 gbmam31.seq 1446827567 gbmam32.seq 1455111173 gbmam33.seq 1385308836 gbmam34.seq 1424749144 gbmam35.seq 1410339361 gbmam36.seq 1378454484 gbmam37.seq 1434286183 gbmam38.seq 1499999524 gbmam39.seq 1342505130 gbmam4.seq 1487401787 gbmam40.seq 1480436127 gbmam41.seq 1406193426 gbmam42.seq 907465328 gbmam43.seq 839494897 gbmam44.seq 1363269325 gbmam45.seq 1343119710 gbmam46.seq 1465682461 gbmam47.seq 1327495418 gbmam48.seq 1455155074 gbmam49.seq 1484831122 gbmam5.seq 1403782937 gbmam50.seq 1389175376 gbmam51.seq 1460772173 gbmam52.seq 1499643620 gbmam53.seq 1494407093 gbmam54.seq 1396535326 gbmam55.seq 1383327549 gbmam56.seq 1473290653 gbmam57.seq 1411021419 gbmam58.seq 1443634265 gbmam59.seq 1429536704 gbmam6.seq 1399808988 gbmam60.seq 1372697093 gbmam61.seq 1445899120 gbmam62.seq 1487459605 gbmam63.seq 1446030419 gbmam64.seq 1491900321 gbmam65.seq 1447662228 gbmam66.seq 1288272320 gbmam67.seq 1489541175 gbmam68.seq 1367385872 gbmam69.seq 1485960787 gbmam7.seq 1433690311 gbmam70.seq 1367200168 gbmam71.seq 1407233551 gbmam72.seq 1437343447 gbmam73.seq 1344751550 gbmam74.seq 1487484232 gbmam75.seq 1418284918 gbmam76.seq 1499602081 gbmam77.seq 1297485464 gbmam78.seq 1441482016 gbmam79.seq 1435168677 gbmam8.seq 1345159341 gbmam80.seq 1472528753 gbmam81.seq 1427875805 gbmam82.seq 1399062857 gbmam83.seq 1414660891 gbmam84.seq 1404065710 gbmam85.seq 1471139449 gbmam86.seq 1360004244 gbmam87.seq 1498868645 gbmam88.seq 1463009812 gbmam89.seq 1460040942 gbmam9.seq 1456467514 gbmam90.seq 1375828745 gbmam91.seq 1499523909 gbmam92.seq 1445611423 gbmam93.seq 1449752142 gbmam94.seq 1496616060 gbmam95.seq 1436171585 gbmam96.seq 1444940922 gbmam97.seq 1410643331 gbmam98.seq 1473092164 gbmam99.seq 31182631 gbnew.txt 1499999533 gbpat1.seq 1499998866 gbpat10.seq 1500000212 gbpat11.seq 1499117685 gbpat12.seq 1500000080 gbpat13.seq 1499999526 gbpat14.seq 1499999810 gbpat15.seq 1500000101 gbpat16.seq 1499999262 gbpat17.seq 1500000031 gbpat18.seq 1499998872 gbpat19.seq 1499997700 gbpat2.seq 1500000033 gbpat20.seq 1500000087 gbpat21.seq 1500000178 gbpat22.seq 1499999529 gbpat23.seq 1499998599 gbpat24.seq 1499999973 gbpat25.seq 1497452296 gbpat26.seq 1499998088 gbpat27.seq 1499946758 gbpat28.seq 1499999160 gbpat29.seq 1499996296 gbpat3.seq 1499999058 gbpat30.seq 1498575921 gbpat31.seq 1499998970 gbpat32.seq 1499999158 gbpat33.seq 1499995693 gbpat34.seq 1499997858 gbpat35.seq 1499998623 gbpat36.seq 1499999862 gbpat37.seq 1500000032 gbpat38.seq 1499999722 gbpat39.seq 1499999332 gbpat4.seq 1498559244 gbpat40.seq 1499940981 gbpat41.seq 1499996775 gbpat42.seq 1499998629 gbpat43.seq 1500000186 gbpat44.seq 1499998965 gbpat45.seq 1499998832 gbpat46.seq 1499992533 gbpat47.seq 1499998804 gbpat48.seq 1499993151 gbpat49.seq 1499909606 gbpat5.seq 1500000126 gbpat50.seq 1499997512 gbpat51.seq 1499920981 gbpat52.seq 1499999330 gbpat53.seq 1499999022 gbpat54.seq 1499999056 gbpat55.seq 1499996080 gbpat56.seq 1500000214 gbpat57.seq 1499998128 gbpat58.seq 1499996741 gbpat59.seq 1499999382 gbpat6.seq 1499986020 gbpat60.seq 1499998796 gbpat61.seq 1500000007 gbpat62.seq 1499843862 gbpat63.seq 1499866922 gbpat64.seq 1499480501 gbpat65.seq 1477061152 gbpat66.seq 1499998595 gbpat67.seq 1499998966 gbpat68.seq 1499999339 gbpat69.seq 1499999417 gbpat7.seq 1499999165 gbpat70.seq 1499999709 gbpat71.seq 1499946499 gbpat72.seq 1499998676 gbpat73.seq 1499998664 gbpat74.seq 1499998904 gbpat75.seq 1499999057 gbpat76.seq 1499999558 gbpat77.seq 1499999181 gbpat78.seq 1499999127 gbpat79.seq 1499969143 gbpat8.seq 600121054 gbpat80.seq 1499999458 gbpat9.seq 1499995029 gbphg1.seq 1499468587 gbphg2.seq 582683811 gbphg3.seq 1499873912 gbpln1.seq 1490892671 gbpln10.seq 1497729906 gbpln100.seq 1471514124 gbpln1000.se 1460672453 gbpln1001.se 847689175 gbpln1002.se 797030463 gbpln1003.se 776617524 gbpln1004.se 1450233858 gbpln1005.se 1469651463 gbpln1006.se 834034797 gbpln1007.se 795540701 gbpln1008.se 776376885 gbpln1009.se 1489362717 gbpln101.seq 1448905128 gbpln1010.se 1457656304 gbpln1011.se 833009352 gbpln1012.se 797524540 gbpln1013.se 773297930 gbpln1014.se 1451244889 gbpln1015.se 1454193216 gbpln1016.se 830169429 gbpln1017.se 793310457 gbpln1018.se 773560290 gbpln1019.se 1499092145 gbpln102.seq 1446231891 gbpln1020.se 1450937303 gbpln1021.se 835938341 gbpln1022.se 795056321 gbpln1023.se 770765157 gbpln1024.se 1475561524 gbpln1025.se 1466579245 gbpln1026.se 829099164 gbpln1027.se 790989379 gbpln1028.se 773398673 gbpln1029.se 1473551999 gbpln103.seq 1462046272 gbpln1030.se 1449910042 gbpln1031.se 837413052 gbpln1032.se 790648527 gbpln1033.se 772176401 gbpln1034.se 1460620041 gbpln1035.se 1455765886 gbpln1036.se 833059054 gbpln1037.se 794545184 gbpln1038.se 774083177 gbpln1039.se 1497683966 gbpln104.seq 1448946753 gbpln1040.se 1458559584 gbpln1041.se 835451342 gbpln1042.se 794577233 gbpln1043.se 775251446 gbpln1044.se 1454531761 gbpln1045.se 1463618989 gbpln1046.se 836809812 gbpln1047.se 806584862 gbpln1048.se 776084155 gbpln1049.se 1339792010 gbpln105.seq 1485075661 gbpln1050.se 1448852265 gbpln1051.se 836125457 gbpln1052.se 794049612 gbpln1053.se 769729355 gbpln1054.se 1469601615 gbpln1055.se 1458361301 gbpln1056.se 840008504 gbpln1057.se 794029694 gbpln1058.se 769623341 gbpln1059.se 946931884 gbpln106.seq 1477482614 gbpln1060.se 1456549528 gbpln1061.se 836931236 gbpln1062.se 792455888 gbpln1063.se 768695354 gbpln1064.se 1450909194 gbpln1065.se 1454926637 gbpln1066.se 835570197 gbpln1067.se 798619346 gbpln1068.se 776375847 gbpln1069.se 1121159029 gbpln107.seq 1468212148 gbpln1070.se 1463519623 gbpln1071.se 832456199 gbpln1072.se 793920035 gbpln1073.se 773324985 gbpln1074.se 1443647684 gbpln1075.se 1458966967 gbpln1076.se 834886228 gbpln1077.se 792465315 gbpln1078.se 766375549 gbpln1079.se 1164001315 gbpln108.seq 1449349195 gbpln1080.se 1457671779 gbpln1081.se 836173230 gbpln1082.se 792990723 gbpln1083.se 774691916 gbpln1084.se 1452432506 gbpln1085.se 797342703 gbpln1086.se 1496638015 gbpln1087.se 804070482 gbpln1088.se 777569920 gbpln1089.se 1483600477 gbpln109.seq 1461158646 gbpln1090.se 1466754128 gbpln1091.se 830451601 gbpln1092.se 798616435 gbpln1093.se 774880678 gbpln1094.se 1455218535 gbpln1095.se 1460523331 gbpln1096.se 837230145 gbpln1097.se 796560308 gbpln1098.se 777015504 gbpln1099.se 1408071661 gbpln11.seq 1314173387 gbpln110.seq 1455593679 gbpln1100.se 1455711383 gbpln1101.se 838785071 gbpln1102.se 791233293 gbpln1103.se 770014685 gbpln1104.se 1450013191 gbpln1105.se 1455309450 gbpln1106.se 835677720 gbpln1107.se 793372574 gbpln1108.se 769401747 gbpln1109.se 946518369 gbpln111.seq 1456544663 gbpln1110.se 1465313453 gbpln1111.se 839230685 gbpln1112.se 803963907 gbpln1113.se 778586682 gbpln1114.se 1463130395 gbpln1115.se 1457728697 gbpln1116.se 832496071 gbpln1117.se 797513192 gbpln1118.se 776551156 gbpln1119.se 1120694900 gbpln112.seq 1449845840 gbpln1120.se 1460493739 gbpln1121.se 839860091 gbpln1122.se 789840368 gbpln1123.se 776969912 gbpln1124.se 1450486337 gbpln1125.se 1492412414 gbpln1126.se 1486347390 gbpln1127.se 1445734827 gbpln1128.se 1251330037 gbpln1129.se 1163541839 gbpln113.seq 1123381446 gbpln1130.se 1111693114 gbpln1131.se 1309334197 gbpln1132.se 1445887647 gbpln1133.se 1075129462 gbpln1134.se 830295693 gbpln1135.se 794035728 gbpln1136.se 766241777 gbpln1137.se 1451959155 gbpln1138.se 1460262157 gbpln1139.se 1476382817 gbpln114.seq 800420442 gbpln1140.se 807100878 gbpln1141.se 813165275 gbpln1142.se 1489858794 gbpln1143.se 1463645427 gbpln1144.se 836403024 gbpln1145.se 797704105 gbpln1146.se 771673145 gbpln1147.se 1489073756 gbpln1148.se 1463000631 gbpln1149.se 1472023278 gbpln115.seq 835021187 gbpln1150.se 794511065 gbpln1151.se 765022160 gbpln1152.se 1450430115 gbpln1153.se 1446394723 gbpln1154.se 837987830 gbpln1155.se 795104781 gbpln1156.se 772053911 gbpln1157.se 1454341387 gbpln1158.se 1471789737 gbpln1159.se 1398752652 gbpln116.seq 850377149 gbpln1160.se 1235921295 gbpln1161.se 820639220 gbpln1162.se 1480990953 gbpln1163.se 791663935 gbpln1164.se 942730875 gbpln1165.se 1413074394 gbpln1166.se 1271934713 gbpln1167.se 1485567802 gbpln1168.se 1184860474 gbpln1169.se 1421926221 gbpln117.seq 1227017136 gbpln1170.se 774219381 gbpln1171.se 1442415305 gbpln1172.se 1485783848 gbpln1173.se 1496789915 gbpln1174.se 1459198915 gbpln1175.se 952026327 gbpln1176.se 818534977 gbpln1177.se 744338029 gbpln1178.se 840481828 gbpln1179.se 1469834257 gbpln118.seq 1482265733 gbpln1180.se 867339882 gbpln1181.se 665178568 gbpln1182.se 840478319 gbpln1183.se 804862544 gbpln1184.se 775136193 gbpln1185.se 1456887584 gbpln1186.se 1470716689 gbpln1187.se 836948259 gbpln1188.se 794972859 gbpln1189.se 1475164725 gbpln119.seq 775455598 gbpln1190.se 1463119445 gbpln1191.se 1451301195 gbpln1192.se 852997313 gbpln1193.se 798187575 gbpln1194.se 776406263 gbpln1195.se 1458385249 gbpln1196.se 1463826120 gbpln1197.se 833048862 gbpln1198.se 794071582 gbpln1199.se 1475360853 gbpln12.seq 1486621137 gbpln120.seq 772684697 gbpln1200.se 1454827832 gbpln1201.se 1451661085 gbpln1202.se 839152730 gbpln1203.se 798464996 gbpln1204.se 775710033 gbpln1205.se 1463986968 gbpln1206.se 1455516963 gbpln1207.se 827472017 gbpln1208.se 799696373 gbpln1209.se 1457160312 gbpln121.seq 771541363 gbpln1210.se 1456098533 gbpln1211.se 1450468258 gbpln1212.se 830011447 gbpln1213.se 803324869 gbpln1214.se 778613518 gbpln1215.se 1485535574 gbpln1216.se 1460285834 gbpln1217.se 834396522 gbpln1218.se 793156442 gbpln1219.se 1454763247 gbpln122.seq 771664945 gbpln1220.se 1460976066 gbpln1221.se 1472747650 gbpln1222.se 831402033 gbpln1223.se 788227480 gbpln1224.se 773608315 gbpln1225.se 1459251214 gbpln1226.se 1457115869 gbpln1227.se 833114761 gbpln1228.se 791988363 gbpln1229.se 1498503243 gbpln123.seq 773778680 gbpln1230.se 1439338108 gbpln1231.se 1459678216 gbpln1232.se 832582978 gbpln1233.se 790630518 gbpln1234.se 774554078 gbpln1235.se 1459431387 gbpln1236.se 1462622889 gbpln1237.se 841885928 gbpln1238.se 814740283 gbpln1239.se 1441635964 gbpln124.seq 781686950 gbpln1240.se 1470777020 gbpln1241.se 1474113031 gbpln1242.se 836345572 gbpln1243.se 803943397 gbpln1244.se 776352617 gbpln1245.se 1461742228 gbpln1246.se 1468260082 gbpln1247.se 833628952 gbpln1248.se 800337028 gbpln1249.se 1486044425 gbpln125.seq 775679569 gbpln1250.se 1485372410 gbpln1251.se 1470684487 gbpln1252.se 837791026 gbpln1253.se 805450455 gbpln1254.se 782697461 gbpln1255.se 1462403294 gbpln1256.se 1471545155 gbpln1257.se 844251896 gbpln1258.se 800661389 gbpln1259.se 1479251541 gbpln126.seq 770104661 gbpln1260.se 1486820730 gbpln1261.se 1437673274 gbpln1262.se 1478905630 gbpln1263.se 1484038098 gbpln1264.se 1459847462 gbpln1265.se 1419009936 gbpln1266.se 1449294852 gbpln1267.se 1432942330 gbpln1268.se 1483752514 gbpln1269.se 1458104721 gbpln127.seq 1440643664 gbpln1270.se 1404423649 gbpln1271.se 1444711390 gbpln1272.se 1488511554 gbpln1273.se 1472104928 gbpln1274.se 1252858539 gbpln1275.se 1227118965 gbpln1276.se 1253367586 gbpln1277.se 1312280922 gbpln1278.se 1221593375 gbpln1279.se 1411028718 gbpln128.seq 1480321489 gbpln1280.se 1413447705 gbpln1281.se 1469526349 gbpln1282.se 1268059309 gbpln1283.se 2734223096 gbpln1284.se 2727931901 gbpln1285.se 2720692598 gbpln1286.se 2732441076 gbpln1287.se 2733260927 gbpln1288.se 157556535 gbpln1289.se 1353855770 gbpln129.seq 2694271430 gbpln1290.se 2735442486 gbpln1291.se 2720859722 gbpln1292.se 2732011308 gbpln1293.se 2383529845 gbpln1294.se 2723191931 gbpln1295.se 2689474086 gbpln1296.se 2737751830 gbpln1297.se 2700210160 gbpln1298.se 2006289519 gbpln1299.se 1437976712 gbpln13.seq 1357941853 gbpln130.seq 2636141786 gbpln1300.se 2722875815 gbpln1301.se 2725415454 gbpln1302.se 2730393002 gbpln1303.se 1948886785 gbpln1304.se 2738131093 gbpln1305.se 2727379378 gbpln1306.se 2679871098 gbpln1307.se 2737685310 gbpln1308.se 786720890 gbpln1309.se 1471747640 gbpln131.seq 2727907345 gbpln1310.se 2657432129 gbpln1311.se 2735229991 gbpln1312.se 2728645371 gbpln1313.se 218791011 gbpln1314.se 2719617838 gbpln1315.se 2721885171 gbpln1316.se 2721092581 gbpln1317.se 2679558604 gbpln1318.se 181580803 gbpln1319.se 1475148766 gbpln132.seq 2722179116 gbpln1320.se 2736369220 gbpln1321.se 2726783046 gbpln1322.se 2440060122 gbpln1323.se 2736724965 gbpln1324.se 2696541624 gbpln1325.se 2737924301 gbpln1326.se 1979539878 gbpln1327.se 2731302183 gbpln1328.se 2702984894 gbpln1329.se 1499375765 gbpln133.seq 2732485324 gbpln1330.se 1906858977 gbpln1331.se 1333776538 gbpln1332.se 1481529082 gbpln1333.se 1126988286 gbpln1334.se 1310090641 gbpln1335.se 1319048578 gbpln1336.se 1215502439 gbpln1337.se 1273213184 gbpln1338.se 1439841247 gbpln1339.se 1499799014 gbpln134.seq 1291263007 gbpln1340.se 1286241557 gbpln1341.se 1294607816 gbpln1342.se 1298830856 gbpln1343.se 1179380341 gbpln1344.se 1227809389 gbpln1345.se 1347974809 gbpln1346.se 1227045645 gbpln1347.se 1241387178 gbpln1348.se 1321199139 gbpln1349.se 1475765369 gbpln135.seq 1307076096 gbpln1350.se 1194598426 gbpln1351.se 1267961203 gbpln1352.se 1465598311 gbpln1353.se 1272760531 gbpln1354.se 1248554044 gbpln1355.se 1285502181 gbpln1356.se 1353649948 gbpln1357.se 1201259963 gbpln1358.se 1114385426 gbpln1359.se 1489368190 gbpln136.seq 1428292861 gbpln1360.se 1254591123 gbpln1361.se 1109371533 gbpln1362.se 1256013571 gbpln1363.se 1193254570 gbpln1364.se 1147797532 gbpln1365.se 1185963587 gbpln1366.se 1176623547 gbpln1367.se 1184486862 gbpln1368.se 1178497787 gbpln1369.se 1491306094 gbpln137.seq 1255058840 gbpln1370.se 1121066110 gbpln1371.se 1150746117 gbpln1372.se 1179251584 gbpln1373.se 1319824235 gbpln1374.se 1194499724 gbpln1375.se 1150884296 gbpln1376.se 1260272463 gbpln1377.se 1277796253 gbpln1378.se 1077009674 gbpln1379.se 1476492903 gbpln138.seq 1159931138 gbpln1380.se 1298671968 gbpln1381.se 1092881836 gbpln1382.se 1120436749 gbpln1383.se 1214127482 gbpln1384.se 1117793566 gbpln1385.se 1019835843 gbpln1386.se 1155398206 gbpln1387.se 1368620545 gbpln1388.se 1144165985 gbpln1389.se 1295984790 gbpln139.seq 1072391985 gbpln1390.se 1263097017 gbpln1391.se 1297997059 gbpln1392.se 1325335044 gbpln1393.se 1216230084 gbpln1394.se 1263623363 gbpln1395.se 1174025244 gbpln1396.se 1229634718 gbpln1397.se 1363681878 gbpln1398.se 1218381112 gbpln1399.se 1499998704 gbpln14.seq 1251274347 gbpln140.seq 1400966271 gbpln1400.se 1382372150 gbpln1401.se 1176735774 gbpln1402.se 1224889930 gbpln1403.se 1310436934 gbpln1404.se 1233749942 gbpln1405.se 1059964644 gbpln1406.se 1254488223 gbpln1407.se 1310744622 gbpln1408.se 1163904965 gbpln1409.se 1453657951 gbpln141.seq 1264654503 gbpln1410.se 1296551517 gbpln1411.se 1158563945 gbpln1412.se 1059918971 gbpln1413.se 1259052983 gbpln1414.se 1206631634 gbpln1415.se 1106849019 gbpln1416.se 1193454949 gbpln1417.se 1254210685 gbpln1418.se 1151910983 gbpln1419.se 1481017758 gbpln142.seq 1118028517 gbpln1420.se 1136283639 gbpln1421.se 1270471759 gbpln1422.se 1106145822 gbpln1423.se 1237358153 gbpln1424.se 1388485833 gbpln1425.se 1221364282 gbpln1426.se 1101728075 gbpln1427.se 1191208317 gbpln1428.se 1212231259 gbpln1429.se 1498606076 gbpln143.seq 1132007157 gbpln1430.se 1441955987 gbpln1431.se 1470274017 gbpln1432.se 1459739391 gbpln1433.se 1471760010 gbpln1434.se 1440847993 gbpln1435.se 1455978021 gbpln1436.se 1445045468 gbpln1437.se 1487079619 gbpln1438.se 1481625137 gbpln1439.se 1442798465 gbpln144.seq 1447279971 gbpln1440.se 1048521841 gbpln1441.se 1038155649 gbpln1442.se 833369914 gbpln1443.se 931292853 gbpln1444.se 811379776 gbpln1445.se 1077992421 gbpln1446.se 812614241 gbpln1447.se 1052276437 gbpln1448.se 1035793500 gbpln1449.se 1457724171 gbpln145.seq 832863065 gbpln1450.se 922247149 gbpln1451.se 807661511 gbpln1452.se 1066166792 gbpln1453.se 997697986 gbpln1454.se 1273669998 gbpln1455.se 1102521608 gbpln1456.se 1209618371 gbpln1457.se 1111089963 gbpln1458.se 1160173863 gbpln1459.se 1479937021 gbpln146.seq 1205643923 gbpln1460.se 1237074429 gbpln1461.se 1242683281 gbpln1462.se 1080809951 gbpln1463.se 1226448377 gbpln1464.se 1349517074 gbpln1465.se 1175767295 gbpln1466.se 1216393612 gbpln1467.se 1294608106 gbpln1468.se 1298831146 gbpln1469.se 1491344801 gbpln147.seq 1179380631 gbpln1470.se 1227809679 gbpln1471.se 1347975099 gbpln1472.se 1227045935 gbpln1473.se 1241387663 gbpln1474.se 1256013573 gbpln1475.se 1193254572 gbpln1476.se 1147797534 gbpln1477.se 1185963589 gbpln1478.se 1176623549 gbpln1479.se 1495551806 gbpln148.seq 1184486864 gbpln1480.se 1178497789 gbpln1481.se 1255058842 gbpln1482.se 1121066112 gbpln1483.se 1150746119 gbpln1484.se 1179251586 gbpln1485.se 1319824237 gbpln1486.se 1194499726 gbpln1487.se 1150884349 gbpln1488.se 1183507690 gbpln1489.se 1492595295 gbpln149.seq 1165156001 gbpln1490.se 1145365871 gbpln1491.se 1114264316 gbpln1492.se 1291707339 gbpln1493.se 1200907808 gbpln1494.se 1185642828 gbpln1495.se 1268692726 gbpln1496.se 1272919740 gbpln1497.se 1103058293 gbpln1498.se 1122948169 gbpln1499.se 1498861659 gbpln15.seq 1475790089 gbpln150.seq 1380211964 gbpln1500.se 1129155752 gbpln1501.se 1160577179 gbpln1502.se 1260272465 gbpln1503.se 1277796255 gbpln1504.se 1077009676 gbpln1505.se 1159931140 gbpln1506.se 1298671970 gbpln1507.se 1092881838 gbpln1508.se 1120436751 gbpln1509.se 1477822066 gbpln151.seq 1214127484 gbpln1510.se 1117793568 gbpln1511.se 1019835845 gbpln1512.se 1155398208 gbpln1513.se 1368620547 gbpln1514.se 1144165987 gbpln1515.se 1072392038 gbpln1516.se 1310090643 gbpln1517.se 1319048580 gbpln1518.se 1215502441 gbpln1519.se 1462101378 gbpln152.seq 1273213186 gbpln1520.se 1439841249 gbpln1521.se 1291263009 gbpln1522.se 1286241610 gbpln1523.se 1263097019 gbpln1524.se 1297997061 gbpln1525.se 1325335047 gbpln1526.se 1216230086 gbpln1527.se 1263623365 gbpln1528.se 1174025246 gbpln1529.se 1497200933 gbpln153.seq 1229634720 gbpln1530.se 1363681880 gbpln1531.se 1218381114 gbpln1532.se 1400966274 gbpln1533.se 1382372152 gbpln1534.se 1176735776 gbpln1535.se 1259998472 gbpln1536.se 1429872810 gbpln1537.se 1290195552 gbpln1538.se 1118855412 gbpln1539.se 1497415098 gbpln154.seq 1286015571 gbpln1540.se 1309057752 gbpln1541.se 1189205456 gbpln1542.se 1088738989 gbpln1543.se 1310436046 gbpln1544.se 1233749054 gbpln1545.se 1059963756 gbpln1546.se 1254487335 gbpln1547.se 1310743734 gbpln1548.se 1233633287 gbpln1549.se 1230413080 gbpln155.seq 1257623330 gbpln1550.se 1136790411 gbpln1551.se 1024083293 gbpln1552.se 1208012116 gbpln1553.se 1341166334 gbpln1554.se 1178296123 gbpln1555.se 1133776595 gbpln1556.se 1321198791 gbpln1557.se 1307075748 gbpln1558.se 1194598078 gbpln1559.se 847363052 gbpln156.seq 1267960855 gbpln1560.se 1465597963 gbpln1561.se 1272760183 gbpln1562.se 1248553572 gbpln1563.se 997697304 gbpln1564.se 1273669316 gbpln1565.se 1102520926 gbpln1566.se 1209617689 gbpln1567.se 1111089281 gbpln1568.se 1160173181 gbpln1569.se 1005396841 gbpln157.seq 1205643241 gbpln1570.se 1237073747 gbpln1571.se 1242682599 gbpln1572.se 1080809269 gbpln1573.se 1226447695 gbpln1574.se 1349516392 gbpln1575.se 1175766613 gbpln1576.se 1216392639 gbpln1577.se 1306535163 gbpln1578.se 1471600767 gbpln1579.se 963947636 gbpln158.seq 1474480099 gbpln1580.se 1442648460 gbpln1581.se 1445144506 gbpln1582.se 1470808023 gbpln1583.se 1400146173 gbpln1584.se 1451194528 gbpln1585.se 1491931525 gbpln1586.se 1485075954 gbpln1587.se 1464218638 gbpln1588.se 1464354463 gbpln1589.se 1459631632 gbpln159.seq 1434708321 gbpln1590.se 1446304634 gbpln1591.se 1481913454 gbpln1592.se 225362530 gbpln1593.se 2549738660 gbpln1594.se 1967027328 gbpln1595.se 1908341558 gbpln1596.se 1899626925 gbpln1597.se 1507440270 gbpln1598.se 1195338085 gbpln1599.se 1499242007 gbpln16.seq 748612126 gbpln160.seq 1471685919 gbpln1600.se 1482476333 gbpln1601.se 1457504784 gbpln1602.se 1489313455 gbpln1603.se 1498865598 gbpln1604.se 997934006 gbpln1605.se 832020729 gbpln1606.se 803030138 gbpln1607.se 771628223 gbpln1608.se 1448711979 gbpln1609.se 952879187 gbpln161.seq 1240387718 gbpln1610.se 1254120972 gbpln1611.se 1355940856 gbpln1612.se 1218508495 gbpln1613.se 1405315859 gbpln1614.se 971627123 gbpln1615.se 850272715 gbpln1616.se 849609082 gbpln1617.se 850190924 gbpln1618.se 976829654 gbpln1619.se 925770625 gbpln162.seq 814643125 gbpln1620.se 879514342 gbpln1621.se 812317704 gbpln1622.se 1488237027 gbpln1623.se 944480603 gbpln1624.se 1488070952 gbpln1625.se 1498634832 gbpln1626.se 1496264712 gbpln1627.se 1489792519 gbpln1628.se 1231600041 gbpln1629.se 679052523 gbpln163.seq 1265330116 gbpln1630.se 1488619214 gbpln1631.se 1499817121 gbpln1632.se 1330362587 gbpln1633.se 1240461713 gbpln1634.se 1332036329 gbpln1635.se 1277787876 gbpln1636.se 1478171319 gbpln1637.se 1308033872 gbpln1638.se 1388656433 gbpln1639.se 891360401 gbpln164.seq 1443471168 gbpln1640.se 1413408953 gbpln1641.se 548537029 gbpln1642.se 1225077527 gbpln1643.se 720006493 gbpln1644.se 919172194 gbpln1645.se 874099561 gbpln1646.se 897784196 gbpln1647.se 876816853 gbpln1648.se 928190368 gbpln1649.se 983898073 gbpln165.seq 951802003 gbpln1650.se 824940722 gbpln1651.se 1489306195 gbpln1652.se 1440059389 gbpln1653.se 1482809012 gbpln1654.se 1486345764 gbpln1655.se 1467102609 gbpln1656.se 1478834238 gbpln1657.se 1444208200 gbpln1658.se 1483418667 gbpln1659.se 816632077 gbpln166.seq 1450848094 gbpln1660.se 1437771931 gbpln1661.se 1444812712 gbpln1662.se 1488993344 gbpln1663.se 1446871084 gbpln1664.se 1494839831 gbpln1665.se 1496741541 gbpln1666.se 1374411960 gbpln1667.se 1182248477 gbpln1668.se 1497598741 gbpln1669.se 1120135193 gbpln167.seq 1491491345 gbpln1670.se 1461709979 gbpln1671.se 1449889995 gbpln1672.se 1495849546 gbpln1673.se 1484634302 gbpln1674.se 1412074936 gbpln1675.se 1405761405 gbpln1676.se 1402453546 gbpln1677.se 1455644102 gbpln1678.se 1455814532 gbpln1679.se 972749686 gbpln168.seq 1446114329 gbpln1680.se 1446417320 gbpln1681.se 917155014 gbpln1682.se 1344094781 gbpln1683.se 1494221919 gbpln1684.se 1499592828 gbpln1685.se 1412833253 gbpln1686.se 1483609453 gbpln1687.se 1452520406 gbpln1688.se 1397047033 gbpln1689.se 850229174 gbpln169.seq 1363158169 gbpln1690.se 1095290873 gbpln1691.se 1407629769 gbpln1692.se 1467698693 gbpln1693.se 1475786928 gbpln1694.se 1473543989 gbpln1695.se 1177921624 gbpln1696.se 1429782007 gbpln1697.se 1449842921 gbpln1698.se 1191589738 gbpln1699.se 1499877669 gbpln17.seq 1055433660 gbpln170.seq 1497010592 gbpln1700.se 1315701164 gbpln1701.se 1281309867 gbpln1702.se 1464811778 gbpln1703.se 1494393829 gbpln1704.se 873807622 gbpln1705.se 1362396542 gbpln1706.se 1296127754 gbpln1707.se 1242755788 gbpln1708.se 1236451053 gbpln1709.se 1010018946 gbpln171.seq 1161997091 gbpln1710.se 1077269694 gbpln1711.se 1063032754 gbpln1712.se 1035835981 gbpln1713.se 1035095313 gbpln1714.se 1031632940 gbpln1715.se 978747642 gbpln1716.se 979039775 gbpln1717.se 970029823 gbpln1718.se 965223462 gbpln1719.se 649020564 gbpln172.seq 968357268 gbpln1720.se 1280849387 gbpln1721.se 1277873606 gbpln1722.se 1033073499 gbpln1723.se 1255917596 gbpln1724.se 1033902901 gbpln1725.se 1338307356 gbpln1726.se 1253985607 gbpln1727.se 1211059423 gbpln1728.se 1165332095 gbpln1729.se 926976142 gbpln173.seq 1473761940 gbpln1730.se 1478507707 gbpln1731.se 1406604626 gbpln1732.se 1497359305 gbpln1733.se 1498148324 gbpln1734.se 1470135810 gbpln1735.se 1271154552 gbpln1736.se 1449537429 gbpln1737.se 878967169 gbpln1738.se 1355240038 gbpln1739.se 1412030056 gbpln174.seq 1480516680 gbpln1740.se 1497401637 gbpln1741.se 1490481944 gbpln1742.se 1420494202 gbpln1743.se 1392744913 gbpln1744.se 1498251308 gbpln1745.se 1248523234 gbpln1746.se 1455420277 gbpln1747.se 1417475415 gbpln1748.se 1382790154 gbpln1749.se 1356887733 gbpln175.seq 1392095099 gbpln1750.se 1438579339 gbpln1751.se 1435206085 gbpln1752.se 1438544862 gbpln1753.se 1473935428 gbpln1754.se 1447579761 gbpln1755.se 1397298339 gbpln1756.se 1202495428 gbpln1757.se 1159422590 gbpln1758.se 1142132932 gbpln1759.se 1468866068 gbpln176.seq 1041331622 gbpln1760.se 957152555 gbpln1761.se 1081839501 gbpln1762.se 1445552919 gbpln1763.se 1319425564 gbpln1764.se 1268533720 gbpln1765.se 1109648066 gbpln1766.se 1486501664 gbpln1767.se 1497707315 gbpln1768.se 1422234672 gbpln1769.se 1486380476 gbpln177.seq 1489590944 gbpln1770.se 1478227713 gbpln1771.se 1402600454 gbpln1772.se 1491759977 gbpln1773.se 1344663270 gbpln1774.se 725493360 gbpln1775.se 868135523 gbpln1776.se 882846605 gbpln1777.se 797751389 gbpln1778.se 806424461 gbpln1779.se 1483755130 gbpln178.seq 733757044 gbpln1780.se 1273734389 gbpln1781.se 1332600147 gbpln1782.se 1391180272 gbpln1783.se 1460414227 gbpln1784.se 1492816679 gbpln1785.se 1449473974 gbpln1786.se 1430029422 gbpln1787.se 1067644063 gbpln1788.se 1460876656 gbpln1789.se 1471551413 gbpln179.seq 1372324559 gbpln1790.se 807214472 gbpln1791.se 1476620950 gbpln1792.se 1383029421 gbpln1793.se 1407240135 gbpln1794.se 823995636 gbpln1795.se 779758590 gbpln1796.se 767138463 gbpln1797.se 1459415295 gbpln1798.se 1318422290 gbpln1799.se 1492321788 gbpln18.seq 1430360286 gbpln180.seq 809577106 gbpln1800.se 767635813 gbpln1801.se 1472481285 gbpln1802.se 1489014285 gbpln1803.se 1470984315 gbpln1804.se 783356383 gbpln1805.se 768556688 gbpln1806.se 1437743364 gbpln1807.se 1455697771 gbpln1808.se 827116263 gbpln1809.se 1354708414 gbpln181.seq 785947999 gbpln1810.se 765845200 gbpln1811.se 1449229608 gbpln1812.se 1406361789 gbpln1813.se 789953322 gbpln1814.se 1476310111 gbpln1815.se 1381424733 gbpln1816.se 1399187032 gbpln1817.se 828245843 gbpln1818.se 784946746 gbpln1819.se 1360985782 gbpln182.seq 762930721 gbpln1820.se 1442020097 gbpln1821.se 1446746274 gbpln1822.se 839668894 gbpln1823.se 780847594 gbpln1824.se 766352668 gbpln1825.se 1433384069 gbpln1826.se 1448399892 gbpln1827.se 830761006 gbpln1828.se 781576153 gbpln1829.se 1498274774 gbpln183.seq 770532847 gbpln1830.se 1451368039 gbpln1831.se 1456351185 gbpln1832.se 1469113773 gbpln1833.se 1493659421 gbpln1834.se 1334364137 gbpln1835.se 1341348990 gbpln1836.se 1487354963 gbpln1837.se 443688365 gbpln1838.se 1310990192 gbpln1839.se 1493955474 gbpln184.seq 936978374 gbpln1840.se 920269142 gbpln1841.se 883112886 gbpln1842.se 832543127 gbpln1843.se 1498857428 gbpln1844.se 1476584173 gbpln1845.se 952859598 gbpln1846.se 787766863 gbpln1847.se 1428004358 gbpln1848.se 755531660 gbpln1849.se 1431959754 gbpln185.seq 1480074698 gbpln1850.se 1469627882 gbpln1851.se 1183963878 gbpln1852.se 1240333955 gbpln1853.se 1318953961 gbpln1854.se 1188607975 gbpln1855.se 1366617485 gbpln1856.se 1335944846 gbpln1857.se 1266250426 gbpln1858.se 1452816684 gbpln1859.se 1485055855 gbpln186.seq 780043620 gbpln1860.se 905108798 gbpln1861.se 1382990824 gbpln1862.se 1232901940 gbpln1863.se 1440152635 gbpln1864.se 1168368744 gbpln1865.se 1199437811 gbpln1866.se 750909446 gbpln1867.se 1409079072 gbpln1868.se 1372624455 gbpln1869.se 1485757436 gbpln187.seq 1289743162 gbpln1870.se 1460859481 gbpln1871.se 790727412 gbpln1872.se 902368242 gbpln1873.se 1499845871 gbpln1874.se 1365966046 gbpln1875.se 1438204134 gbpln188.seq 1426149679 gbpln189.seq 1498836297 gbpln19.seq 1497872888 gbpln190.seq 1495081791 gbpln191.seq 1484404197 gbpln192.seq 1482220170 gbpln193.seq 1480457424 gbpln194.seq 1491210797 gbpln195.seq 1493134101 gbpln196.seq 1493792066 gbpln197.seq 1480359996 gbpln198.seq 1477246073 gbpln199.seq 1499996634 gbpln2.seq 1493444162 gbpln20.seq 1474958682 gbpln200.seq 1499996520 gbpln201.seq 1499999980 gbpln202.seq 1499997700 gbpln203.seq 931486813 gbpln204.seq 1442962999 gbpln205.seq 1432829714 gbpln206.seq 1493844141 gbpln207.seq 838266744 gbpln208.seq 786074578 gbpln209.seq 1461570444 gbpln21.seq 1469406697 gbpln210.seq 1351709444 gbpln211.seq 1499970886 gbpln212.seq 1499998501 gbpln213.seq 1499999242 gbpln214.seq 1499992267 gbpln215.seq 1499999524 gbpln216.seq 1499998942 gbpln217.seq 1499999650 gbpln218.seq 1489481842 gbpln219.seq 1405009495 gbpln22.seq 1444795352 gbpln220.seq 1495724689 gbpln221.seq 968409350 gbpln222.seq 665291577 gbpln223.seq 860028189 gbpln224.seq 800605872 gbpln225.seq 794469115 gbpln226.seq 1492903391 gbpln227.seq 1017585126 gbpln228.seq 924325157 gbpln229.seq 1410349024 gbpln23.seq 1201978654 gbpln230.seq 1227268207 gbpln231.seq 1152253241 gbpln232.seq 1115248374 gbpln233.seq 1125506105 gbpln234.seq 1145303472 gbpln235.seq 1479140921 gbpln236.seq 1462365456 gbpln237.seq 1468069807 gbpln238.seq 724345875 gbpln239.seq 1486602472 gbpln24.seq 887561680 gbpln240.seq 834970472 gbpln241.seq 826391913 gbpln242.seq 792513917 gbpln243.seq 743209872 gbpln244.seq 1498927764 gbpln245.seq 860028189 gbpln246.seq 800605872 gbpln247.seq 794469115 gbpln248.seq 1492903391 gbpln249.seq 1447069404 gbpln25.seq 997390426 gbpln250.seq 663098252 gbpln251.seq 855592604 gbpln252.seq 807031053 gbpln253.seq 793905039 gbpln254.seq 1491456147 gbpln255.seq 1466632070 gbpln256.seq 840180304 gbpln257.seq 796430245 gbpln258.seq 779180715 gbpln259.seq 1443978080 gbpln26.seq 1486604510 gbpln260.seq 1445385427 gbpln261.seq 831209396 gbpln262.seq 783682955 gbpln263.seq 775938782 gbpln264.seq 1442399440 gbpln265.seq 1471877377 gbpln266.seq 872662143 gbpln267.seq 815663229 gbpln268.seq 813528167 gbpln269.seq 1431713844 gbpln27.seq 780491844 gbpln270.seq 734904793 gbpln271.seq 1451981137 gbpln272.seq 824184474 gbpln273.seq 768070182 gbpln274.seq 1491145948 gbpln275.seq 1472604409 gbpln276.seq 1481497172 gbpln277.seq 783385752 gbpln278.seq 770520351 gbpln279.seq 1433132237 gbpln28.seq 1452863252 gbpln280.seq 1486785182 gbpln281.seq 906907390 gbpln282.seq 844110716 gbpln283.seq 841780855 gbpln284.seq 805270043 gbpln285.seq 764396863 gbpln286.seq 841492595 gbpln287.seq 714482811 gbpln288.seq 916127997 gbpln289.seq 1420175010 gbpln29.seq 858459407 gbpln290.seq 848936990 gbpln291.seq 813129213 gbpln292.seq 765593150 gbpln293.seq 862731158 gbpln294.seq 665885634 gbpln295.seq 854365265 gbpln296.seq 802776346 gbpln297.seq 793295912 gbpln298.seq 1480158894 gbpln299.seq 1499949328 gbpln3.seq 1462499991 gbpln30.seq 1429544600 gbpln300.seq 814320946 gbpln301.seq 759349720 gbpln302.seq 1487159826 gbpln303.seq 1463992028 gbpln304.seq 684180819 gbpln305.seq 873292213 gbpln306.seq 827422505 gbpln307.seq 815925825 gbpln308.seq 779009585 gbpln309.seq 1361699247 gbpln31.seq 739747654 gbpln310.seq 1498046242 gbpln311.seq 849628701 gbpln312.seq 803882830 gbpln313.seq 794420470 gbpln314.seq 1474790996 gbpln315.seq 1469965572 gbpln316.seq 854770002 gbpln317.seq 805931576 gbpln318.seq 798923954 gbpln319.seq 1405185513 gbpln32.seq 1489544894 gbpln320.seq 1467528130 gbpln321.seq 854339916 gbpln322.seq 803900400 gbpln323.seq 791449620 gbpln324.seq 1476207543 gbpln325.seq 1475343864 gbpln326.seq 870939392 gbpln327.seq 809408813 gbpln328.seq 801514137 gbpln329.seq 1469659294 gbpln33.seq 1492438448 gbpln330.seq 1476330312 gbpln331.seq 846934671 gbpln332.seq 794708793 gbpln333.seq 789781753 gbpln334.seq 1475691254 gbpln335.seq 1489470879 gbpln336.seq 888406351 gbpln337.seq 835271741 gbpln338.seq 823533989 gbpln339.seq 1463842015 gbpln34.seq 787819193 gbpln340.seq 748786657 gbpln341.seq 1483648703 gbpln342.seq 1197559587 gbpln343.seq 898446949 gbpln344.seq 628489896 gbpln345.seq 1024113089 gbpln346.seq 1032878661 gbpln347.seq 858694781 gbpln348.seq 960391204 gbpln349.seq 1498027548 gbpln35.seq 1090094606 gbpln350.seq 781959143 gbpln351.seq 946995961 gbpln352.seq 857542781 gbpln353.seq 656405285 gbpln354.seq 907889097 gbpln355.seq 896386890 gbpln356.seq 726432335 gbpln357.seq 798296822 gbpln358.seq 918393750 gbpln359.seq 1351882593 gbpln36.seq 584961784 gbpln360.seq 948865971 gbpln361.seq 954536271 gbpln362.seq 819735731 gbpln363.seq 756588093 gbpln364.seq 876067119 gbpln365.seq 625446321 gbpln366.seq 977801494 gbpln367.seq 854357980 gbpln368.seq 807732556 gbpln369.seq 1351800954 gbpln37.seq 947696453 gbpln370.seq 1067629605 gbpln371.seq 822222048 gbpln372.seq 950272996 gbpln373.seq 1488985571 gbpln374.seq 894745096 gbpln375.seq 893352134 gbpln376.seq 1498806035 gbpln377.seq 1491810166 gbpln378.seq 933986451 gbpln379.seq 1468650835 gbpln38.seq 939527664 gbpln380.seq 810117922 gbpln381.seq 765938558 gbpln382.seq 886537018 gbpln383.seq 623519964 gbpln384.seq 996940649 gbpln385.seq 1030190034 gbpln386.seq 832828033 gbpln387.seq 956342979 gbpln388.seq 1134286144 gbpln389.seq 1469755843 gbpln39.seq 790513299 gbpln390.seq 944161893 gbpln391.seq 860035788 gbpln392.seq 647268685 gbpln393.seq 902239623 gbpln394.seq 1345936752 gbpln395.seq 787834228 gbpln396.seq 910724363 gbpln397.seq 606016896 gbpln398.seq 961485234 gbpln399.seq 1484665361 gbpln4.seq 1497034040 gbpln40.seq 1242775191 gbpln400.seq 1453328788 gbpln401.seq 818591771 gbpln402.seq 766580884 gbpln403.seq 1476620557 gbpln404.seq 1460693671 gbpln405.seq 750738544 gbpln406.seq 1496665003 gbpln407.seq 995069022 gbpln408.seq 1012956234 gbpln409.seq 1492343636 gbpln41.seq 827074347 gbpln410.seq 940621783 gbpln411.seq 1079418810 gbpln412.seq 776922106 gbpln413.seq 938380968 gbpln414.seq 1492330319 gbpln415.seq 891714442 gbpln416.seq 878638403 gbpln417.seq 721632671 gbpln418.seq 779156122 gbpln419.seq 1499134618 gbpln42.seq 895553446 gbpln420.seq 604678568 gbpln421.seq 931006295 gbpln422.seq 933660027 gbpln423.seq 810459540 gbpln424.seq 761872100 gbpln425.seq 878702815 gbpln426.seq 627081460 gbpln427.seq 994320235 gbpln428.seq 999434327 gbpln429.seq 1497555328 gbpln43.seq 823789349 gbpln430.seq 945629782 gbpln431.seq 1062113821 gbpln432.seq 792298939 gbpln433.seq 941851700 gbpln434.seq 850142413 gbpln435.seq 656955691 gbpln436.seq 904094753 gbpln437.seq 900193903 gbpln438.seq 1470079206 gbpln439.seq 1482367657 gbpln44.seq 1497721340 gbpln440.seq 937117048 gbpln441.seq 936021119 gbpln442.seq 812696702 gbpln443.seq 746628212 gbpln444.seq 897168807 gbpln445.seq 626698501 gbpln446.seq 1007072101 gbpln447.seq 1000831797 gbpln448.seq 841918855 gbpln449.seq 1489311909 gbpln45.seq 963426816 gbpln450.seq 1093654114 gbpln451.seq 791118382 gbpln452.seq 959940756 gbpln453.seq 853263842 gbpln454.seq 648051398 gbpln455.seq 901282075 gbpln456.seq 923491092 gbpln457.seq 732477869 gbpln458.seq 789987733 gbpln459.seq 1445921549 gbpln46.seq 926022053 gbpln460.seq 610840579 gbpln461.seq 949759032 gbpln462.seq 955444559 gbpln463.seq 818480442 gbpln464.seq 752251380 gbpln465.seq 897893149 gbpln466.seq 631111272 gbpln467.seq 1022032953 gbpln468.seq 1006306956 gbpln469.seq 1443373575 gbpln47.seq 837035085 gbpln470.seq 966140819 gbpln471.seq 1090560006 gbpln472.seq 800164754 gbpln473.seq 959884028 gbpln474.seq 886916735 gbpln475.seq 641540050 gbpln476.seq 910168783 gbpln477.seq 908785549 gbpln478.seq 729527181 gbpln479.seq 1498200088 gbpln48.seq 797552105 gbpln480.seq 910975470 gbpln481.seq 616026199 gbpln482.seq 945685366 gbpln483.seq 953145956 gbpln484.seq 820081609 gbpln485.seq 763165947 gbpln486.seq 1489098826 gbpln487.seq 1009123187 gbpln488.seq 1016689515 gbpln489.seq 1373091983 gbpln49.seq 832912303 gbpln490.seq 952656374 gbpln491.seq 1065835283 gbpln492.seq 776075044 gbpln493.seq 935940025 gbpln494.seq 1488231655 gbpln495.seq 1487557825 gbpln496.seq 720169483 gbpln497.seq 780564861 gbpln498.seq 1499144496 gbpln499.seq 1441200989 gbpln5.seq 1426038992 gbpln50.seq 934713391 gbpln500.seq 1233388213 gbpln501.seq 807542511 gbpln502.seq 757881986 gbpln503.seq 889760627 gbpln504.seq 635890046 gbpln505.seq 1007873898 gbpln506.seq 1015524558 gbpln507.seq 836625022 gbpln508.seq 959076059 gbpln509.seq 1434527576 gbpln51.seq 1077416379 gbpln510.seq 789416089 gbpln511.seq 958430056 gbpln512.seq 877922843 gbpln513.seq 648665455 gbpln514.seq 907513209 gbpln515.seq 904978028 gbpln516.seq 727024880 gbpln517.seq 789120540 gbpln518.seq 898507915 gbpln519.seq 1477836807 gbpln52.seq 617229811 gbpln520.seq 942711764 gbpln521.seq 964780021 gbpln522.seq 818917331 gbpln523.seq 755294557 gbpln524.seq 882064051 gbpln525.seq 627203691 gbpln526.seq 993595919 gbpln527.seq 1021497440 gbpln528.seq 827286497 gbpln529.seq 1479480118 gbpln53.seq 962451301 gbpln530.seq 1082256067 gbpln531.seq 781463827 gbpln532.seq 919665368 gbpln533.seq 1497522046 gbpln534.seq 905574854 gbpln535.seq 906714977 gbpln536.seq 718743537 gbpln537.seq 787529633 gbpln538.seq 910251919 gbpln539.seq 1319684527 gbpln54.seq 608518276 gbpln540.seq 934541265 gbpln541.seq 954054955 gbpln542.seq 806443717 gbpln543.seq 1009766480 gbpln544.seq 1318260463 gbpln545.seq 1253136609 gbpln546.seq 1066198175 gbpln547.seq 1119572655 gbpln548.seq 1040217505 gbpln549.seq 1291834351 gbpln55.seq 1310077288 gbpln550.seq 955690374 gbpln551.seq 1230684440 gbpln552.seq 1179787958 gbpln553.seq 1125383520 gbpln554.seq 1051194518 gbpln555.seq 965656648 gbpln556.seq 1363518112 gbpln557.seq 1497325995 gbpln558.seq 787261705 gbpln559.seq 1497065990 gbpln56.seq 773098599 gbpln560.seq 1456694585 gbpln561.seq 1200145527 gbpln562.seq 1449107426 gbpln563.seq 1445293522 gbpln564.seq 1219201533 gbpln565.seq 1281941476 gbpln566.seq 1485920790 gbpln567.seq 1322806126 gbpln568.seq 756143249 gbpln569.seq 1495889390 gbpln57.seq 878426054 gbpln570.seq 631056251 gbpln571.seq 993852367 gbpln572.seq 1020132695 gbpln573.seq 830166807 gbpln574.seq 955723315 gbpln575.seq 1057964328 gbpln576.seq 784007552 gbpln577.seq 947940191 gbpln578.seq 857511193 gbpln579.seq 1287363361 gbpln58.seq 649137171 gbpln580.seq 903393879 gbpln581.seq 908180396 gbpln582.seq 721135945 gbpln583.seq 786739709 gbpln584.seq 918070756 gbpln585.seq 603192844 gbpln586.seq 938102555 gbpln587.seq 955978436 gbpln588.seq 1498148306 gbpln589.seq 1314132044 gbpln59.seq 1442851988 gbpln590.seq 768159651 gbpln591.seq 891261263 gbpln592.seq 1017239134 gbpln593.seq 1036737053 gbpln594.seq 980587319 gbpln595.seq 1096962209 gbpln596.seq 964715275 gbpln597.seq 883795567 gbpln598.seq 879409471 gbpln599.seq 1472320537 gbpln6.seq 1499888056 gbpln60.seq 922242639 gbpln600.seq 805484043 gbpln601.seq 912391541 gbpln602.seq 954577618 gbpln603.seq 1499998343 gbpln604.seq 1499998184 gbpln605.seq 1499811182 gbpln606.seq 1499821684 gbpln607.seq 1499904843 gbpln608.seq 1500000036 gbpln609.seq 1441635456 gbpln61.seq 1499998132 gbpln610.seq 1499945008 gbpln611.seq 1499388631 gbpln612.seq 1499807211 gbpln613.seq 1499997899 gbpln614.seq 1499841232 gbpln615.seq 1499982986 gbpln616.seq 1467355641 gbpln617.seq 723245216 gbpln618.seq 865045961 gbpln619.seq 1442701563 gbpln62.seq 815791689 gbpln620.seq 802718902 gbpln621.seq 1497835829 gbpln622.seq 1489200818 gbpln623.seq 873797632 gbpln624.seq 820367220 gbpln625.seq 806296382 gbpln626.seq 775209384 gbpln627.seq 744231520 gbpln628.seq 817156402 gbpln629.seq 1396494473 gbpln63.seq 771380170 gbpln630.seq 913253142 gbpln631.seq 634934982 gbpln632.seq 1019175188 gbpln633.seq 1023638564 gbpln634.seq 822225605 gbpln635.seq 961290952 gbpln636.seq 1090804562 gbpln637.seq 813694518 gbpln638.seq 962545328 gbpln639.seq 1357918367 gbpln64.seq 873725319 gbpln640.seq 673190932 gbpln641.seq 905064826 gbpln642.seq 908590682 gbpln643.seq 742712720 gbpln644.seq 793279946 gbpln645.seq 934932909 gbpln646.seq 640700840 gbpln647.seq 961568346 gbpln648.seq 952066709 gbpln649.seq 1227296142 gbpln65.seq 1470907411 gbpln650.seq 1315696038 gbpln651.seq 1451561486 gbpln652.seq 1409767917 gbpln653.seq 1192999645 gbpln654.seq 1105379400 gbpln655.seq 1196658436 gbpln656.seq 1136119548 gbpln657.seq 1284507799 gbpln658.seq 1122567296 gbpln659.seq 1477669894 gbpln66.seq 1192074506 gbpln660.seq 1181896740 gbpln661.seq 1430814492 gbpln662.seq 858786663 gbpln663.seq 1482575758 gbpln664.seq 1256005171 gbpln665.seq 1249214474 gbpln666.seq 1164522681 gbpln667.seq 1002097666 gbpln668.seq 1300955592 gbpln669.seq 1486392750 gbpln67.seq 1317957634 gbpln670.seq 1148040939 gbpln671.seq 1403417765 gbpln672.seq 1375754075 gbpln673.seq 1327873437 gbpln674.seq 1281078332 gbpln675.seq 1383451324 gbpln676.seq 1300107704 gbpln677.seq 1290738490 gbpln678.seq 1459920083 gbpln679.seq 1413265901 gbpln68.seq 1006352199 gbpln680.seq 962815279 gbpln681.seq 975138624 gbpln682.seq 906550423 gbpln683.seq 790269619 gbpln684.seq 956926034 gbpln685.seq 908369814 gbpln686.seq 1035806383 gbpln687.seq 1095241384 gbpln688.seq 889046375 gbpln689.seq 1497433984 gbpln69.seq 920177986 gbpln690.seq 934896187 gbpln691.seq 972756494 gbpln692.seq 1478454737 gbpln693.seq 1479400215 gbpln694.seq 1382640922 gbpln695.seq 1372701817 gbpln696.seq 1490030230 gbpln697.seq 1296249908 gbpln698.seq 1454591651 gbpln699.seq 1486763485 gbpln7.seq 1483539734 gbpln70.seq 1470492456 gbpln700.seq 1449617563 gbpln701.seq 1223515912 gbpln702.seq 1372955396 gbpln703.seq 1437909873 gbpln704.seq 1307026425 gbpln705.seq 1462620068 gbpln706.seq 1466603356 gbpln707.seq 1073063047 gbpln708.seq 890586335 gbpln709.seq 1318317824 gbpln71.seq 628166165 gbpln710.seq 1008494769 gbpln711.seq 987228439 gbpln712.seq 843057145 gbpln713.seq 959088226 gbpln714.seq 1080118899 gbpln715.seq 790032688 gbpln716.seq 943744807 gbpln717.seq 858758922 gbpln718.seq 664109823 gbpln719.seq 1495740283 gbpln72.seq 920678547 gbpln720.seq 888501596 gbpln721.seq 739915903 gbpln722.seq 788736235 gbpln723.seq 944601114 gbpln724.seq 621465898 gbpln725.seq 948555730 gbpln726.seq 954911742 gbpln727.seq 854893069 gbpln728.seq 752395251 gbpln729.seq 1490193530 gbpln73.seq 890282441 gbpln730.seq 626588937 gbpln731.seq 1004358313 gbpln732.seq 1028945402 gbpln733.seq 838465030 gbpln734.seq 950517847 gbpln735.seq 1082441570 gbpln736.seq 789583361 gbpln737.seq 950035125 gbpln738.seq 853507173 gbpln739.seq 1492749723 gbpln74.seq 659807142 gbpln740.seq 902654821 gbpln741.seq 890952839 gbpln742.seq 721824594 gbpln743.seq 785634142 gbpln744.seq 909002040 gbpln745.seq 625532225 gbpln746.seq 945667284 gbpln747.seq 953425672 gbpln748.seq 871481110 gbpln749.seq 1451376875 gbpln75.seq 1254084023 gbpln750.seq 1125916060 gbpln751.seq 1182821230 gbpln752.seq 1211366567 gbpln753.seq 746226477 gbpln754.seq 808684469 gbpln755.seq 907082918 gbpln756.seq 776688264 gbpln757.seq 1492098096 gbpln758.seq 1287386861 gbpln759.seq 1491338637 gbpln76.seq 1186027473 gbpln760.seq 1009876518 gbpln761.seq 1484585650 gbpln762.seq 1144766377 gbpln763.seq 752395251 gbpln764.seq 890282441 gbpln765.seq 626588937 gbpln766.seq 1004358313 gbpln767.seq 1028945402 gbpln768.seq 838465030 gbpln769.seq 1489169168 gbpln77.seq 950517847 gbpln770.seq 1082441570 gbpln771.seq 789583361 gbpln772.seq 950035125 gbpln773.seq 853507173 gbpln774.seq 659807142 gbpln775.seq 902654821 gbpln776.seq 890952839 gbpln777.seq 721824594 gbpln778.seq 785634142 gbpln779.seq 1409365495 gbpln78.seq 909002040 gbpln780.seq 625532225 gbpln781.seq 945667284 gbpln782.seq 953425672 gbpln783.seq 1496387869 gbpln784.seq 660302813 gbpln785.seq 841140962 gbpln786.seq 1479991498 gbpln787.seq 1471774772 gbpln788.seq 1499491526 gbpln789.seq 1472504601 gbpln79.seq 1497490496 gbpln790.seq 1492455770 gbpln791.seq 1465220219 gbpln792.seq 1469411527 gbpln793.seq 1468988514 gbpln794.seq 1470643875 gbpln795.seq 1445523370 gbpln796.seq 1467112589 gbpln797.seq 1473756313 gbpln798.seq 1467448952 gbpln799.seq 1422472053 gbpln8.seq 1449559676 gbpln80.seq 1445506294 gbpln800.seq 1405467369 gbpln801.seq 1440178564 gbpln802.seq 1419442824 gbpln803.seq 1343375454 gbpln804.seq 1368729073 gbpln805.seq 1441459202 gbpln806.seq 1481187930 gbpln807.seq 1441199233 gbpln808.seq 1400519486 gbpln809.seq 1481961805 gbpln81.seq 1484052531 gbpln810.seq 1375272260 gbpln811.seq 898515506 gbpln812.seq 632797874 gbpln813.seq 1008257523 gbpln814.seq 1024893589 gbpln815.seq 849343329 gbpln816.seq 961475028 gbpln817.seq 1105697901 gbpln818.seq 806976002 gbpln819.seq 1484043236 gbpln82.seq 970149905 gbpln820.seq 872154954 gbpln821.seq 676154112 gbpln822.seq 905516393 gbpln823.seq 922918521 gbpln824.seq 742368603 gbpln825.seq 788401116 gbpln826.seq 929538621 gbpln827.seq 641895628 gbpln828.seq 961976136 gbpln829.seq 1439343076 gbpln83.seq 973033369 gbpln830.seq 834845237 gbpln831.seq 1096228945 gbpln832.seq 1065747701 gbpln833.seq 978382753 gbpln834.seq 970377845 gbpln835.seq 932157797 gbpln836.seq 878151180 gbpln837.seq 874085481 gbpln838.seq 829265282 gbpln839.seq 1433849050 gbpln84.seq 863296712 gbpln840.seq 823515696 gbpln841.seq 815413878 gbpln842.seq 1384284611 gbpln843.seq 1351462558 gbpln844.seq 1230738646 gbpln845.seq 541733671 gbpln846.seq 2012725364 gbpln847.seq 2313576156 gbpln848.seq 2199353950 gbpln849.seq 1428892929 gbpln85.seq 2096617948 gbpln850.seq 2106642320 gbpln851.seq 1745413839 gbpln852.seq 1943630373 gbpln853.seq 1096169796 gbpln854.seq 836152673 gbpln855.seq 790234194 gbpln856.seq 768134126 gbpln857.seq 1464177021 gbpln858.seq 1454383718 gbpln859.seq 1437482363 gbpln86.seq 839765734 gbpln860.seq 794136795 gbpln861.seq 777214951 gbpln862.seq 1459963687 gbpln863.seq 1453910479 gbpln864.seq 831555004 gbpln865.seq 787385081 gbpln866.seq 774061568 gbpln867.seq 1444041489 gbpln868.seq 1462025010 gbpln869.seq 1434708607 gbpln87.seq 837904862 gbpln870.seq 793009108 gbpln871.seq 770582515 gbpln872.seq 1458992600 gbpln873.seq 1472670481 gbpln874.seq 837974598 gbpln875.seq 802983165 gbpln876.seq 776399714 gbpln877.seq 1452076153 gbpln878.seq 1467682458 gbpln879.seq 1446968733 gbpln88.seq 841987686 gbpln880.seq 800255273 gbpln881.seq 776782162 gbpln882.seq 765490377 gbpln883.seq 737409430 gbpln884.seq 1467554404 gbpln885.seq 838067528 gbpln886.seq 794050154 gbpln887.seq 769006556 gbpln888.seq 1456537014 gbpln889.seq 1455795139 gbpln89.seq 1456423618 gbpln890.seq 831709069 gbpln891.seq 788018841 gbpln892.seq 776335168 gbpln893.seq 1447227789 gbpln894.seq 1462058949 gbpln895.seq 831948387 gbpln896.seq 792155197 gbpln897.seq 764395261 gbpln898.seq 1469026352 gbpln899.seq 1201022408 gbpln9.seq 1470543353 gbpln90.seq 1457035184 gbpln900.seq 832913530 gbpln901.seq 783381752 gbpln902.seq 777226067 gbpln903.seq 1449010172 gbpln904.seq 1460033796 gbpln905.seq 856583955 gbpln906.seq 800941651 gbpln907.seq 764839741 gbpln908.seq 1463437686 gbpln909.seq 1379500687 gbpln91.seq 1457211427 gbpln910.seq 838548262 gbpln911.seq 802434968 gbpln912.seq 775426579 gbpln913.seq 1468251987 gbpln914.seq 1456996279 gbpln915.seq 836584180 gbpln916.seq 794556423 gbpln917.seq 763379902 gbpln918.seq 1472540375 gbpln919.seq 818536597 gbpln92.seq 1467456048 gbpln920.seq 841588737 gbpln921.seq 793586133 gbpln922.seq 774193866 gbpln923.seq 1483592340 gbpln924.seq 1464730710 gbpln925.seq 832767207 gbpln926.seq 787519847 gbpln927.seq 773580778 gbpln928.seq 1453968537 gbpln929.seq 744339770 gbpln93.seq 1458876981 gbpln930.seq 836647345 gbpln931.seq 804025438 gbpln932.seq 780287537 gbpln933.seq 1456910351 gbpln934.seq 1461116471 gbpln935.seq 847868245 gbpln936.seq 799503371 gbpln937.seq 769858205 gbpln938.seq 1451384310 gbpln939.seq 840483635 gbpln94.seq 1448178188 gbpln940.seq 841182040 gbpln941.seq 790643457 gbpln942.seq 771991395 gbpln943.seq 1449905950 gbpln944.seq 799948093 gbpln945.seq 836052022 gbpln946.seq 791807902 gbpln947.seq 771195580 gbpln948.seq 1452626436 gbpln949.seq 1482268557 gbpln95.seq 1452862184 gbpln950.seq 666670553 gbpln951.seq 841954476 gbpln952.seq 801058907 gbpln953.seq 777293272 gbpln954.seq 1485779605 gbpln955.seq 1452913122 gbpln956.seq 836617454 gbpln957.seq 790837079 gbpln958.seq 777459210 gbpln959.seq 1445216053 gbpln96.seq 1453527109 gbpln960.seq 1454781569 gbpln961.seq 839842770 gbpln962.seq 793797445 gbpln963.seq 776363694 gbpln964.seq 1456772381 gbpln965.seq 1466569983 gbpln966.seq 845148875 gbpln967.seq 804833074 gbpln968.seq 778470839 gbpln969.seq 1499019777 gbpln97.seq 1481006670 gbpln970.seq 1474068832 gbpln971.seq 794180239 gbpln972.seq 774312132 gbpln973.seq 1457303714 gbpln974.seq 835115957 gbpln975.seq 1457626964 gbpln976.seq 836718375 gbpln977.seq 801816183 gbpln978.seq 780710756 gbpln979.seq 1471007440 gbpln98.seq 1487855625 gbpln980.seq 1468374097 gbpln981.seq 835020954 gbpln982.seq 794498287 gbpln983.seq 775035873 gbpln984.seq 1474921681 gbpln985.seq 1459702204 gbpln986.seq 836763143 gbpln987.seq 794319484 gbpln988.seq 771563217 gbpln989.seq 1497460972 gbpln99.seq 1442336041 gbpln990.seq 1461924552 gbpln991.seq 835744192 gbpln992.seq 793808493 gbpln993.seq 775366858 gbpln994.seq 1452650569 gbpln995.seq 1461461119 gbpln996.seq 839340147 gbpln997.seq 793588554 gbpln998.seq 778845058 gbpln999.seq 1499992998 gbpri1.seq 1394043154 gbpri10.seq 1495964572 gbpri100.seq 1318392032 gbpri101.seq 1355571629 gbpri102.seq 1445745824 gbpri103.seq 1442671889 gbpri104.seq 1493536509 gbpri105.seq 1403137257 gbpri106.seq 1444919461 gbpri107.seq 1410522937 gbpri108.seq 1451687101 gbpri109.seq 1308233895 gbpri11.seq 1408933533 gbpri110.seq 1456495937 gbpri111.seq 1387816181 gbpri112.seq 1404931846 gbpri113.seq 1432578708 gbpri114.seq 1405440011 gbpri115.seq 1338627748 gbpri116.seq 1340905028 gbpri117.seq 1453101243 gbpri118.seq 1324362889 gbpri119.seq 1352591724 gbpri12.seq 1324397641 gbpri120.seq 1408571537 gbpri121.seq 1275737568 gbpri122.seq 1421464150 gbpri123.seq 1495167941 gbpri124.seq 1455208542 gbpri125.seq 1403991861 gbpri126.seq 1446257073 gbpri127.seq 1384095134 gbpri128.seq 1445278199 gbpri129.seq 1495555692 gbpri13.seq 1293353386 gbpri130.seq 1433367948 gbpri131.seq 1395378867 gbpri132.seq 1276602476 gbpri133.seq 1438054241 gbpri134.seq 1467541000 gbpri135.seq 1320863092 gbpri136.seq 1456536651 gbpri137.seq 1466610863 gbpri138.seq 1359780806 gbpri139.seq 1402237462 gbpri14.seq 1499943067 gbpri140.seq 1475693129 gbpri141.seq 1260750539 gbpri142.seq 1495098301 gbpri143.seq 1238904125 gbpri144.seq 1242283958 gbpri145.seq 1479001314 gbpri146.seq 1432304969 gbpri147.seq 1492676945 gbpri148.seq 1476290353 gbpri149.seq 1487902997 gbpri15.seq 1442607100 gbpri150.seq 1456981003 gbpri151.seq 1443625247 gbpri152.seq 1400092576 gbpri153.seq 1345137226 gbpri154.seq 1373185934 gbpri155.seq 1434010548 gbpri156.seq 1490297845 gbpri157.seq 1429267901 gbpri158.seq 1484585056 gbpri159.seq 1347857626 gbpri16.seq 1420880036 gbpri160.seq 1285024893 gbpri161.seq 1370173209 gbpri162.seq 1496306681 gbpri163.seq 1450180646 gbpri164.seq 1341467614 gbpri165.seq 1387332345 gbpri166.seq 1470704693 gbpri167.seq 1354403503 gbpri168.seq 1344504790 gbpri169.seq 1491380503 gbpri17.seq 1462427536 gbpri170.seq 1432074004 gbpri171.seq 1333079314 gbpri172.seq 1466026810 gbpri173.seq 1446816413 gbpri174.seq 1384264132 gbpri175.seq 1458853763 gbpri176.seq 1457412745 gbpri177.seq 1364294010 gbpri178.seq 1401919613 gbpri179.seq 1397668469 gbpri18.seq 1348141524 gbpri180.seq 1422975046 gbpri181.seq 1485417814 gbpri182.seq 1476689128 gbpri183.seq 1397626924 gbpri184.seq 1498120792 gbpri185.seq 1387697250 gbpri186.seq 1416144227 gbpri187.seq 1452703693 gbpri188.seq 1407035473 gbpri189.seq 1369669627 gbpri19.seq 1288712580 gbpri190.seq 1248506113 gbpri191.seq 1364854184 gbpri192.seq 1479558812 gbpri193.seq 1366753503 gbpri194.seq 1489166909 gbpri195.seq 1415801198 gbpri196.seq 1384022664 gbpri197.seq 1434572298 gbpri198.seq 1381901910 gbpri199.seq 1499865965 gbpri2.seq 1439722114 gbpri20.seq 1439604557 gbpri200.seq 1405041057 gbpri201.seq 1483127194 gbpri202.seq 1380666928 gbpri203.seq 1470392437 gbpri204.seq 1487830678 gbpri205.seq 1434611604 gbpri206.seq 1456507913 gbpri207.seq 1404327410 gbpri208.seq 1478530987 gbpri209.seq 1499998573 gbpri21.seq 1216965101 gbpri210.seq 1446664469 gbpri211.seq 1423350776 gbpri212.seq 1494349874 gbpri213.seq 1462051519 gbpri214.seq 1487459860 gbpri215.seq 1346932542 gbpri216.seq 1435992514 gbpri217.seq 1471040937 gbpri218.seq 1411620583 gbpri219.seq 1499972210 gbpri22.seq 1484773618 gbpri220.seq 1346264468 gbpri221.seq 1341625721 gbpri222.seq 1396369090 gbpri223.seq 1400881270 gbpri224.seq 1340397469 gbpri225.seq 1438615217 gbpri226.seq 1325442546 gbpri227.seq 1351884774 gbpri228.seq 1453347110 gbpri229.seq 1433886473 gbpri23.seq 1476115506 gbpri230.seq 1364420628 gbpri231.seq 1472683653 gbpri232.seq 1471719526 gbpri233.seq 1426931843 gbpri234.seq 1473415294 gbpri235.seq 1433692077 gbpri236.seq 1419022466 gbpri237.seq 1462223561 gbpri238.seq 1281714719 gbpri239.seq 1499229052 gbpri24.seq 1459018558 gbpri240.seq 1384280699 gbpri241.seq 1371120703 gbpri242.seq 1466988530 gbpri243.seq 1499909991 gbpri244.seq 1421428560 gbpri245.seq 1498574461 gbpri246.seq 1460703428 gbpri247.seq 1470716420 gbpri248.seq 1433800361 gbpri249.seq 1487414233 gbpri25.seq 1480017837 gbpri250.seq 1376936902 gbpri251.seq 1400467397 gbpri252.seq 1475236263 gbpri253.seq 1496630249 gbpri254.seq 1468620991 gbpri255.seq 1474162791 gbpri256.seq 1396104189 gbpri257.seq 1346586479 gbpri258.seq 1347952902 gbpri259.seq 1493262066 gbpri26.seq 1298764233 gbpri260.seq 1427293566 gbpri261.seq 1494008872 gbpri262.seq 1470822249 gbpri263.seq 1419747378 gbpri264.seq 1464271928 gbpri265.seq 1450721835 gbpri266.seq 1396794441 gbpri267.seq 1499094281 gbpri268.seq 1462020778 gbpri269.seq 1407053883 gbpri27.seq 1456716634 gbpri270.seq 1423150660 gbpri271.seq 1334733868 gbpri272.seq 1477093306 gbpri273.seq 1401382229 gbpri274.seq 1344819957 gbpri275.seq 1335018581 gbpri276.seq 1393585317 gbpri277.seq 1492681989 gbpri278.seq 1394057394 gbpri279.seq 1441456060 gbpri28.seq 1306374829 gbpri280.seq 1459492320 gbpri281.seq 1283178271 gbpri282.seq 1394896273 gbpri283.seq 1413425043 gbpri284.seq 1411752861 gbpri285.seq 1458158066 gbpri286.seq 1447911944 gbpri287.seq 1416279069 gbpri288.seq 1354359649 gbpri289.seq 1380240636 gbpri29.seq 1335473768 gbpri290.seq 1477859325 gbpri291.seq 1444661086 gbpri292.seq 1220138079 gbpri293.seq 1454577601 gbpri294.seq 1318715138 gbpri295.seq 1387096617 gbpri296.seq 1386291267 gbpri297.seq 1285515157 gbpri298.seq 1381683190 gbpri299.seq 1499835984 gbpri3.seq 1416177736 gbpri30.seq 1315306325 gbpri300.seq 1344125998 gbpri301.seq 1479620330 gbpri302.seq 1397358101 gbpri303.seq 1380192545 gbpri304.seq 1351740135 gbpri305.seq 1389255921 gbpri306.seq 1454933355 gbpri307.seq 1483361280 gbpri308.seq 1487165286 gbpri309.seq 1449889074 gbpri31.seq 1483238733 gbpri310.seq 1437384214 gbpri311.seq 1449717924 gbpri312.seq 1347588235 gbpri313.seq 1454975982 gbpri314.seq 1420356842 gbpri315.seq 1298170956 gbpri316.seq 1423364495 gbpri317.seq 1446686181 gbpri318.seq 1382434322 gbpri319.seq 1490919852 gbpri32.seq 1336368762 gbpri320.seq 1465383649 gbpri321.seq 1484781680 gbpri322.seq 1443957160 gbpri323.seq 1454606590 gbpri324.seq 1469781588 gbpri325.seq 1450937924 gbpri326.seq 1394994063 gbpri327.seq 1406591232 gbpri328.seq 1357023920 gbpri329.seq 1466190397 gbpri33.seq 1427953248 gbpri330.seq 1447872000 gbpri331.seq 1338229282 gbpri332.seq 1403835377 gbpri333.seq 1429580186 gbpri334.seq 1248333550 gbpri335.seq 1402508561 gbpri336.seq 1422378175 gbpri337.seq 1452195282 gbpri338.seq 1305786268 gbpri339.seq 1440000495 gbpri34.seq 1499725723 gbpri340.seq 1491467888 gbpri341.seq 1430438158 gbpri342.seq 1460937361 gbpri343.seq 1465691916 gbpri344.seq 1497771895 gbpri345.seq 1404242887 gbpri346.seq 1450577537 gbpri347.seq 1392382627 gbpri348.seq 1432052149 gbpri349.seq 1299250150 gbpri35.seq 1334212373 gbpri350.seq 1429020982 gbpri351.seq 1423811698 gbpri352.seq 1384476752 gbpri353.seq 1376938780 gbpri354.seq 1315743817 gbpri355.seq 1296914866 gbpri356.seq 1375431616 gbpri357.seq 1499104053 gbpri358.seq 1337266903 gbpri359.seq 1441505962 gbpri36.seq 1387658377 gbpri360.seq 1447004941 gbpri361.seq 1428215933 gbpri362.seq 1356652960 gbpri363.seq 1450829410 gbpri364.seq 1334734998 gbpri365.seq 1204021778 gbpri366.seq 1242592154 gbpri367.seq 1428199143 gbpri368.seq 1315803328 gbpri369.seq 1442377437 gbpri37.seq 1482804994 gbpri370.seq 1476541419 gbpri371.seq 1332772828 gbpri372.seq 1348388802 gbpri373.seq 1317135705 gbpri374.seq 1471839736 gbpri375.seq 1349875606 gbpri376.seq 1449336746 gbpri377.seq 1481089824 gbpri378.seq 1452204000 gbpri379.seq 1454058016 gbpri38.seq 1433019350 gbpri380.seq 1405902907 gbpri381.seq 1430080558 gbpri382.seq 1485814493 gbpri383.seq 1481394732 gbpri384.seq 1493952422 gbpri385.seq 1483650864 gbpri386.seq 1498174621 gbpri387.seq 1332498510 gbpri388.seq 1492344318 gbpri389.seq 1499749892 gbpri39.seq 1344939899 gbpri390.seq 1374624317 gbpri391.seq 1489875387 gbpri392.seq 1437646849 gbpri393.seq 1485043933 gbpri394.seq 1485744358 gbpri395.seq 1492874798 gbpri396.seq 1482252028 gbpri397.seq 1439310195 gbpri398.seq 1482378168 gbpri399.seq 1499966483 gbpri4.seq 1436112761 gbpri40.seq 1499242761 gbpri400.seq 1442385277 gbpri401.seq 1399203187 gbpri402.seq 1469910956 gbpri403.seq 1444342128 gbpri404.seq 1452739846 gbpri405.seq 1499355586 gbpri406.seq 1489531864 gbpri407.seq 1499124071 gbpri408.seq 1398185797 gbpri409.seq 1447805077 gbpri41.seq 1484387503 gbpri410.seq 1463231009 gbpri411.seq 1462310583 gbpri412.seq 1492396590 gbpri413.seq 1422294696 gbpri414.seq 1485131116 gbpri415.seq 1446691494 gbpri416.seq 1450290362 gbpri417.seq 1493916949 gbpri418.seq 1400353287 gbpri419.seq 1469953918 gbpri42.seq 1436356154 gbpri420.seq 1494870306 gbpri421.seq 1478354423 gbpri422.seq 1489520482 gbpri423.seq 1450655713 gbpri424.seq 1495820714 gbpri425.seq 1493735476 gbpri426.seq 1498619752 gbpri427.seq 1491875632 gbpri428.seq 1497685449 gbpri429.seq 1339666235 gbpri43.seq 1460652003 gbpri430.seq 1458781711 gbpri431.seq 1448622684 gbpri432.seq 1379265128 gbpri433.seq 1485291162 gbpri434.seq 1429631124 gbpri435.seq 1421359972 gbpri436.seq 1479107154 gbpri437.seq 1477232500 gbpri438.seq 1494815850 gbpri439.seq 1445286112 gbpri44.seq 1475640926 gbpri440.seq 1495435072 gbpri441.seq 1499853000 gbpri442.seq 1453600199 gbpri443.seq 1449675356 gbpri444.seq 1441802866 gbpri445.seq 1459507426 gbpri446.seq 1499899011 gbpri447.seq 1422394893 gbpri448.seq 1488584120 gbpri449.seq 1458190513 gbpri45.seq 1366139865 gbpri450.seq 1489791401 gbpri451.seq 1429504375 gbpri452.seq 1494493572 gbpri453.seq 1459477896 gbpri454.seq 1499861206 gbpri455.seq 1478968579 gbpri456.seq 1383168329 gbpri457.seq 1490208533 gbpri458.seq 1481469183 gbpri459.seq 1496305448 gbpri46.seq 1487358118 gbpri460.seq 1418280729 gbpri461.seq 1469473522 gbpri462.seq 1475609586 gbpri463.seq 1483950167 gbpri464.seq 1498266223 gbpri465.seq 1481885255 gbpri466.seq 1455217837 gbpri467.seq 1499971714 gbpri468.seq 1470603011 gbpri469.seq 1486466591 gbpri47.seq 1490055628 gbpri470.seq 1487820198 gbpri471.seq 1492122670 gbpri472.seq 1499621014 gbpri473.seq 1392665956 gbpri474.seq 1497966034 gbpri475.seq 1407245725 gbpri476.seq 1494936297 gbpri477.seq 1464587120 gbpri478.seq 1489388730 gbpri479.seq 1499237528 gbpri48.seq 1453664132 gbpri480.seq 1469874871 gbpri481.seq 1485936595 gbpri482.seq 1464835790 gbpri483.seq 1372581275 gbpri484.seq 1299804542 gbpri485.seq 1498843546 gbpri486.seq 1408871474 gbpri487.seq 1425713151 gbpri488.seq 1438590915 gbpri489.seq 1478814770 gbpri49.seq 1382106129 gbpri490.seq 1464637518 gbpri491.seq 1471163774 gbpri492.seq 1442864381 gbpri493.seq 1497298252 gbpri494.seq 1475522136 gbpri495.seq 1479264018 gbpri496.seq 1455146899 gbpri497.seq 1464226394 gbpri498.seq 1486631211 gbpri499.seq 1499769578 gbpri5.seq 1226472415 gbpri50.seq 1473480932 gbpri500.seq 1458695948 gbpri501.seq 1494522166 gbpri502.seq 1454977289 gbpri503.seq 1437991993 gbpri504.seq 1412405226 gbpri505.seq 1463354391 gbpri506.seq 1498494333 gbpri507.seq 1475240191 gbpri508.seq 1473139012 gbpri509.seq 1410747376 gbpri51.seq 1385796031 gbpri510.seq 1421911234 gbpri511.seq 1481060464 gbpri512.seq 1478696369 gbpri513.seq 1479338477 gbpri514.seq 1498211811 gbpri515.seq 1482951586 gbpri516.seq 1494526720 gbpri517.seq 1431030255 gbpri518.seq 1454888822 gbpri519.seq 1373045505 gbpri52.seq 1485236484 gbpri520.seq 1430456405 gbpri521.seq 1455322553 gbpri522.seq 1416195512 gbpri523.seq 1354257429 gbpri524.seq 1467014700 gbpri525.seq 1493520053 gbpri526.seq 1436826054 gbpri527.seq 1499646865 gbpri528.seq 1489056492 gbpri529.seq 1208942574 gbpri53.seq 1484611944 gbpri530.seq 1453792366 gbpri531.seq 1499828025 gbpri532.seq 1481212036 gbpri533.seq 1454546463 gbpri534.seq 1449525084 gbpri535.seq 1494861403 gbpri536.seq 1473073758 gbpri537.seq 1486637996 gbpri538.seq 1497524132 gbpri539.seq 1492722199 gbpri54.seq 1478472937 gbpri540.seq 1491661481 gbpri541.seq 1455424594 gbpri542.seq 1455410131 gbpri543.seq 1486798120 gbpri544.seq 1441337577 gbpri545.seq 1483251288 gbpri546.seq 1441475428 gbpri547.seq 1403877591 gbpri548.seq 1495708282 gbpri549.seq 1397228467 gbpri55.seq 1443829319 gbpri550.seq 1458144264 gbpri551.seq 1461166920 gbpri552.seq 1456151937 gbpri553.seq 1496379177 gbpri554.seq 1437126770 gbpri555.seq 1485094045 gbpri556.seq 1453438439 gbpri557.seq 1474474081 gbpri558.seq 1460119816 gbpri559.seq 1411410910 gbpri56.seq 1330399589 gbpri560.seq 1414825104 gbpri561.seq 1471697740 gbpri562.seq 1433084067 gbpri563.seq 1478274327 gbpri564.seq 1482687860 gbpri565.seq 1482974764 gbpri566.seq 1480469936 gbpri567.seq 1365267937 gbpri568.seq 1484031460 gbpri569.seq 1340419381 gbpri57.seq 1476809977 gbpri570.seq 1481869552 gbpri571.seq 1470047194 gbpri572.seq 1375002197 gbpri573.seq 1488929328 gbpri574.seq 1489028060 gbpri575.seq 1493835205 gbpri576.seq 1486745077 gbpri577.seq 1437553393 gbpri578.seq 1443179149 gbpri579.seq 1441188568 gbpri58.seq 1460602913 gbpri580.seq 1455986166 gbpri581.seq 1498773877 gbpri582.seq 1499035903 gbpri583.seq 1498350785 gbpri584.seq 1324286020 gbpri585.seq 1342005827 gbpri586.seq 1485309573 gbpri587.seq 1467695018 gbpri588.seq 1475508820 gbpri589.seq 1480666117 gbpri59.seq 1447849220 gbpri590.seq 1433586828 gbpri591.seq 1455303102 gbpri592.seq 1394241071 gbpri593.seq 1428383612 gbpri594.seq 1456849852 gbpri595.seq 1478130441 gbpri596.seq 1430906638 gbpri597.seq 1415832047 gbpri598.seq 1489738461 gbpri599.seq 1372350935 gbpri6.seq 1418186863 gbpri60.seq 1493866735 gbpri600.seq 1458388413 gbpri601.seq 1478199348 gbpri602.seq 1417654857 gbpri603.seq 1497983883 gbpri604.seq 1404955585 gbpri605.seq 1492838254 gbpri606.seq 1497134439 gbpri607.seq 1479735906 gbpri608.seq 1472705450 gbpri609.seq 1439810091 gbpri61.seq 1381720975 gbpri610.seq 1416762592 gbpri611.seq 1495558904 gbpri612.seq 1424515521 gbpri613.seq 1477733469 gbpri614.seq 1464718114 gbpri615.seq 1498933031 gbpri616.seq 1490817778 gbpri617.seq 1491458941 gbpri618.seq 1465681968 gbpri619.seq 1457940176 gbpri62.seq 1496819507 gbpri620.seq 1451050267 gbpri621.seq 1437287082 gbpri622.seq 1440304461 gbpri623.seq 1429844247 gbpri624.seq 1475674737 gbpri625.seq 1449628456 gbpri626.seq 1453162683 gbpri627.seq 1498815168 gbpri628.seq 1492324018 gbpri629.seq 1354428010 gbpri63.seq 1482095198 gbpri630.seq 1467968922 gbpri631.seq 1493794103 gbpri632.seq 1497414154 gbpri633.seq 1493271275 gbpri634.seq 1478807514 gbpri635.seq 1314470939 gbpri636.seq 1449436519 gbpri637.seq 1497023848 gbpri638.seq 1474246118 gbpri639.seq 1498318031 gbpri64.seq 1491146957 gbpri640.seq 1496621910 gbpri641.seq 1472111063 gbpri642.seq 1492255475 gbpri643.seq 1495646498 gbpri644.seq 1476243033 gbpri645.seq 1496643022 gbpri646.seq 1483696357 gbpri647.seq 1382824259 gbpri648.seq 1474515975 gbpri649.seq 1404932319 gbpri65.seq 1451559409 gbpri650.seq 1497404699 gbpri651.seq 1455159667 gbpri652.seq 1470661765 gbpri653.seq 1499809421 gbpri654.seq 1474904775 gbpri655.seq 1496245896 gbpri656.seq 1445251994 gbpri657.seq 1479906220 gbpri658.seq 1499478494 gbpri659.seq 1435930533 gbpri66.seq 1493624391 gbpri660.seq 1499851130 gbpri661.seq 1497674665 gbpri662.seq 1411592327 gbpri663.seq 1489420228 gbpri664.seq 1481062305 gbpri665.seq 1441340535 gbpri666.seq 1497169182 gbpri667.seq 1480589150 gbpri668.seq 1486402030 gbpri669.seq 1499500934 gbpri67.seq 1495900570 gbpri670.seq 1491990715 gbpri671.seq 1496800725 gbpri672.seq 1412443957 gbpri673.seq 1498499804 gbpri674.seq 1429865359 gbpri675.seq 1463482208 gbpri676.seq 1499506329 gbpri677.seq 739672202 gbpri678.seq 1386124160 gbpri68.seq 1294623779 gbpri69.seq 1440746568 gbpri7.seq 1438151750 gbpri70.seq 1430161868 gbpri71.seq 1498693701 gbpri72.seq 1488803493 gbpri73.seq 1367919676 gbpri74.seq 1402453123 gbpri75.seq 1382841152 gbpri76.seq 1486197320 gbpri77.seq 1410633473 gbpri78.seq 1352632885 gbpri79.seq 1473652046 gbpri8.seq 1419080565 gbpri80.seq 1458489606 gbpri81.seq 1291215494 gbpri82.seq 1398782649 gbpri83.seq 1353135812 gbpri84.seq 1403280131 gbpri85.seq 1428137974 gbpri86.seq 1334924951 gbpri87.seq 1417624487 gbpri88.seq 1402680643 gbpri89.seq 1441992627 gbpri9.seq 1477087256 gbpri90.seq 1470398745 gbpri91.seq 1341322037 gbpri92.seq 1474094189 gbpri93.seq 1292086729 gbpri94.seq 1414586173 gbpri95.seq 1434986666 gbpri96.seq 1472844685 gbpri97.seq 1361097032 gbpri98.seq 1397531715 gbpri99.seq 812207 gbrel.txt 1499862285 gbrod1.seq 1477931319 gbrod10.seq 1443709248 gbrod100.seq 1487930170 gbrod101.seq 1352000298 gbrod102.seq 1497255342 gbrod103.seq 1215970140 gbrod104.seq 1323685727 gbrod105.seq 1425029177 gbrod106.seq 1436426304 gbrod107.seq 1498137432 gbrod108.seq 1384334707 gbrod109.seq 1365976721 gbrod11.seq 1497989819 gbrod110.seq 1369805604 gbrod111.seq 1375684152 gbrod112.seq 1183129833 gbrod113.seq 1212798272 gbrod114.seq 1430413982 gbrod115.seq 1470331296 gbrod12.seq 1417227931 gbrod13.seq 1471007422 gbrod14.seq 1438813865 gbrod15.seq 1490543396 gbrod16.seq 1383122131 gbrod17.seq 1420672254 gbrod18.seq 1475952043 gbrod19.seq 1499967437 gbrod2.seq 1397046843 gbrod20.seq 1351547492 gbrod21.seq 1434496523 gbrod22.seq 1387638765 gbrod23.seq 1486251329 gbrod24.seq 1347390436 gbrod25.seq 1452122190 gbrod26.seq 1353193118 gbrod27.seq 1370231234 gbrod28.seq 1370743208 gbrod29.seq 1499850426 gbrod3.seq 1453193685 gbrod30.seq 1484525776 gbrod31.seq 1406105502 gbrod32.seq 1474692538 gbrod33.seq 1404292919 gbrod34.seq 1358612176 gbrod35.seq 1325901204 gbrod36.seq 1445832321 gbrod37.seq 1301809704 gbrod38.seq 1459759409 gbrod39.seq 1499968704 gbrod4.seq 1371820929 gbrod40.seq 1379541974 gbrod41.seq 1447951148 gbrod42.seq 1358076947 gbrod43.seq 1393051649 gbrod44.seq 1377941029 gbrod45.seq 1484184886 gbrod46.seq 1439114050 gbrod47.seq 1409951130 gbrod48.seq 1472027087 gbrod49.seq 1239684965 gbrod5.seq 1372610888 gbrod50.seq 1482622482 gbrod51.seq 1393105943 gbrod52.seq 1451159866 gbrod53.seq 1434520361 gbrod54.seq 1444092726 gbrod55.seq 1361891899 gbrod56.seq 1453486986 gbrod57.seq 1458676727 gbrod58.seq 1379094101 gbrod59.seq 1403075066 gbrod6.seq 1475060334 gbrod60.seq 1359302535 gbrod61.seq 1465899229 gbrod62.seq 1295906456 gbrod63.seq 1477278364 gbrod64.seq 1378018089 gbrod65.seq 1390451722 gbrod66.seq 1462626302 gbrod67.seq 1299128117 gbrod68.seq 1371052535 gbrod69.seq 1462509765 gbrod7.seq 1444445568 gbrod70.seq 1478048412 gbrod71.seq 1480151384 gbrod72.seq 1426832728 gbrod73.seq 1455522110 gbrod74.seq 1332398568 gbrod75.seq 1471786581 gbrod76.seq 1376661169 gbrod77.seq 1454859611 gbrod78.seq 1295571253 gbrod79.seq 1380850319 gbrod8.seq 1399344953 gbrod80.seq 1315896821 gbrod81.seq 1411009597 gbrod82.seq 1453282390 gbrod83.seq 1391252549 gbrod84.seq 1498811032 gbrod85.seq 1444865055 gbrod86.seq 1488474687 gbrod87.seq 1331476829 gbrod88.seq 1465473324 gbrod89.seq 1395344650 gbrod9.seq 1416734769 gbrod90.seq 1486479413 gbrod91.seq 1462152570 gbrod92.seq 1423079792 gbrod93.seq 1368356742 gbrod94.seq 1452029512 gbrod95.seq 1391575059 gbrod96.seq 1477641360 gbrod97.seq 1461787631 gbrod98.seq 1303790964 gbrod99.seq 1499999065 gbsts1.seq 1499999696 gbsts2.seq 1449776269 gbsts3.seq 1434571481 gbsyn1.seq 1317756404 gbsyn2.seq 1363478773 gbsyn3.seq 1429349564 gbsyn4.seq 1317756374 gbsyn5.seq 1363478755 gbsyn6.seq 1492035219 gbsyn7.seq 1499987422 gbsyn8.seq 1430902905 gbsyn9.seq 1499999359 gbtsa1.seq 1499998358 gbtsa10.seq 1499999259 gbtsa11.seq 1499996808 gbtsa12.seq 1499995864 gbtsa13.seq 1499999108 gbtsa14.seq 1499997641 gbtsa15.seq 1500000126 gbtsa16.seq 1499998745 gbtsa17.seq 1499996863 gbtsa18.seq 1499998887 gbtsa19.seq 1499998717 gbtsa2.seq 1499998625 gbtsa20.seq 1499997206 gbtsa21.seq 1499998529 gbtsa22.seq 1499998785 gbtsa23.seq 1499998648 gbtsa24.seq 1499999864 gbtsa25.seq 1499998293 gbtsa26.seq 1499996528 gbtsa27.seq 1500000219 gbtsa28.seq 1500000076 gbtsa29.seq 1499998829 gbtsa3.seq 1499999627 gbtsa30.seq 1499999302 gbtsa31.seq 1499999301 gbtsa32.seq 1499997083 gbtsa33.seq 1499997527 gbtsa34.seq 1499999008 gbtsa35.seq 1499997043 gbtsa36.seq 163789411 gbtsa37.seq 1500000215 gbtsa4.seq 1500000258 gbtsa5.seq 1499998665 gbtsa6.seq 1499999377 gbtsa7.seq 1499999658 gbtsa8.seq 1499997214 gbtsa9.seq 7358236 gbuna1.seq 1499955677 gbvrl1.seq 1499998335 gbvrl10.seq 1499995344 gbvrl100.seq 1499971803 gbvrl101.seq 1499966365 gbvrl102.seq 1499967938 gbvrl103.seq 1499938953 gbvrl104.seq 1499965317 gbvrl105.seq 1499987304 gbvrl106.seq 1499987284 gbvrl107.seq 1499957489 gbvrl108.seq 1499959207 gbvrl109.seq 1499998611 gbvrl11.seq 1499935814 gbvrl110.seq 1499982356 gbvrl111.seq 1499947863 gbvrl112.seq 1499933452 gbvrl113.seq 1499990450 gbvrl114.seq 1499974275 gbvrl115.seq 1499993867 gbvrl116.seq 1499944332 gbvrl117.seq 1499985811 gbvrl118.seq 1499979838 gbvrl119.seq 1499994587 gbvrl12.seq 1499967719 gbvrl120.seq 1499952402 gbvrl121.seq 1499998888 gbvrl122.seq 1499961200 gbvrl123.seq 1499985853 gbvrl124.seq 1499954305 gbvrl125.seq 1499946121 gbvrl126.seq 1499995295 gbvrl127.seq 1499952305 gbvrl128.seq 1499980341 gbvrl129.seq 1499997583 gbvrl13.seq 1499968520 gbvrl130.seq 1499956025 gbvrl131.seq 1499938432 gbvrl132.seq 1499982642 gbvrl133.seq 1499952185 gbvrl134.seq 1499978248 gbvrl135.seq 1499958664 gbvrl136.seq 1499949195 gbvrl137.seq 1499998669 gbvrl138.seq 1499979729 gbvrl139.seq 1499997895 gbvrl14.seq 1499986465 gbvrl140.seq 1499951287 gbvrl141.seq 1499981167 gbvrl142.seq 1499955535 gbvrl143.seq 1499960404 gbvrl144.seq 1499996711 gbvrl145.seq 1499992507 gbvrl146.seq 1499954320 gbvrl147.seq 1499933960 gbvrl148.seq 1499955145 gbvrl149.seq 1499999371 gbvrl15.seq 1499944408 gbvrl150.seq 1499940953 gbvrl151.seq 1499979746 gbvrl152.seq 1499951418 gbvrl153.seq 1499959882 gbvrl154.seq 1499956108 gbvrl155.seq 1499986866 gbvrl156.seq 1499990316 gbvrl157.seq 1499986375 gbvrl158.seq 1499973133 gbvrl159.seq 1499965609 gbvrl16.seq 1499988045 gbvrl160.seq 1499998350 gbvrl161.seq 1499999953 gbvrl162.seq 1499976713 gbvrl163.seq 1499933613 gbvrl164.seq 1499952311 gbvrl165.seq 1499982830 gbvrl166.seq 1499956799 gbvrl167.seq 1499973219 gbvrl168.seq 1499955024 gbvrl169.seq 1499954035 gbvrl17.seq 1499982309 gbvrl170.seq 1499842841 gbvrl171.seq 1499956708 gbvrl172.seq 1499957655 gbvrl173.seq 1499936367 gbvrl174.seq 1499969456 gbvrl175.seq 1499940911 gbvrl176.seq 1499986158 gbvrl177.seq 1499934193 gbvrl178.seq 1499960089 gbvrl179.seq 1499966852 gbvrl18.seq 1499968472 gbvrl180.seq 1499964938 gbvrl181.seq 1499957473 gbvrl182.seq 1499910781 gbvrl183.seq 1499946519 gbvrl184.seq 1499997793 gbvrl185.seq 1499934453 gbvrl186.seq 1499981264 gbvrl187.seq 1499981919 gbvrl188.seq 1499991047 gbvrl189.seq 1499983189 gbvrl19.seq 1499999873 gbvrl190.seq 1499980996 gbvrl191.seq 1499988813 gbvrl192.seq 1499970750 gbvrl193.seq 1499996969 gbvrl194.seq 1499996421 gbvrl195.seq 1499964870 gbvrl196.seq 1499997119 gbvrl197.seq 1499976377 gbvrl198.seq 1499958066 gbvrl199.seq 1499996422 gbvrl2.seq 1499961543 gbvrl20.seq 1499993412 gbvrl200.seq 1499997351 gbvrl201.seq 1499994090 gbvrl202.seq 1499984945 gbvrl203.seq 1499994350 gbvrl204.seq 1499986981 gbvrl205.seq 1499979400 gbvrl206.seq 1499987232 gbvrl207.seq 1499985578 gbvrl208.seq 1499972876 gbvrl209.seq 1499996558 gbvrl21.seq 1499983667 gbvrl210.seq 1499995065 gbvrl211.seq 1499978361 gbvrl212.seq 1499981467 gbvrl213.seq 1499998633 gbvrl214.seq 1499997816 gbvrl215.seq 1499980882 gbvrl216.seq 1499990082 gbvrl217.seq 1499964096 gbvrl218.seq 1499974331 gbvrl219.seq 1499990084 gbvrl22.seq 1499963261 gbvrl220.seq 1499961403 gbvrl221.seq 1499971980 gbvrl222.seq 1499978644 gbvrl223.seq 1499960591 gbvrl224.seq 1499983436 gbvrl225.seq 1499978758 gbvrl226.seq 1499972063 gbvrl227.seq 1499979278 gbvrl228.seq 1499997618 gbvrl229.seq 1499950332 gbvrl23.seq 1499999244 gbvrl230.seq 1499994572 gbvrl231.seq 1499968075 gbvrl232.seq 1499993654 gbvrl233.seq 1499970630 gbvrl234.seq 1499976495 gbvrl235.seq 1499995087 gbvrl236.seq 1499963031 gbvrl237.seq 1499985795 gbvrl238.seq 1499984065 gbvrl239.seq 1499964978 gbvrl24.seq 1499980563 gbvrl240.seq 1499966179 gbvrl241.seq 1499979184 gbvrl242.seq 1499972537 gbvrl243.seq 1499978314 gbvrl244.seq 1499993560 gbvrl245.seq 1499967607 gbvrl246.seq 1499990076 gbvrl247.seq 1499974005 gbvrl248.seq 1500000247 gbvrl249.seq 1499962216 gbvrl25.seq 1499991807 gbvrl250.seq 1499999706 gbvrl251.seq 1499962905 gbvrl252.seq 1499989691 gbvrl253.seq 1499974049 gbvrl254.seq 1499992138 gbvrl255.seq 1499978803 gbvrl256.seq 1499980597 gbvrl257.seq 1499970178 gbvrl258.seq 1499999820 gbvrl259.seq 1499938509 gbvrl26.seq 1499999581 gbvrl260.seq 1499968734 gbvrl261.seq 1499975470 gbvrl262.seq 1499995860 gbvrl263.seq 1499993553 gbvrl264.seq 1499961571 gbvrl265.seq 1499986824 gbvrl266.seq 1499973441 gbvrl267.seq 1499997602 gbvrl268.seq 1499967084 gbvrl269.seq 1499961214 gbvrl27.seq 1499996550 gbvrl270.seq 1499972485 gbvrl271.seq 1499989117 gbvrl272.seq 1499970534 gbvrl273.seq 1499960889 gbvrl274.seq 1499983845 gbvrl275.seq 1499965103 gbvrl276.seq 1499959793 gbvrl277.seq 1499984537 gbvrl278.seq 1499983938 gbvrl279.seq 1499973114 gbvrl28.seq 1499981983 gbvrl280.seq 1499969303 gbvrl281.seq 1499990155 gbvrl282.seq 1499973784 gbvrl283.seq 1499985755 gbvrl284.seq 1499974894 gbvrl285.seq 1499996129 gbvrl286.seq 1499973642 gbvrl287.seq 1499987616 gbvrl288.seq 1499998496 gbvrl289.seq 1499972737 gbvrl29.seq 1499979426 gbvrl290.seq 1499984134 gbvrl291.seq 1499996707 gbvrl292.seq 1499966659 gbvrl293.seq 1499961382 gbvrl294.seq 1499984833 gbvrl295.seq 1499962522 gbvrl296.seq 1499995084 gbvrl297.seq 1499965393 gbvrl298.seq 1499970905 gbvrl299.seq 1499994287 gbvrl3.seq 1499963403 gbvrl30.seq 1499967142 gbvrl300.seq 1499987985 gbvrl301.seq 1499984678 gbvrl302.seq 1499977730 gbvrl303.seq 1499969724 gbvrl304.seq 1499984844 gbvrl305.seq 1499978053 gbvrl306.seq 1499988579 gbvrl307.seq 1499979084 gbvrl308.seq 1499991487 gbvrl309.seq 1499981523 gbvrl31.seq 1499973744 gbvrl310.seq 1499978412 gbvrl311.seq 1499982240 gbvrl312.seq 1499976222 gbvrl313.seq 1499986364 gbvrl314.seq 1499987633 gbvrl315.seq 1499974461 gbvrl316.seq 1499976067 gbvrl317.seq 1499963671 gbvrl318.seq 1499995811 gbvrl319.seq 1499943684 gbvrl32.seq 1499974448 gbvrl320.seq 1499940717 gbvrl321.seq 1499957564 gbvrl322.seq 1499991812 gbvrl323.seq 1499936369 gbvrl324.seq 1499951573 gbvrl325.seq 1499983602 gbvrl326.seq 1499960244 gbvrl327.seq 1499965414 gbvrl328.seq 1499960118 gbvrl329.seq 1499985957 gbvrl33.seq 1499995673 gbvrl330.seq 1499947062 gbvrl331.seq 1499979583 gbvrl332.seq 621520049 gbvrl333.seq 1499957255 gbvrl34.seq 1499993346 gbvrl35.seq 1499992300 gbvrl36.seq 1499980992 gbvrl37.seq 1499983645 gbvrl38.seq 1499943056 gbvrl39.seq 1499972234 gbvrl4.seq 1499999469 gbvrl40.seq 1499984521 gbvrl41.seq 1499977131 gbvrl42.seq 1499978151 gbvrl43.seq 1499958018 gbvrl44.seq 1499999211 gbvrl45.seq 1499967431 gbvrl46.seq 1499984761 gbvrl47.seq 1499990755 gbvrl48.seq 1499988766 gbvrl49.seq 1499998615 gbvrl5.seq 1499996409 gbvrl50.seq 1499954386 gbvrl51.seq 1499960654 gbvrl52.seq 1499965917 gbvrl53.seq 1499967921 gbvrl54.seq 1499940725 gbvrl55.seq 1499978417 gbvrl56.seq 1499963742 gbvrl57.seq 1499953893 gbvrl58.seq 1499974498 gbvrl59.seq 1499994292 gbvrl6.seq 1499992412 gbvrl60.seq 1499965269 gbvrl61.seq 1499953511 gbvrl62.seq 1499977316 gbvrl63.seq 1499993342 gbvrl64.seq 1499934235 gbvrl65.seq 1499992945 gbvrl66.seq 1499940828 gbvrl67.seq 1499957486 gbvrl68.seq 1499989843 gbvrl69.seq 1499996473 gbvrl7.seq 1499985624 gbvrl70.seq 1499989663 gbvrl71.seq 1499959114 gbvrl72.seq 1499955442 gbvrl73.seq 1499965838 gbvrl74.seq 1499952128 gbvrl75.seq 1499941041 gbvrl76.seq 1499934928 gbvrl77.seq 1499967300 gbvrl78.seq 1499940208 gbvrl79.seq 1499997597 gbvrl8.seq 1499981174 gbvrl80.seq 1499946585 gbvrl81.seq 1499987862 gbvrl82.seq 1499994172 gbvrl83.seq 1499934985 gbvrl84.seq 1499954757 gbvrl85.seq 1499939218 gbvrl86.seq 1499975362 gbvrl87.seq 1499935044 gbvrl88.seq 1499988517 gbvrl89.seq 1499989067 gbvrl9.seq 1499961049 gbvrl90.seq 1499966880 gbvrl91.seq 1499984696 gbvrl92.seq 1499933338 gbvrl93.seq 1499989571 gbvrl94.seq 1499952714 gbvrl95.seq 1499987854 gbvrl96.seq 1499938148 gbvrl97.seq 1499953800 gbvrl98.seq 1499973828 gbvrl99.seq 1468704363 gbvrt1.seq 1499577589 gbvrt10.seq 1462386314 gbvrt100.seq 1154838449 gbvrt101.seq 1262095184 gbvrt102.seq 1090722360 gbvrt103.seq 1424049174 gbvrt104.seq 1496909957 gbvrt105.seq 1493025075 gbvrt106.seq 1320575219 gbvrt107.seq 1436638097 gbvrt108.seq 1458922406 gbvrt109.seq 1306595972 gbvrt11.seq 1465167303 gbvrt110.seq 1318097988 gbvrt111.seq 1411652468 gbvrt112.seq 1421545558 gbvrt113.seq 1476891269 gbvrt114.seq 1386060829 gbvrt115.seq 1433021643 gbvrt116.seq 1497612563 gbvrt117.seq 1486330678 gbvrt118.seq 1462604299 gbvrt119.seq 1480326998 gbvrt12.seq 1476857854 gbvrt120.seq 1488438777 gbvrt121.seq 1462478284 gbvrt122.seq 1498078979 gbvrt123.seq 1484861739 gbvrt124.seq 1477143564 gbvrt125.seq 1483219404 gbvrt126.seq 1463588150 gbvrt127.seq 1491354277 gbvrt128.seq 1497114650 gbvrt129.seq 1475027624 gbvrt13.seq 1478208496 gbvrt130.seq 1462060438 gbvrt131.seq 1385749837 gbvrt132.seq 1470368193 gbvrt133.seq 1486674105 gbvrt134.seq 1419336196 gbvrt135.seq 1491622767 gbvrt136.seq 1480809421 gbvrt137.seq 1474597440 gbvrt138.seq 1498459033 gbvrt139.seq 1443153129 gbvrt14.seq 1436819628 gbvrt140.seq 1480754470 gbvrt141.seq 1473702580 gbvrt142.seq 1483456760 gbvrt143.seq 1460587689 gbvrt144.seq 1491277907 gbvrt145.seq 1433698722 gbvrt146.seq 1392969255 gbvrt147.seq 1458594989 gbvrt148.seq 1497316015 gbvrt149.seq 1469618929 gbvrt15.seq 1416739574 gbvrt150.seq 1485249531 gbvrt151.seq 1468995634 gbvrt152.seq 1495839785 gbvrt153.seq 1361029027 gbvrt154.seq 1454564111 gbvrt155.seq 1463902579 gbvrt156.seq 1483704254 gbvrt157.seq 1320939161 gbvrt158.seq 1450812981 gbvrt159.seq 1498326298 gbvrt16.seq 1478017801 gbvrt160.seq 1392442116 gbvrt161.seq 1496121979 gbvrt162.seq 1429716567 gbvrt163.seq 1495014546 gbvrt164.seq 1444533644 gbvrt165.seq 1472525288 gbvrt166.seq 1371889473 gbvrt167.seq 1458168336 gbvrt168.seq 1480325666 gbvrt169.seq 1499856808 gbvrt17.seq 1333470830 gbvrt170.seq 1339390452 gbvrt171.seq 1446769447 gbvrt172.seq 1432904863 gbvrt173.seq 1469966670 gbvrt174.seq 1484040009 gbvrt175.seq 1496855706 gbvrt176.seq 1433040470 gbvrt177.seq 1375266246 gbvrt178.seq 1483347947 gbvrt179.seq 1499999476 gbvrt18.seq 1363503090 gbvrt180.seq 1442347330 gbvrt181.seq 1494535064 gbvrt182.seq 1440727248 gbvrt183.seq 1472724385 gbvrt184.seq 1399605061 gbvrt185.seq 1291348384 gbvrt186.seq 1492986566 gbvrt187.seq 1497829903 gbvrt188.seq 1436699186 gbvrt189.seq 1492323235 gbvrt19.seq 1173719027 gbvrt190.seq 1470502273 gbvrt191.seq 1336897357 gbvrt192.seq 1451022601 gbvrt193.seq 1496444625 gbvrt194.seq 1452606394 gbvrt195.seq 1498405608 gbvrt196.seq 1458261551 gbvrt197.seq 1422476619 gbvrt198.seq 1465708115 gbvrt199.seq 1488073608 gbvrt2.seq 1499977540 gbvrt20.seq 1479745451 gbvrt200.seq 1495244154 gbvrt201.seq 1468455350 gbvrt202.seq 1484551004 gbvrt203.seq 1341285700 gbvrt204.seq 1391197912 gbvrt205.seq 1409281707 gbvrt206.seq 1244065533 gbvrt207.seq 1487136121 gbvrt208.seq 1489780401 gbvrt209.seq 1499998471 gbvrt21.seq 1493866969 gbvrt210.seq 1487035640 gbvrt211.seq 1478584592 gbvrt212.seq 1485918275 gbvrt213.seq 1444589689 gbvrt214.seq 1499541605 gbvrt215.seq 1448188156 gbvrt216.seq 889072804 gbvrt217.seq 1750969594 gbvrt218.seq 1582584122 gbvrt219.seq 1499998299 gbvrt22.seq 1439178988 gbvrt220.seq 1385914538 gbvrt221.seq 1260623871 gbvrt222.seq 1241027078 gbvrt223.seq 1394205943 gbvrt224.seq 647635060 gbvrt225.seq 1800655812 gbvrt226.seq 1625880297 gbvrt227.seq 1452341451 gbvrt228.seq 1413268707 gbvrt229.seq 1497572035 gbvrt23.seq 1301679404 gbvrt230.seq 1265017882 gbvrt231.seq 1398329117 gbvrt232.seq 646313711 gbvrt233.seq 2486764648 gbvrt234.seq 2399841711 gbvrt235.seq 2168065652 gbvrt236.seq 1730481357 gbvrt237.seq 1674077467 gbvrt238.seq 1643880041 gbvrt239.seq 1500000075 gbvrt24.seq 1613167793 gbvrt240.seq 1585967368 gbvrt241.seq 1573317635 gbvrt242.seq 1525189779 gbvrt243.seq 1522308102 gbvrt244.seq 1503557506 gbvrt245.seq 1502833827 gbvrt246.seq 1439581620 gbvrt247.seq 1297818631 gbvrt248.seq 1258324368 gbvrt249.seq 1482680520 gbvrt25.seq 1369247334 gbvrt250.seq 1368865938 gbvrt251.seq 1472115430 gbvrt252.seq 1449680126 gbvrt253.seq 1309689855 gbvrt254.seq 1469430849 gbvrt255.seq 1466100957 gbvrt256.seq 1392101492 gbvrt257.seq 1390671725 gbvrt258.seq 1408841519 gbvrt259.seq 1484980244 gbvrt26.seq 1498224495 gbvrt260.seq 1475026708 gbvrt261.seq 1464576040 gbvrt262.seq 1459906041 gbvrt263.seq 1465282649 gbvrt264.seq 286802878 gbvrt265.seq 2737865440 gbvrt266.seq 582597811 gbvrt267.seq 2729824435 gbvrt268.seq 666748676 gbvrt269.seq 1498744695 gbvrt27.seq 2720117404 gbvrt270.seq 646964638 gbvrt271.seq 2731547963 gbvrt272.seq 195179179 gbvrt273.seq 2734657827 gbvrt274.seq 21623841 gbvrt275.seq 2728895745 gbvrt276.seq 2505979018 gbvrt277.seq 2204702755 gbvrt278.seq 1642333222 gbvrt279.seq 1490692340 gbvrt28.seq 1549476405 gbvrt280.seq 1535228181 gbvrt281.seq 1466613005 gbvrt282.seq 1478204774 gbvrt283.seq 1470950309 gbvrt284.seq 186687778 gbvrt285.seq 2736013151 gbvrt286.seq 466831313 gbvrt287.seq 2724707547 gbvrt288.seq 428842069 gbvrt289.seq 1480834605 gbvrt29.seq 2726904396 gbvrt290.seq 418344636 gbvrt291.seq 2737394570 gbvrt292.seq 32900508 gbvrt293.seq 2595542382 gbvrt294.seq 2455087006 gbvrt295.seq 2265220339 gbvrt296.seq 2012454031 gbvrt297.seq 1582208555 gbvrt298.seq 1469382459 gbvrt299.seq 1487660705 gbvrt3.seq 1338749465 gbvrt30.seq 1410611776 gbvrt300.seq 1422190236 gbvrt301.seq 1462005873 gbvrt302.seq 1484741743 gbvrt303.seq 1485090814 gbvrt304.seq 1490723364 gbvrt305.seq 1409295542 gbvrt306.seq 1415524312 gbvrt307.seq 1419887839 gbvrt308.seq 1489003648 gbvrt309.seq 1423257163 gbvrt31.seq 1450997370 gbvrt310.seq 1416322818 gbvrt311.seq 1087669617 gbvrt312.seq 1499731259 gbvrt313.seq 1497257661 gbvrt314.seq 1481805507 gbvrt315.seq 1479706062 gbvrt316.seq 726088557 gbvrt317.seq 1389228052 gbvrt32.seq 1467789570 gbvrt33.seq 1490583831 gbvrt34.seq 1048495703 gbvrt35.seq 1063697372 gbvrt36.seq 1045817455 gbvrt37.seq 1371630420 gbvrt38.seq 1358087426 gbvrt39.seq 1499992628 gbvrt4.seq 1409890116 gbvrt40.seq 1495658777 gbvrt41.seq 1468214202 gbvrt42.seq 1497507497 gbvrt43.seq 1392041424 gbvrt44.seq 838606763 gbvrt45.seq 1154852032 gbvrt46.seq 1294541035 gbvrt47.seq 1495334811 gbvrt48.seq 1471849771 gbvrt49.seq 1460025258 gbvrt5.seq 1495075479 gbvrt50.seq 1443062910 gbvrt51.seq 1495785632 gbvrt52.seq 1476013646 gbvrt53.seq 1465137855 gbvrt54.seq 1282827292 gbvrt55.seq 1432076811 gbvrt56.seq 1499422517 gbvrt57.seq 1473624134 gbvrt58.seq 1494431972 gbvrt59.seq 1488052262 gbvrt6.seq 1230349555 gbvrt60.seq 1413618697 gbvrt61.seq 1330262106 gbvrt62.seq 1463202068 gbvrt63.seq 1491604647 gbvrt64.seq 1469825980 gbvrt65.seq 1495977022 gbvrt66.seq 1412203616 gbvrt67.seq 1485152845 gbvrt68.seq 1499863036 gbvrt69.seq 1498753855 gbvrt7.seq 1421892042 gbvrt70.seq 1440473233 gbvrt71.seq 1451333745 gbvrt72.seq 1480202965 gbvrt73.seq 1472327219 gbvrt74.seq 1468479423 gbvrt75.seq 1483155919 gbvrt76.seq 566961473 gbvrt77.seq 1068402515 gbvrt78.seq 1067356332 gbvrt79.seq 1480906084 gbvrt8.seq 896844818 gbvrt80.seq 805318346 gbvrt81.seq 1275607077 gbvrt82.seq 1208361643 gbvrt83.seq 874873714 gbvrt84.seq 1313422786 gbvrt85.seq 1438940816 gbvrt86.seq 1490321479 gbvrt87.seq 1497249551 gbvrt88.seq 1499997625 gbvrt89.seq 1490946714 gbvrt9.seq 1499999710 gbvrt90.seq 1456553791 gbvrt91.seq 1483558245 gbvrt92.seq 1491731612 gbvrt93.seq 1438387067 gbvrt94.seq 1455534996 gbvrt95.seq 1485012342 gbvrt96.seq 1488248379 gbvrt97.seq 1470679083 gbvrt98.seq 1492360931 gbvrt99.seq 2.2.6 Per-Division Statistics The following table provides a per-division breakdown of the number of sequence entries and the total number of bases of DNA/RNA in each non-CON and non-WGS sequence data file. CON division records, which are constructed from other sequence records, are not represented here because their inclusion would essentially be a form of double-counting. Sequences from Whole Genome Shotgun (WGS) sequencing projects are not represented here because all WGS project data are made available on a per-project basis: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs rather than being incorporated within the GenBank release distribution. Division Entries Bases BCT1 179284 605564943 BCT10 328 678449857 BCT100 258 653923313 BCT101 359 666225283 BCT102 382 696334557 BCT103 245 677775589 BCT104 482 698739746 BCT105 408 682352277 BCT106 468 715318023 BCT107 243 704231055 BCT108 1256 675354276 BCT109 334 654032984 BCT11 398 744648257 BCT110 554 679882975 BCT111 380 662058224 BCT112 427 673149175 BCT113 329 698888880 BCT114 420 680908242 BCT115 327 686296985 BCT116 241 668134081 BCT117 417 665145326 BCT118 430 716996313 BCT119 338 709981986 BCT12 435 754400246 BCT120 231 647784523 BCT121 319 704567319 BCT122 412 670422985 BCT123 662 742273805 BCT124 410 717152916 BCT125 321 683354877 BCT126 297 677891448 BCT127 364 666326934 BCT128 375 781152754 BCT129 318 742043566 BCT13 425 683822718 BCT130 343 670116773 BCT131 405 678786483 BCT132 462 671933260 BCT133 416 686432617 BCT134 402 666124654 BCT135 301 688028886 BCT136 349 761125294 BCT137 354 666397801 BCT138 280 705757914 BCT139 348 664476844 BCT14 577 673816566 BCT140 370 703293834 BCT141 590 645714165 BCT142 296 690904276 BCT143 360 740744954 BCT144 352 677083265 BCT145 319 657661635 BCT146 373 665845086 BCT147 370 664802484 BCT148 823 642524889 BCT149 436 653729620 BCT15 535 671362816 BCT150 493 642663218 BCT151 433 637559932 BCT152 429 639152736 BCT153 427 666799655 BCT154 497 701020063 BCT155 359 678999086 BCT156 439 709219624 BCT157 281 680750761 BCT158 315 746965603 BCT159 446 676199636 BCT16 474 674222103 BCT160 438 668562329 BCT161 380 703501094 BCT162 379 652797711 BCT163 323 668467527 BCT164 505 805501339 BCT165 558 737131098 BCT166 299 679515109 BCT167 300 678258608 BCT168 393 657353752 BCT169 389 658150329 BCT17 311 674180150 BCT170 543 675918377 BCT171 314 678098648 BCT172 513 643910152 BCT173 417 675085408 BCT174 440 664708932 BCT175 401 701050972 BCT176 395 713342384 BCT177 491 683028888 BCT178 373 720617570 BCT179 319 664913032 BCT18 344 676004182 BCT180 363 674628433 BCT181 320 677441321 BCT182 403 669780395 BCT183 429 688867623 BCT184 491 701304637 BCT185 344 663652282 BCT186 387 647871336 BCT187 316 654620175 BCT188 247 646407798 BCT189 512 758846451 BCT19 70027 655383623 BCT190 173 661330423 BCT191 351 652024521 BCT192 344 666342670 BCT193 332 648631216 BCT194 374 681359815 BCT195 372 678730747 BCT196 366 766243201 BCT197 369 932926129 BCT198 393 661835970 BCT199 437 651597274 BCT2 26409 631602615 BCT20 468 673645700 BCT200 412 732795946 BCT201 348 698431104 BCT202 464 708422169 BCT203 537 664226632 BCT204 395 695696610 BCT205 394 641460067 BCT206 432 656304485 BCT207 436 690455904 BCT208 411 670684800 BCT209 413 691698017 BCT21 354 671500075 BCT210 418 665685393 BCT211 355 672685526 BCT212 242 651256533 BCT213 316 676834783 BCT214 412 661098129 BCT215 468 660304733 BCT216 445 693357127 BCT217 274 657840434 BCT218 390 632301559 BCT219 391 646774861 BCT22 470 675185718 BCT220 325 697315878 BCT221 330 691600154 BCT222 358 673368396 BCT223 360 684365716 BCT224 305 663814183 BCT225 400 651649994 BCT226 399 660013263 BCT227 363 676851864 BCT228 246 642444177 BCT229 345 633362681 BCT23 444 676371204 BCT230 311 638993752 BCT231 443 652447670 BCT232 382 656055031 BCT233 562 673125964 BCT234 384 658511744 BCT235 322 699790950 BCT236 347 644453986 BCT237 325 664344637 BCT238 364 639274556 BCT239 391 634115249 BCT24 419 672736918 BCT240 369 621956922 BCT241 319 622001434 BCT242 319 638280773 BCT243 510 755482091 BCT244 431 623488822 BCT245 446 679064917 BCT246 384 648871588 BCT247 273 658962899 BCT248 405 654539611 BCT249 278 663020520 BCT25 387 669570630 BCT250 449 651119210 BCT251 318 644064483 BCT252 344 640971062 BCT253 353 640203068 BCT254 346 667928337 BCT255 336 663965113 BCT256 362 741819082 BCT257 115 649106896 BCT258 120 649642176 BCT259 117 651093970 BCT26 356 683686294 BCT260 142 648325885 BCT261 132 648462192 BCT262 166 645781303 BCT263 154 649572121 BCT264 134 645288206 BCT265 120 648674112 BCT266 148 646806570 BCT267 131 649766889 BCT268 141 646519417 BCT269 311 667371380 BCT27 381 692212796 BCT270 372 695397861 BCT271 327 650349466 BCT272 668 651595974 BCT273 1316 628081928 BCT274 439 663887590 BCT275 271 674245123 BCT276 501 698000880 BCT277 205 628675293 BCT278 305 633512213 BCT279 449 657191988 BCT28 395 694555001 BCT280 357 648862223 BCT281 460 642628835 BCT282 249 628073268 BCT283 459 680382341 BCT284 262 630840981 BCT285 365 702992359 BCT286 414 666751352 BCT287 464 676700325 BCT288 357 641345248 BCT289 306 674229667 BCT29 797 706541943 BCT290 338 646910493 BCT291 416 718107356 BCT292 541 646177494 BCT293 534 672326407 BCT294 508 662494101 BCT295 383 625949983 BCT296 381 619809637 BCT297 388 646721165 BCT298 203 633255201 BCT299 322 633367139 BCT3 380 727573230 BCT30 362 681525364 BCT300 359 630368058 BCT301 340 633335476 BCT302 389 631796772 BCT303 275 650724899 BCT304 407 615278408 BCT305 453 633414690 BCT306 356 671712723 BCT307 312 850868588 BCT308 713 789273469 BCT309 415 666237017 BCT31 294 679385944 BCT310 371 647517554 BCT311 318 663859104 BCT312 270 625321581 BCT313 411 647328671 BCT314 318 643832859 BCT315 482 628393694 BCT316 329 702286044 BCT317 318 660665527 BCT318 344 658431203 BCT319 291 638278501 BCT32 182 650382815 BCT320 392 665189541 BCT321 436 682036639 BCT322 337 648358542 BCT323 352 628298871 BCT324 353 639072464 BCT325 362 660249485 BCT326 371 647631763 BCT327 190 638200382 BCT328 231 618242086 BCT329 478 636646683 BCT33 176 650756403 BCT330 339 634536040 BCT331 327 642989797 BCT332 494 612190954 BCT333 362 679074262 BCT334 425 643580568 BCT335 360 680028674 BCT336 341 646710504 BCT337 517 613881153 BCT338 419 623787467 BCT339 341 632308274 BCT34 333 687723495 BCT340 295 632543316 BCT341 113 618507089 BCT342 266 668801918 BCT343 421 653616692 BCT344 310 629511082 BCT345 272 622630660 BCT346 312 637894463 BCT347 338 601981573 BCT348 374 599208417 BCT349 387 601525446 BCT35 252 702099748 BCT350 365 598357794 BCT351 385 616163718 BCT352 307 624939585 BCT353 207 632667914 BCT354 395 636769916 BCT355 349 669910947 BCT356 347 632382669 BCT357 333 604556585 BCT358 337 627084434 BCT359 293 647765044 BCT36 258 684841890 BCT360 513 647889378 BCT361 361 626706967 BCT362 387 635411203 BCT363 444 611273621 BCT364 572 607252596 BCT365 581 605952139 BCT366 481 623295680 BCT367 328 622233711 BCT368 320 651717444 BCT369 303 624383182 BCT37 308 703122979 BCT370 402 641451922 BCT371 380 608345724 BCT372 346 670143545 BCT373 378 683968002 BCT374 533 646551795 BCT375 448 816528373 BCT376 308 632163702 BCT377 291 659560602 BCT378 373 616218862 BCT379 309 700285684 BCT38 338 696859766 BCT380 255196 521311510 BCT381 18895 618873764 BCT382 118473 633284264 BCT383 143606 579734955 BCT384 439090 461175686 BCT385 345575 540007666 BCT386 33721 770820064 BCT387 4480 720323907 BCT388 183 657588772 BCT389 2054 756028244 BCT39 314 659257489 BCT390 1702 842858069 BCT391 4967 796872965 BCT392 1216 1156273752 BCT393 2519 808926693 BCT394 3244 698256460 BCT395 2651 760172440 BCT396 5471 831696930 BCT397 67452 757229384 BCT398 342861 579261871 BCT399 274795 692028055 BCT4 488 735049964 BCT40 470 666601624 BCT400 186116 737636405 BCT401 551 647045161 BCT402 539 616420277 BCT403 614 618419202 BCT404 721 626903512 BCT405 1355 763548097 BCT406 1331 757463592 BCT407 752 1079352001 BCT408 788 1181222364 BCT409 772 1180452809 BCT41 257 671604557 BCT410 747 1183293812 BCT411 908 1122804354 BCT412 135909 391267116 BCT42 254 674524865 BCT43 253 663878043 BCT44 269 678666910 BCT45 356 671837402 BCT46 296 667279769 BCT47 302 680142930 BCT48 354 666916704 BCT49 318 666142082 BCT5 535 720960951 BCT50 307 659968085 BCT51 404 660945473 BCT52 355 658397269 BCT53 370 666058724 BCT54 352 679695209 BCT55 310 676113332 BCT56 380 665494040 BCT57 314 675189980 BCT58 351 687094772 BCT59 283 680689662 BCT6 421 681407729 BCT60 306 668229610 BCT61 364 676660585 BCT62 385 669830558 BCT63 389 666924900 BCT64 270 664587007 BCT65 378 705487235 BCT66 334 680380801 BCT67 346 668579124 BCT68 365 715856299 BCT69 405 658187753 BCT7 483 668491491 BCT70 303 681477148 BCT71 302 685883371 BCT72 294 680301340 BCT73 332 681219414 BCT74 261 812788435 BCT75 420 673521896 BCT76 546 719959641 BCT77 283 673303473 BCT78 264 674459536 BCT79 295 675721565 BCT8 358 692645123 BCT80 335 744698483 BCT81 326 696770230 BCT82 321 718133404 BCT83 298 718817245 BCT84 445 833910977 BCT85 229 695310061 BCT86 367 683973809 BCT87 308 664161816 BCT88 317 672990666 BCT89 328 687644224 BCT9 306 695151837 BCT90 274 671365532 BCT91 290 695681051 BCT92 368 673844841 BCT93 449 674784714 BCT94 384 712045076 BCT95 333 673735065 BCT96 392 671670238 BCT97 384 682299053 BCT98 304 664052267 BCT99 279 693104913 ENV1 404936 504137599 ENV10 566799 376334904 ENV11 473832 456622585 ENV12 540812 319425255 ENV13 478760 384840200 ENV14 578160 347669877 ENV15 475682 407146652 ENV16 599554 294288615 ENV17 639667 272903480 ENV18 635544 304500635 ENV19 556784 333243476 ENV2 392 739108087 ENV20 580969 418988540 ENV21 517950 394391457 ENV22 263631 577165603 ENV23 230250 723610461 ENV24 35255 1134035872 ENV25 556 1180839460 ENV26 3628 1150410199 ENV27 59602 493112753 ENV3 228 657217903 ENV4 362 694381595 ENV5 190811 642446362 ENV6 587432 403125385 ENV7 619181 388785028 ENV8 601409 331729500 ENV9 654120 366070006 EST1 465977 174308554 EST10 482043 205967454 EST100 517292 306923062 EST101 572037 237459407 EST102 559294 267726281 EST103 438882 278539371 EST104 452379 282544321 EST105 457768 286423598 EST106 453648 316507926 EST107 467276 316307309 EST108 406793 276435371 EST109 452021 300764871 EST11 471711 197507946 EST110 443989 266985079 EST111 429972 269203166 EST112 464096 260991632 EST113 350998 223319813 EST114 476308 240216312 EST115 485257 274643989 EST116 395717 254669198 EST117 482639 288166713 EST118 382325 254197422 EST119 370653 210357762 EST12 322583 106753943 EST120 445442 110879500 EST121 655163 335230361 EST122 444989 268689753 EST123 525350 276989596 EST124 589765 303709580 EST125 513385 307281996 EST126 516694 335998529 EST127 491527 334500574 EST128 532637 311323503 EST129 556498 334057210 EST13 301749 92372308 EST130 598413 377593104 EST131 586158 424805683 EST132 516013 257492321 EST133 450086 57158888 EST134 437282 143245366 EST135 493832 303944482 EST136 425206 296888986 EST137 466065 305456128 EST138 478066 185339736 EST139 439961 279386128 EST14 347472 167081303 EST140 484777 311107403 EST141 426411 268353582 EST142 474499 271881990 EST143 415419 262731400 EST144 308344 202758336 EST145 387556 241562421 EST146 471867 264993844 EST147 468153 269893637 EST148 477754 306027432 EST149 549437 329225324 EST15 493156 244488995 EST150 402350 268360026 EST151 558737 237612444 EST152 547224 277957727 EST153 557383 344790066 EST154 546025 301306957 EST155 604175 356770958 EST156 550234 334143831 EST157 454074 288984513 EST158 470217 251396385 EST159 496106 288116407 EST16 474032 251368095 EST160 524086 332289726 EST161 526572 335112749 EST162 704335 310582306 EST163 523885 268059220 EST164 160508 62179656 EST17 457757 255514548 EST18 450196 229864133 EST19 474469 243734254 EST2 491819 192418565 EST20 456042 290329202 EST21 490016 267396255 EST22 438186 247245089 EST23 475097 272528135 EST24 580925 324451383 EST25 475163 257856181 EST26 435810 254794016 EST27 459609 251074031 EST28 612286 324496600 EST29 477763 253024467 EST3 502232 208186542 EST30 458347 254207984 EST31 441030 288328606 EST32 407520 291487028 EST33 506128 301706328 EST34 646422 372155166 EST35 492892 313664390 EST36 399185 228718847 EST37 251826 94149042 EST38 250653 102524611 EST39 326753 158114824 EST4 481134 204966535 EST40 458553 260614853 EST41 481776 267321459 EST42 445859 239425658 EST43 478003 281971780 EST44 514559 258507525 EST45 432115 256080139 EST46 555545 284627171 EST47 428549 244644468 EST48 427350 248367124 EST49 356408 171252905 EST5 553081 304493059 EST50 380013 160923523 EST51 497766 268661754 EST52 567821 321096038 EST53 424697 286367550 EST54 443979 244346760 EST55 479995 282630884 EST56 435436 238017594 EST57 475812 267264809 EST58 456697 277492215 EST59 423516 247601577 EST6 554208 330648550 EST60 493790 328213670 EST61 453345 279929538 EST62 446534 228511008 EST63 442054 273170269 EST64 430879 276096116 EST65 387044 256147759 EST66 499348 272756277 EST67 492309 275432928 EST68 504996 275600854 EST69 546290 305077232 EST7 540105 306846766 EST70 553829 334809249 EST71 537336 343664681 EST72 571859 312688191 EST73 457976 272413041 EST74 455395 315122095 EST75 437072 292981329 EST76 478581 283595158 EST77 381953 266593478 EST78 394074 275427532 EST79 387013 268154609 EST8 444485 136281758 EST80 405918 312454106 EST81 482029 303562360 EST82 444072 320726420 EST83 527304 302552612 EST84 595653 185509320 EST85 484936 324185653 EST86 500884 319871396 EST87 514673 307428564 EST88 665381 324722530 EST89 573480 246149740 EST9 610686 285528423 EST90 502848 317635102 EST91 506437 296786309 EST92 556465 189646982 EST93 522816 322339813 EST94 435662 248284254 EST95 565188 195459952 EST96 539298 245456385 EST97 565908 213435810 EST98 480324 291578683 EST99 493591 315895139 GSS1 483479 349296758 GSS10 549398 306200402 GSS11 509423 310376613 GSS12 538965 349860615 GSS13 509966 374571319 GSS14 512828 347179763 GSS15 616180 341875744 GSS16 601325 382166328 GSS17 554041 299119263 GSS18 526423 376158987 GSS19 511572 348071364 GSS2 460201 347841793 GSS20 577692 368004477 GSS21 604911 430653437 GSS22 539650 313867816 GSS23 480128 288835407 GSS24 520556 344312424 GSS25 527717 338255365 GSS26 534248 340858599 GSS27 635961 302776424 GSS28 603256 311457182 GSS29 565793 359083465 GSS3 458540 341240724 GSS30 481776 375188147 GSS31 477307 346769440 GSS32 527310 371157179 GSS33 582683 334711180 GSS34 455748 343138471 GSS35 528008 355610411 GSS36 503502 237594580 GSS37 571262 298776721 GSS38 410423 304951180 GSS39 400436 328705208 GSS4 570402 278278440 GSS40 413921 339245797 GSS41 405497 322825444 GSS42 412914 336687443 GSS43 411124 339534803 GSS44 403630 324267442 GSS45 492110 342591421 GSS46 551425 342687655 GSS47 595773 396914217 GSS48 591336 415945153 GSS49 485562 343093739 GSS5 490746 253738527 GSS50 503549 287770639 GSS51 554830 374121090 GSS52 550430 333256703 GSS53 524885 392924779 GSS54 619764 367277711 GSS55 482999 336634680 GSS56 452062 410212064 GSS57 449905 353090294 GSS58 541536 372218794 GSS59 549588 336343465 GSS6 467594 255861593 GSS60 603164 386815772 GSS61 550814 394198266 GSS62 479566 405372981 GSS63 483522 432108982 GSS64 500594 386846589 GSS65 693919 182281475 GSS66 722417 183320408 GSS67 550656 296527024 GSS68 486339 437767473 GSS69 664155 209652989 GSS7 387194 193364516 GSS70 497910 271795430 GSS71 469823 373072015 GSS72 558235 396415803 GSS73 514612 301975971 GSS74 536492 324108794 GSS75 577883 423388755 GSS76 592228 423063871 GSS77 614795 293252526 GSS78 578512 442245852 GSS79 218692 107340587 GSS8 446633 219821351 GSS9 493291 281336228 HTC1 105590 213533747 HTC2 401591 390665398 HTC3 144384 137071023 HTG1 11398 1117560132 HTG10 6350 1134106153 HTG11 7062 1123865166 HTG12 7026 1130939026 HTG13 7013 1154694359 HTG14 7057 1150125682 HTG15 6831 1156870599 HTG16 6287 1141547857 HTG17 6819 1143695002 HTG18 8686 1144543963 HTG19 9215 1092227754 HTG2 7566 1119083438 HTG20 9512 1082832923 HTG21 8342 1123201930 HTG22 7079 1136335249 HTG23 6609 1155598595 HTG24 7648 1153326826 HTG25 5037 585490676 HTG3 5928 1131528069 HTG4 5455 1141252380 HTG5 5356 1144862828 HTG6 5358 1145015310 HTG7 6607 1133078642 HTG8 6863 1144292626 HTG9 6252 1140248232 INV1 273492 651552751 INV10 51 1175944582 INV100 90 1149938021 INV100 24 1183019498 INV100 9 1174682958 INV100 16 1159910001 INV100 10 1125198822 INV100 8 1168893861 INV100 10 1181886938 INV100 11 1124349472 INV100 17 1182045163 INV100 66 1168249651 INV100 46 1181676885 INV101 41 1174569690 INV101 67 1183721606 INV101 61 1183955448 INV101 71 1165637419 INV101 71 1168207696 INV101 71 1182625271 INV101 75 1163687121 INV101 41 1173501709 INV101 26 1181951868 INV101 53 1170041755 INV101 84 1181215442 INV102 74 1182456330 INV102 41 1180714263 INV102 66 1182246249 INV102 11 1133060275 INV102 49 1168521872 INV102 30 1137158099 INV102 5 1073216512 INV102 7 1125700450 INV102 10 1171368215 INV102 13 1116949082 INV102 39 1178586861 INV103 72 1180300921 INV103 57 1180020732 INV103 52 1112683271 INV103 9 1098315678 INV103 36 1180882190 INV103 84 1169985231 INV103 98 1171209577 INV103 74 1182282736 INV103 76 1183432832 INV103 66 1177544287 INV103 36 1173038194 INV104 63 1183268016 INV104 63 1167297517 INV104 57 1151507332 INV104 22 1171547234 INV104 26 1177143463 INV104 26 1139929052 INV104 22 1084854477 INV104 6 1091477445 INV104 8 1085017551 INV104 16 1158537880 INV104 32 1126036225 INV105 46 1172729285 INV105 16 1168305744 INV105 27 1076945583 INV105 10 1168343815 INV105 66 1175042348 INV105 87 1182131347 INV105 61 1128862030 INV105 70 1181778157 INV105 98 1147402933 INV105 52 1179142037 INV105 44 1171761664 INV106 67 1174257075 INV106 47 1163489626 INV106 54 1180334176 INV106 116 1175360765 INV106 55 1182105592 INV106 110 1176156631 INV106 72 1173511525 INV106 73 1172679097 INV106 40 1114811988 INV106 10 1098002852 INV106 52 1174697800 INV107 775 1174689749 INV107 58 1166794818 INV107 40 1164346843 INV107 46 1177065364 INV107 35 1181965147 INV107 34 1069160500 INV107 11 1160223324 INV107 13 1134890516 INV107 22 1172221719 INV107 54 1173700345 INV107 9 1082368318 INV108 61 1157120031 INV108 11 1112847074 INV108 23 1180169940 INV108 163134 482936247 INV109 31 1173292515 INV11 75 1121226569 INV110 42300 972990845 INV111 416786 268623822 INV112 442164 322312362 INV113 451135 362411161 INV114 420793 403994918 INV115 211478 737487094 INV116 335563 911143076 INV117 175987 1007044948 INV118 190032 1023686434 INV119 314674 948962787 INV12 11 1128947860 INV120 532132 812156511 INV121 150793 946789418 INV122 559947 798666922 INV123 333510 935192861 INV124 78775 1084222756 INV125 189063 1020829929 INV126 576789 778256940 INV127 300528 596144943 INV128 286535 109978900 INV129 309498 165661773 INV13 13 1147046285 INV130 428495 366187371 INV131 192064 817718172 INV132 15 1049417950 INV133 5 1069690714 INV134 24 1162836797 INV135 59 1158687670 INV136 846 1177944383 INV137 73 1164213597 INV138 11 1075757141 INV139 915 1173638389 INV14 13 1041715951 INV140 74 1178807631 INV141 82 1182787957 INV142 44 1172446807 INV143 54 1173395201 INV144 77 1175033503 INV145 53 1110435514 INV146 39 1177658136 INV147 46 1156001825 INV148 31 1179378047 INV149 23 1103621514 INV15 120 1124481273 INV150 55 1171906377 INV151 61 1176595073 INV152 22 1065753823 INV153 8 1160095586 INV154 82 1175596191 INV155 61 1160003533 INV156 49 1177578721 INV157 94 1182399343 INV158 107 1164654370 INV159 348 1178754731 INV16 72 1148335729 INV160 81 1173603914 INV161 62 1163741821 INV162 68 1176341161 INV163 23 1117715873 INV164 17 1165496987 INV165 31 1177864835 INV166 63 1173828113 INV167 42 1098488573 INV168 197 1182084174 INV169 43 1173758629 INV17 26 1110333705 INV170 30 1163071443 INV171 33 1150779494 INV172 21 1130641041 INV173 34 1165811549 INV174 69 1167363915 INV175 107 1139707051 INV176 46 1144147418 INV177 64 1181555988 INV178 26 1149655799 INV179 25 1129595560 INV18 11 1152075317 INV180 4 1063536830 INV181 36 1180705104 INV182 26 1177137263 INV183 26 1137588813 INV184 23 1162215868 INV185 38 1009439894 INV186 18 1078663242 INV187 7 1139607402 INV188 63 1109671322 INV189 72 1118897610 INV19 25 1142731532 INV190 36 1075862039 INV191 83 1177178814 INV192 90 1183295929 INV193 49 1163680138 INV194 6 1067536953 INV195 45 1146467224 INV196 19 1046867413 INV197 9 1164226515 INV198 27 1135775304 INV199 133 1102741218 INV2 47329 1061215166 INV20 83 1119700353 INV200 38 1100396957 INV201 13 1179677959 INV202 45 1183185772 INV203 57 1153107140 INV204 29 1135569658 INV205 72 1177627269 INV206 51 1169733098 INV207 35 1148265513 INV208 21 978254821 INV209 37 1153788721 INV21 269 1145330434 INV210 25 1171345473 INV211 25 1138659415 INV212 34 1171237378 INV213 54 1180751072 INV214 13 989789286 INV215 26 1179421211 INV216 41 1084185462 INV217 14 1149630139 INV218 30 1172150422 INV219 12 988256607 INV22 86 1175738999 INV220 46 1181236856 INV221 30 1071303334 INV222 10 1116962374 INV223 39 1105305998 INV224 10 1158047402 INV225 58 1167006603 INV226 73 1181270472 INV227 73 1158289704 INV228 43 1174552499 INV229 96 1174494335 INV23 147 1181970090 INV230 39 1175669524 INV231 41 1174392858 INV232 34 1017303632 INV233 20 1091394276 INV234 46 1071904885 INV235 14 1173538008 INV236 53 1173770120 INV237 22 1174925624 INV238 52 1165222203 INV239 9 1135243928 INV24 57 1181883937 INV240 37 1091829023 INV241 61 1183021647 INV242 40 1163223276 INV243 31 1154223394 INV244 45 1052580145 INV245 6 1093677472 INV246 75 1080810493 INV247 6 1184020055 INV248 23 1164597292 INV249 22 1124986753 INV25 53 1161508282 INV250 48 1121283596 INV251 43 1180336726 INV252 36 1148733597 INV253 29 1162221689 INV254 53 1178763719 INV255 185 1134741007 INV256 14 1067550412 INV257 22 1169773962 INV258 42 1118586349 INV259 9 1182202232 INV26 54 1165147075 INV260 63 1164008297 INV261 10 1160133805 INV262 10 1097001354 INV263 46 1148288042 INV264 27 1163598379 INV265 60 1178007008 INV266 32 1154901090 INV267 13 1098887600 INV268 21 1149605523 INV269 33 1134762344 INV27 54 1165175634 INV270 53 1178457892 INV271 8 1046788973 INV272 47 1183581792 INV273 23 1141449862 INV274 375 1180236783 INV275 96 1139172162 INV276 19 1168497183 INV277 38 1138754106 INV278 17 1166894898 INV279 25 1094539453 INV28 53 1161536841 INV280 25 1071893119 INV281 26 1091050727 INV282 24 1061687259 INV283 10 1056135378 INV284 16 1070828630 INV285 12 1117452242 INV286 14 1123071741 INV287 19 1085845070 INV288 60 1126302065 INV289 11 1142405959 INV29 55 1176883823 INV290 29 1173978223 INV291 61 1171216006 INV292 27 1176340908 INV293 99 1091785749 INV294 10 1128248621 INV295 28 1151851000 INV296 38 1156027306 INV297 50 1179318313 INV298 46 1176220893 INV299 86 1126855865 INV3 177 1180760700 INV30 57 1177011707 INV300 11 1150190119 INV301 18 1175856240 INV302 34 1180837817 INV303 13 1046470165 INV304 16 1179517444 INV305 37 1166090880 INV306 23 1158756635 INV307 60 1148464830 INV308 56 1179257620 INV309 38 1182747184 INV31 43 1144408048 INV310 31 1172359644 INV311 15 1123674596 INV312 29 1165109564 INV313 55 1179922467 INV314 32 1138787479 INV315 10 431161191 INV316 1 2140038457 INV317 1 1533311695 INV318 1 991394496 INV319 1 709211797 INV32 66 1057886773 INV320 2 1097626663 INV321 3 1157353054 INV322 5 1139385694 INV323 25 1133784150 INV324 63 1181878340 INV325 101 1158086146 INV326 38 1181278882 INV327 286 1183080436 INV328 45 1154854736 INV329 61 1174533348 INV33 4 1099789685 INV330 32 1008528964 INV331 27 1174263346 INV332 64 1149369266 INV333 26 1183364031 INV334 67 1168339909 INV335 66 1147884150 INV336 44 965200748 INV337 8 1166380755 INV338 39 1173103949 INV339 62 1126817827 INV34 11 1166366342 INV340 64 1170795920 INV341 47 1172322211 INV342 10 1113379081 INV343 14 1164469949 INV344 61 1167552745 INV345 62 1125544552 INV346 54 1169401059 INV347 31 1176053521 INV348 43 1171176178 INV349 14 1116220489 INV35 45 1172392986 INV350 17 1150285064 INV351 45 1165961048 INV352 56 1112251606 INV353 15 1164046658 INV354 98 1179269248 INV355 40 1157032737 INV356 60 1179722234 INV357 67 1152073239 INV358 80 1180095790 INV359 48 1177743598 INV36 155 1116692585 INV360 40 1169609794 INV361 49 1167566562 INV362 53 1180763297 INV363 64 1167962091 INV364 52 1179788115 INV365 41 1077008198 INV366 8 1143611054 INV367 32 1178180889 INV368 55 1169726953 INV369 30 1143514541 INV37 24 1170570773 INV370 42 1181985768 INV371 49 1170651243 INV372 60 1177770436 INV373 58 1163899303 INV374 48 1179283094 INV375 51 1009239312 INV376 45 1170597051 INV377 33 1149912987 INV378 213 1131427468 INV379 63 1171437391 INV38 71 1164866290 INV380 76 1168488225 INV381 62 1166044751 INV382 54 1175149356 INV383 44 1155919506 INV384 237 1056358889 INV385 17 1176712065 INV386 30 1120655481 INV387 29 1165843079 INV388 39 1171071737 INV389 56 1177442728 INV39 45 1011295912 INV390 34 1176994701 INV391 49 1167953952 INV392 73 1168533590 INV393 58 1162130134 INV394 35 1173169764 INV395 68 1169176711 INV396 55 1177852925 INV397 47 1183600727 INV398 48 1181899572 INV399 42 1167995858 INV4 26 1178079121 INV40 4 998366792 INV400 337 1170755978 INV401 38 1163700627 INV402 51 1176507144 INV403 23 1109670578 INV404 10 1151709943 INV405 6 1065246632 INV406 292 1180288671 INV407 59 1165848044 INV408 41 1163567748 INV409 12 1044631257 INV41 5 1050770171 INV410 68 1177050385 INV411 65 1172210463 INV412 49 1161182414 INV413 53 1162135205 INV414 61 1169504490 INV415 53 1178451492 INV416 54 1167857969 INV417 41 1157720543 INV418 15 1130065300 INV419 21 1172240161 INV42 6 993715375 INV420 23 1179640685 INV421 58 1179007315 INV422 65 1168494135 INV423 15 1170602412 INV424 68 1140944349 INV425 20 1182068121 INV426 51 1161151176 INV427 289 1181800355 INV428 58 1183778194 INV429 56 1152524873 INV43 5 1151519287 INV430 37 1181059764 INV431 33 1183150543 INV432 17 1162895880 INV433 8 1168073996 INV434 16 953821265 INV435 23 1165093501 INV436 28 1178140243 INV437 26 1153570909 INV438 57 1183229295 INV439 98 1168775988 INV44 6 1094883419 INV440 30 1175624374 INV441 48 1183765169 INV442 33 1182834679 INV443 62 1166367683 INV444 39 1159631380 INV445 47 1173723338 INV446 29 1179286913 INV447 54 1120407820 INV448 49 1182565343 INV449 44 1173820162 INV45 8 1130260688 INV450 8 1099778931 INV451 9 1112149363 INV452 6 1182219113 INV453 53 1167128077 INV454 57 1099506648 INV455 48 1183468124 INV456 28 1157438427 INV457 264 1160173680 INV458 39 1150347320 INV459 32 1182321740 INV46 9 1130297891 INV460 60 1180145995 INV461 60 1009480385 INV462 6 1089485995 INV463 7 1094680253 INV464 8 1121227790 INV465 40 1040605372 INV466 24 1175286942 INV467 40 1169498334 INV468 69 1169527918 INV469 38 1167718847 INV47 11 1061363842 INV470 46 1106067541 INV471 76 1181623637 INV472 62 1166674309 INV473 48 1128684741 INV474 7 1073869934 INV475 9 1134446170 INV476 29 1155126807 INV477 36 1063228700 INV478 41 1147739941 INV479 35 1174169233 INV48 5 1140274668 INV480 71 1171166426 INV481 63 1163209472 INV482 36 1170458138 INV483 68 1145964553 INV484 52 1183966324 INV485 68 1156021793 INV486 41 1172670489 INV487 21 1170398795 INV488 70 1179432986 INV489 20 1182172308 INV49 6 1125723435 INV490 17 1150135378 INV491 34 1035588533 INV492 9 1164322602 INV493 11 696616259 INV494 4 1098480882 INV495 17 1128239493 INV496 46 1163147483 INV497 31 1166555587 INV498 18 1170697502 INV499 54 1183402121 INV5 79 1180204163 INV50 6 1010603762 INV500 36 1116252282 INV501 15 1175006159 INV502 53 1134197867 INV503 39 1160762091 INV504 6 784756776 INV505 13 1180329439 INV506 23 1176174170 INV507 16 1154965186 INV508 15 1140373678 INV509 19 1165846000 INV51 4 1036851011 INV510 25 1165673556 INV511 35 1091962304 INV512 45 1146902933 INV513 78 1166964687 INV514 86 1180374172 INV515 62 1158067952 INV516 20 1152935285 INV517 28 1153368036 INV518 23 1115796990 INV519 13 1159346242 INV52 5 1047077346 INV520 43 1181378857 INV521 37 1169051928 INV522 35 1181587883 INV523 19 1105257605 INV524 41 1175491415 INV525 246 1134291414 INV526 74 1162039097 INV527 42 1171899175 INV528 64 1182150917 INV529 61 1182594997 INV53 5 904855149 INV530 39 1172872119 INV531 49 1146195324 INV532 11 1057543841 INV533 7 1014602742 INV534 7 1107402104 INV535 19 1154917770 INV536 95 1173818277 INV537 7 1115785790 INV538 23 1036981527 INV539 8 1167420667 INV54 4 1094673453 INV540 167 1122798086 INV541 31 1170423181 INV542 61 1072140099 INV543 12 1138976695 INV544 52 1179942942 INV545 40 1164292766 INV546 19 1136158039 INV547 20 1144004416 INV548 54 1165837308 INV549 35 1078430477 INV55 5 1081852177 INV550 10 1178565949 INV551 103 1177126579 INV552 70 1163288709 INV553 37 1094738481 INV554 7 1063903586 INV555 5 1033425372 INV556 5 1133793345 INV557 6 1097022162 INV558 10 1144083606 INV559 15 1178286721 INV56 203688 848038803 INV560 56 1151206074 INV561 40 1178349688 INV562 212 1125947535 INV563 64 1165292200 INV564 48 1173158005 INV565 98 1180185400 INV566 27 1016054183 INV567 7 1084999665 INV568 22 1159672490 INV569 79 1180045721 INV57 283233 646074924 INV570 34 1180395502 INV571 24 1176439710 INV572 31 1175918517 INV573 60 1173881038 INV574 33 1183137119 INV575 40 1101227863 INV576 13 1172407254 INV577 10 1133270109 INV578 17 1160986959 INV579 63 1172188697 INV58 99 1182304744 INV580 54 1170794397 INV581 48 1051005091 INV582 6 1070516134 INV583 8 1118290074 INV584 45 1146385407 INV585 46 1174606946 INV586 39 1180186297 INV587 14 1154040621 INV588 42 1175882988 INV589 13 1082868413 INV59 76 1173772030 INV590 9 1097592820 INV591 12 1151483778 INV592 20 1178884046 INV593 54 1183961763 INV594 24 1154215854 INV595 36 1160641988 INV596 60 1177039901 INV597 38 947745255 INV598 38 1164056076 INV599 19 968254082 INV6 175 1135542232 INV60 53 1093154771 INV600 5 1135738023 INV601 46 1175547441 INV602 32 956576233 INV603 7 1137083933 INV604 201 1166190476 INV605 42 1183407016 INV606 17 1183129312 INV607 26 1163552733 INV608 20 1135116210 INV609 26 1157264987 INV61 58 1157640454 INV610 36 1165361880 INV611 25 1068168358 INV612 8 1153759493 INV613 13 1168468854 INV614 41 1165774021 INV615 8 1116094366 INV616 27 1179116268 INV617 54 1175536841 INV618 44 890161313 INV619 30 1158313566 INV62 102 1182392531 INV620 9 1064619624 INV621 43 1157155112 INV622 59 1183785476 INV623 46 1178984177 INV624 50 1170246046 INV625 40 1175116562 INV626 57 1150518809 INV627 34 1182961037 INV628 67 1171683919 INV629 32 1036846468 INV63 40 1172719207 INV630 41 1175776049 INV631 59 1158249913 INV632 57 1181123187 INV633 54 1165591773 INV634 24 1157528745 INV635 16 1154368054 INV636 51 1166471254 INV637 27 1124653331 INV638 14 1159484511 INV639 22 1182454075 INV64 75 1176028078 INV640 17 1003622594 INV641 6 1027416730 INV642 21 1161892934 INV643 50 831753780 INV644 4 1089471972 INV645 9 1101980534 INV646 44 1175702680 INV647 41 1131505858 INV648 10 1066812585 INV649 4 980796239 INV65 250377 717596964 INV650 20 1183594436 INV651 43 1163249106 INV652 47 1144061752 INV653 10 1165110718 INV654 62 1179093290 INV655 52 1180864361 INV656 47 1159707827 INV657 12 1023645300 INV658 3 1157463834 INV659 3 1060904444 INV66 28975 1130990238 INV660 4 1181112588 INV661 15 1171997463 INV662 28 938338623 INV663 5 1137688336 INV664 16 1154482827 INV665 50 1180339018 INV666 31 1179713034 INV667 31 1098347645 INV668 8 1160538827 INV669 18 1021456030 INV67 134 1182135009 INV670 2 1006091031 INV671 2 951616379 INV672 2 871667885 INV673 2 818376178 INV674 3 1052261518 INV675 3 939543120 INV676 32 1090180866 INV677 6 1170627702 INV678 32 1053262233 INV679 8 1121167788 INV68 63 1164365485 INV680 9 1108544100 INV681 11 1152684900 INV682 14 1154185609 INV683 38 1134271676 INV684 19 1177658696 INV685 44 1177518978 INV686 22 1079647998 INV687 11 1179569133 INV688 5 887314561 INV689 1 690419613 INV69 76 1164309138 INV690 1 688810701 INV691 1 639929110 INV692 1 625027500 INV693 1 623195831 INV694 1 617718696 INV695 2 1167479169 INV696 2 1124973432 INV697 2 972905134 INV698 6 1143958739 INV699 41 1179501029 INV7 166505 849272741 INV70 166 1169603568 INV700 39 1145476693 INV701 14 1142072413 INV702 21 1176695123 INV703 31 1172264547 INV704 62 1137054351 INV705 27 1175819084 INV706 23 891961094 INV707 9 1167542534 INV708 67 1134243551 INV709 26 1029705715 INV71 65 1143339972 INV710 3 1143035150 INV711 43 1165738581 INV712 12 1137462971 INV713 5 1072259877 INV714 7 1180876279 INV715 35 1175805876 INV716 18 1093802415 INV717 22 1176383333 INV718 57 1183010513 INV719 53 1179327736 INV72 86 1159007076 INV720 21 1167194720 INV721 40 1176398187 INV722 42 1147439138 INV723 27 1168321087 INV724 23 1166281917 INV725 33 1151216138 INV726 18 1000323493 INV727 25 1183567352 INV728 37 1092604927 INV729 195 1163550044 INV73 81 1177581121 INV730 33 950798212 INV731 30 1152607316 INV732 37 1165714265 INV733 33 1068556053 INV734 11 1115976464 INV735 27 1161045343 INV736 35 1171844836 INV737 33 1159525911 INV738 41 1180390883 INV739 11 1024131553 INV74 74 1176312154 INV740 9 1085975686 INV741 42 1147992208 INV742 37 1181637273 INV743 38 1081813347 INV744 3 1174046842 INV745 20 1178261379 INV746 46 1178413119 INV747 13 1142733896 INV748 10 1130174875 INV749 22 1175825264 INV75 58 1180815623 INV750 19 1163517885 INV751 18 1152640158 INV752 15 1147311777 INV753 11 1091619980 INV754 38 1170155090 INV755 29 1173715878 INV756 35 835977582 INV757 2 940631047 INV758 2 928744483 INV759 2 883129211 INV76 89 1173815142 INV760 3 1143834446 INV761 4 1134397883 INV762 250 1171544750 INV763 44 1136955202 INV764 10 1154316587 INV765 49 1174737284 INV766 29 1166236126 INV767 12 1175327206 INV768 45 1153063095 INV769 36 1105816193 INV77 431116 356680313 INV770 51 1142429844 INV771 33 1069665695 INV772 39 1139985500 INV773 32 1175690890 INV774 20 1132543617 INV775 24 1176271695 INV776 63 1133933129 INV777 142 1139463992 INV778 36 1181524309 INV779 24 1115387771 INV78 456573 339953219 INV780 49 1150209817 INV781 20 1083179547 INV782 8 1098795584 INV783 10 1147577596 INV784 12 1181888711 INV785 27 1175290982 INV786 40 1060130206 INV787 8 1129793124 INV788 40 1160847583 INV789 31 1180662633 INV79 462402 341199296 INV790 30 1171761940 INV791 25 1081426888 INV792 18 1003956340 INV793 5 1028031751 INV794 8 1084093438 INV795 9 1085930053 INV796 12 1156139919 INV797 16 1152066914 INV798 34 1175667989 INV799 70 1176610322 INV8 116 1053214729 INV80 439147 288345310 INV800 24 1179259380 INV801 11 1105396847 INV802 12 1115650974 INV803 13 1176755746 INV804 35 1182242624 INV805 13 962698360 INV806 4 998118856 INV807 11 1172986735 INV808 34 1119944490 INV809 51 1169563167 INV81 415888 246928030 INV810 13 1118920573 INV811 72 1179683902 INV812 79 1118509722 INV813 7 1078681531 INV814 11 1179163002 INV815 22 789281094 INV816 4 1079695977 INV817 9 1111645608 INV818 16 1182708412 INV819 31 1103328307 INV82 412374 267268642 INV820 25 853793460 INV821 7 1129785984 INV822 19 1105886509 INV823 9 1143534659 INV824 13 1174582815 INV825 69 1175357321 INV826 80 1153031168 INV827 41 1164065325 INV828 61 1162032954 INV829 40 1123882437 INV83 446673 344283316 INV830 9 1130047032 INV831 11 1116235507 INV832 13 1126566723 INV833 28 1172489440 INV834 51 1136459610 INV835 12 1062372964 INV836 10 1112670569 INV837 68 1181896580 INV838 71 1177368065 INV839 65 1111204596 INV84 445501 595740707 INV840 15 1173116435 INV841 37 1142589085 INV842 12 1124247542 INV843 19 1161505884 INV844 24 1171403553 INV845 41 1165677686 INV846 20 1180506747 INV847 15 1170391368 INV848 42 1165980829 INV849 40 1171861906 INV85 279870 885835726 INV850 36 1077524818 INV851 9 1047907154 INV852 8 1141384454 INV853 15 1168272058 INV854 61 1178023607 INV855 65 1170721200 INV856 14 1053590254 INV857 10 1057950276 INV858 8 1127887377 INV859 4 1020160878 INV86 305332 837984195 INV860 7 1147749005 INV861 33 1176769105 INV862 20 1168205515 INV863 12 1141663061 INV864 39 1171208474 INV865 9 974544864 INV866 10 1175733994 INV867 39 1166578258 INV868 29 1161961409 INV869 21 1037891489 INV87 195120 954133301 INV870 25 1178490259 INV871 53 1169873765 INV872 86 1176021019 INV873 75 1177037179 INV874 32 1151881647 INV875 8 1135911959 INV876 8 919810433 INV877 3 1139338401 INV878 3 972340244 INV879 4 1157140290 INV88 3638 1130213555 INV880 5 1126736368 INV881 31 1182264396 INV882 66 1178364544 INV883 35 1034534722 INV884 44 1177143306 INV885 43 1083170751 INV886 9 1127837545 INV887 49 1177583056 INV888 70 1183935958 INV889 70 1175817111 INV89 997 1180528551 INV890 48 1144611323 INV891 20 1130825940 INV892 84 1178249363 INV893 74 1171197019 INV894 50 1179606929 INV895 78 1175655092 INV896 75 1173593307 INV897 30 1132766399 INV898 13 1149268122 INV899 55 1173118698 INV9 147 1089529911 INV90 10611 1072551043 INV900 57 1183964102 INV901 72 1163162176 INV902 69 1170172550 INV903 55 1171372002 INV904 69 1174685523 INV905 49 1059075259 INV906 11 1138880319 INV907 21 1180633677 INV908 52 1182842349 INV909 20 1136109675 INV91 135 1091976539 INV910 59 1166902771 INV911 67 1180049046 INV912 60 1152975227 INV913 26 1174031121 INV914 49 1182264063 INV915 37 1167508597 INV916 82 1173831360 INV917 70 1181974399 INV918 57 1148872951 INV919 40 1169598662 INV92 807 1128444034 INV920 22 1122949879 INV921 11 1173320112 INV922 82 1180802772 INV923 83 1179519663 INV924 70 1181909064 INV925 51 1150708751 INV926 7 1146761823 INV927 8 1055443050 INV928 53 1177806892 INV929 86 1172323872 INV93 62020 1074818142 INV930 84 1180311193 INV931 73 1164334570 INV932 72 1183223171 INV933 67 1162390553 INV934 55 1182871381 INV935 34 1184074510 INV936 27 1157545289 INV937 29 1161972265 INV938 58 1177882987 INV939 65 1180837664 INV94 63 1182498503 INV940 80 1180893864 INV941 27 1164634991 INV942 25 1163917876 INV943 21 1135242236 INV944 86 1179798276 INV945 67 1176878455 INV946 51 1167587975 INV947 20 1107295341 INV948 48 1166998486 INV949 37 1141131615 INV95 87 1161713051 INV950 39 1178888356 INV951 65 1179881145 INV952 31 1149916497 INV953 79 1182580014 INV954 84 1169638868 INV955 48 1171495920 INV956 72 1172468481 INV957 65 1172923430 INV958 87 1174809060 INV959 66 1138385327 INV96 58 1176509978 INV960 55 1157177408 INV961 41 1183767190 INV962 54 1145403994 INV963 13 1177483908 INV964 17 1163670499 INV965 18 1087617850 INV966 10 1102334196 INV967 32 1165661141 INV968 78 1176142905 INV969 69 1174487870 INV97 97 1176767964 INV970 42 1172705966 INV971 55 1183806990 INV972 43 1171825405 INV973 29 1126047347 INV974 24 1165054152 INV975 55 1178862848 INV976 47 1148163762 INV977 5 1067443809 INV978 14 1169822539 INV979 66 1172480678 INV98 53 1183767471 INV980 66 1177353082 INV981 69 1162958016 INV982 31 1164230050 INV983 32 1148823264 INV984 20 1152598456 INV985 7 1043196064 INV986 9 1017702910 INV987 5 1022661575 INV988 6 1037507473 INV989 7 1047450933 INV99 65 1176381598 INV990 9 1131078777 INV991 38 1183586240 INV992 22 1106444411 INV993 44 1175827194 INV994 49 1180628303 INV995 42 1183827936 INV996 12 1170125249 INV997 12 1145634183 INV998 17 1176013975 INV999 19 1132457585 MAM1 54649 917178765 MAM10 17 1127029450 MAM100 18 998024221 MAM101 9 1129296049 MAM102 53 1144597149 MAM103 9 1076958295 MAM104 10 1091212439 MAM105 10 1183156498 MAM106 16 1135846769 MAM107 8 1092852495 MAM108 17 1061340501 MAM109 7 1070781583 MAM11 18 1142664549 MAM110 12 1145013723 MAM111 8 1169519331 MAM112 12 1133392046 MAM113 14 1122198751 MAM114 15 1135810435 MAM115 14 1093872974 MAM116 11 1141987079 MAM117 18 1168610859 MAM118 5 1017575367 MAM119 8 1092520245 MAM12 15 1132274725 MAM120 21 1083014647 MAM121 13 1112078254 MAM122 17 1118758367 MAM123 13 1165846276 MAM124 18 1100393997 MAM125 8 1179792582 MAM126 14 1041093991 MAM127 5 1164514221 MAM128 10 1172455048 MAM129 7 1165637199 MAM13 9 1181471817 MAM130 9 1082208304 MAM131 7 1132943029 MAM132 9 1122466917 MAM133 6 999063376 MAM134 5 1043899296 MAM135 9 1183016709 MAM136 14 1158872058 MAM137 14 1170139353 MAM138 11 1110325951 MAM139 11 1159492295 MAM14 14 1173406720 MAM140 11 1173441240 MAM141 14 1120745545 MAM142 9 1088893088 MAM143 12 1099118976 MAM144 17 1182972727 MAM145 12 1124668268 MAM146 16 1139882797 MAM147 9 1180843934 MAM148 16 1130346730 MAM149 7 1147471451 MAM15 10 1131536607 MAM150 14 1157587755 MAM151 5 1073397237 MAM152 10 1173167440 MAM153 12 1165618356 MAM154 18 986700581 MAM155 7 1128061078 MAM156 12 1157534009 MAM157 11 1137571448 MAM158 9 1104150082 MAM159 12 1128267746 MAM16 14 1173052009 MAM160 18 1031989209 MAM161 5 1040560864 MAM162 9 1110923230 MAM163 11 1042773086 MAM164 10 1163642923 MAM165 15283 724754917 MAM17 12 1057388218 MAM18 10 1098097203 MAM19 15 1026611779 MAM2 7 1177030125 MAM20 6 1069522997 MAM21 12 1147180873 MAM22 13 1089172779 MAM23 8 1147102555 MAM24 17 1161495983 MAM25 7 1160364752 MAM26 14 1119860958 MAM27 12 1168070061 MAM28 11 1147190445 MAM29 16 1179712380 MAM3 45056 812377816 MAM30 10 1156184385 MAM31 16 1138379370 MAM32 9 1133234150 MAM33 12 1136792441 MAM34 14 1083174451 MAM35 10 1114325055 MAM36 16 1100855100 MAM37 8 1087010659 MAM38 12 1132313879 MAM39 86259 1052143995 MAM4 5 977148124 MAM40 67632 1075398586 MAM41 20 1168721798 MAM42 260323 628322297 MAM43 1 716413629 MAM44 1 662751787 MAM45 2 1076242322 MAM46 6 1060323989 MAM47 7 1157094405 MAM48 374 1047383769 MAM49 11 1148682982 MAM5 13 1070912825 MAM50 270 1107760733 MAM51 16 1096674869 MAM52 11 1153008662 MAM53 15 1183890503 MAM54 3346 1174847022 MAM55 209458 659291453 MAM56 14 1092077466 MAM57 14 1163101092 MAM58 283 1113603904 MAM59 9 1139689185 MAM6 13 1061705218 MAM60 400 1104705819 MAM61 8 1083688240 MAM62 36 1141428289 MAM63 10 1174298463 MAM64 17 1141584519 MAM65 9 1177791867 MAM66 12 1142868678 MAM67 278 1016632173 MAM68 8 1175859851 MAM69 13 1079428393 MAM7 15 1160135387 MAM70 8 1131775367 MAM71 14 1079277413 MAM72 11 1080315572 MAM73 17 1101712135 MAM74 13 1051005117 MAM75 10 1174291860 MAM76 10 1119665667 MAM77 9 1183872739 MAM78 17 1024269365 MAM79 9 1137930415 MAM8 20 1124934750 MAM80 14 1061883364 MAM81 8 1162431176 MAM82 14 1127176217 MAM83 7 1104289556 MAM84 10 1116587684 MAM85 15 1090723901 MAM86 16 1130864720 MAM87 13 1059549871 MAM88 10 1183235581 MAM89 15 1154898355 MAM9 21 1147650305 MAM90 12 1149723292 MAM91 165 1085909386 MAM92 13 1183728650 MAM93 22 1141158435 MAM94 8 1144438750 MAM95 12 1181431425 MAM96 12 1133730981 MAM97 10 1140589415 MAM98 9 1113504619 MAM99 12 1141683482 PAT1 1093034 539685021 PAT10 688431 489282351 PAT11 677210 371938852 PAT12 520550 625173756 PAT13 707192 313512775 PAT14 603518 512090676 PAT15 1067063 29472194 PAT16 1081381 20546239 PAT17 1015188 597244424 PAT18 1080061 409395868 PAT19 1268035 483794169 PAT2 771018 511595731 PAT20 957939 647785084 PAT21 700608 783002133 PAT22 957476 615694519 PAT23 1205746 433132753 PAT24 1105895 360298443 PAT25 872586 449018987 PAT26 1586661 64029505 PAT27 1019180 511837383 PAT28 1070484 563952971 PAT29 886304 639311305 PAT3 745621 413109287 PAT30 761696 641000999 PAT31 633845 417084151 PAT32 497127 560581485 PAT33 727524 277686155 PAT34 285754 357061356 PAT35 588065 306799680 PAT36 961837 373084730 PAT37 537111 782993806 PAT38 969618 455188716 PAT39 1548538 54896125 PAT4 842828 549260886 PAT40 794851 680460169 PAT41 634643 560451533 PAT42 298174 613720394 PAT43 440312 290616054 PAT44 889649 200469917 PAT45 1073928 350037548 PAT46 722305 158194292 PAT47 562161 295357897 PAT48 436641 272412297 PAT49 683693 337144111 PAT5 692703 426144298 PAT50 548231 230169843 PAT51 636335 205213070 PAT52 457420 602422278 PAT53 384811 506982052 PAT54 762397 200710246 PAT55 602886 167459732 PAT56 253405 374210339 PAT57 862313 110750583 PAT58 961337 332036811 PAT59 776383 723417163 PAT6 748959 287586253 PAT60 566980 857437963 PAT61 661773 800495331 PAT62 746865 713761456 PAT63 990079 532289556 PAT64 707389 772084652 PAT65 730648 766263060 PAT66 756664 723875246 PAT67 459726 836540752 PAT68 704210 316880626 PAT69 847025 63837655 PAT7 704537 359977380 PAT70 853182 51598492 PAT71 873103 312174230 PAT72 743107 740743486 PAT73 755340 755945115 PAT74 1137682 489266844 PAT75 729207 240496158 PAT76 584438 410185029 PAT77 604462 444606168 PAT78 695792 290981153 PAT79 789857 552097392 PAT8 717585 514538735 PAT80 353969 266036254 PAT9 936372 600411819 PHG1 18898 659347405 PHG2 16356 686532222 PHG3 14035 271087027 PLN1 182369 828375546 PLN10 121 1176725979 PLN100 43 1182331514 PLN100 2 1161694293 PLN100 2 1153142705 PLN100 1 669220190 PLN100 1 629226312 PLN100 1 613110551 PLN100 2 1144904879 PLN100 2 1160236768 PLN100 1 658438119 PLN100 1 628047470 PLN100 1 612916554 PLN101 43 1175719222 PLN101 2 1143852611 PLN101 2 1150763450 PLN101 1 657631428 PLN101 1 629616096 PLN101 1 610488678 PLN101 2 1145704528 PLN101 2 1148031132 PLN101 1 655385637 PLN101 1 626286153 PLN101 1 610690180 PLN102 43 1183406182 PLN102 2 1141737084 PLN102 2 1145450335 PLN102 1 659936173 PLN102 1 627661034 PLN102 1 608478632 PLN102 2 1164887918 PLN102 2 1157801119 PLN102 1 654540277 PLN102 1 624453744 PLN102 1 610565479 PLN103 42 1163229317 PLN103 2 1154225896 PLN103 2 1144646810 PLN103 1 661109612 PLN103 1 624188817 PLN103 1 609603980 PLN103 2 1153106963 PLN103 2 1149274143 PLN103 1 657668641 PLN103 1 627263816 PLN103 1 611107145 PLN104 44 1182265834 PLN104 2 1143888586 PLN104 2 1151475536 PLN104 1 659552134 PLN104 1 627284235 PLN104 1 612025601 PLN104 2 1148289352 PLN104 2 1155467049 PLN104 1 660627594 PLN104 1 636764043 PLN104 1 612684114 PLN105 82 1008208987 PLN105 2 1172404752 PLN105 2 1143811555 PLN105 1 660087335 PLN105 1 626870575 PLN105 1 607666773 PLN105 2 1160190638 PLN105 2 1151319163 PLN105 1 663157241 PLN105 1 626857742 PLN105 1 607587567 PLN106 2 747319580 PLN106 2 1166417974 PLN106 2 1149892400 PLN106 1 660726353 PLN106 1 625613366 PLN106 1 606853752 PLN106 2 1145435293 PLN106 2 1148608716 PLN106 1 659649991 PLN106 1 630477981 PLN106 1 612914000 PLN107 2 884812093 PLN107 2 1159094545 PLN107 2 1155390937 PLN107 1 657190419 PLN107 1 626766831 PLN107 1 610506001 PLN107 2 1139699259 PLN107 2 1151798322 PLN107 1 659109138 PLN107 1 625619081 PLN107 1 605020174 PLN108 2 918639035 PLN108 2 1144201423 PLN108 2 1150772597 PLN108 1 660123737 PLN108 1 626033862 PLN108 1 611584699 PLN108 2 1146634294 PLN108 1 629468067 PLN108 2 1181536715 PLN108 1 634780758 PLN108 1 613857241 PLN109 7 1170902936 PLN109 2 1153523653 PLN109 2 1157943603 PLN109 1 655608708 PLN109 1 630476109 PLN109 1 611734907 PLN109 2 1148834704 PLN109 2 1153026048 PLN109 1 660958633 PLN109 1 628850999 PLN109 1 613418293 PLN11 81 1074115299 PLN110 28 1037362098 PLN110 2 1149130062 PLN110 2 1149230152 PLN110 1 662192201 PLN110 1 624651312 PLN110 1 607896916 PLN110 2 1144733231 PLN110 2 1148913967 PLN110 1 659736604 PLN110 1 626336238 PLN110 1 607408596 PLN111 2 746994619 PLN111 2 1149881386 PLN111 2 1156807113 PLN111 1 662539114 PLN111 1 634696490 PLN111 1 614659814 PLN111 2 1155079160 PLN111 2 1150818685 PLN111 1 657222892 PLN111 1 629605540 PLN111 1 613053250 PLN112 2 884447165 PLN112 2 1144594366 PLN112 2 1153001227 PLN112 1 663034619 PLN112 1 623546353 PLN112 1 613383894 PLN112 2 1145099380 PLN112 21 1178182689 PLN112 43 1173368751 PLN112 16 1115226327 PLN112 5 955353777 PLN113 2 918277773 PLN113 3 875632936 PLN113 2 877648901 PLN113 3 1033679662 PLN113 34 1141347588 PLN113 12 848648943 PLN113 1 655484837 PLN113 1 626855960 PLN113 1 604911185 PLN113 2 1146256337 PLN113 2 1152814527 PLN114 31 1165164536 PLN114 1 631897805 PLN114 1 637173558 PLN114 1 641960388 PLN114 2 1176182574 PLN114 2 1155488842 PLN114 1 660305412 PLN114 1 629753639 PLN114 1 609200707 PLN114 2 1175561398 PLN114 2 1154972860 PLN115 41 1161230213 PLN115 1 659208678 PLN115 1 627226266 PLN115 1 603942392 PLN115 2 1145038912 PLN115 2 1141862336 PLN115 1 661554418 PLN115 1 627699516 PLN115 1 609498991 PLN115 2 1148139209 PLN115 51 1161837995 PLN116 39 1104197109 PLN116 39 664623668 PLN116 2 961863683 PLN116 1 639092456 PLN116 2 1152889042 PLN116 1 616552515 PLN116 1 734473537 PLN116 2 1100022842 PLN116 2 990953513 PLN116 2 1156725275 PLN116 2 921884013 PLN117 14 1122538268 PLN117 2 954999066 PLN117 1 602817757 PLN117 2 1122645515 PLN117 35 1172890850 PLN117 34 1181509311 PLN117 92 1151713734 PLN117 41 751503334 PLN117 1 646201372 PLN117 1 587623253 PLN117 1 663525381 PLN118 23 1160343908 PLN118 2 1170194602 PLN118 2 684606446 PLN118 1 525133463 PLN118 1 663523538 PLN118 1 635405230 PLN118 1 611936476 PLN118 2 1150154113 PLN118 2 1161072711 PLN118 1 660736956 PLN118 1 627598042 PLN119 60 1155357749 PLN119 1 612187513 PLN119 2 1155070448 PLN119 2 1145745297 PLN119 1 673406957 PLN119 1 630137118 PLN119 1 612939186 PLN119 2 1151335502 PLN119 2 1155631783 PLN119 1 657661460 PLN119 1 626889213 PLN12 23 1134451674 PLN120 31 1173596134 PLN120 1 610003100 PLN120 2 1148528258 PLN120 2 1146029239 PLN120 1 662475302 PLN120 1 630354994 PLN120 1 612387238 PLN120 2 1155754903 PLN120 2 1149070389 PLN120 1 653250953 PLN120 1 631324550 PLN121 30 1150335358 PLN121 1 609093722 PLN121 2 1149523883 PLN121 2 1145083390 PLN121 1 655260812 PLN121 1 634191159 PLN121 1 614681618 PLN121 2 1172767975 PLN121 2 1152836532 PLN121 1 658721539 PLN121 1 626163282 PLN122 16 1148466888 PLN122 1 609194012 PLN122 2 1153379980 PLN122 2 1162676726 PLN122 1 656359106 PLN122 1 622273932 PLN122 1 610730036 PLN122 2 1152019255 PLN122 2 1150333174 PLN122 1 657708949 PLN122 1 625240013 PLN123 48 1182920700 PLN123 1 610861510 PLN123 2 1136292166 PLN123 2 1152354408 PLN123 1 657289215 PLN123 1 624169276 PLN123 1 611474174 PLN123 2 1152158626 PLN123 2 1154678582 PLN123 1 664634244 PLN123 1 643202471 PLN124 49 1135581028 PLN124 1 617103718 PLN124 2 1161114768 PLN124 2 1163751838 PLN124 1 660262686 PLN124 1 634680428 PLN124 1 612896067 PLN124 2 1153985512 PLN124 2 1159127655 PLN124 1 658111403 PLN124 1 631828453 PLN125 38 1163679393 PLN125 1 612358733 PLN125 2 1172628206 PLN125 2 1161043722 PLN125 1 661402595 PLN125 1 635870417 PLN125 1 617906818 PLN125 2 1154505804 PLN125 2 1161723662 PLN125 1 666500271 PLN125 1 632086707 PLN126 149 1055178691 PLN126 1 607961820 PLN126 2 1173780312 PLN126 21 1134943785 PLN126 29 1167338095 PLN126 33 1171528235 PLN126 12 1152489829 PLN126 92 1120024293 PLN126 30 1144069965 PLN126 31 1131160060 PLN126 37 1171331343 PLN127 68 1041375145 PLN127 18 1137163367 PLN127 18 1108681313 PLN127 11 1140492879 PLN127 14 1175056220 PLN127 51 1162077512 PLN127 14 989011425 PLN127 4 968685916 PLN127 4 989422041 PLN127 4 1035905487 PLN127 4 964344820 PLN128 91 1074993814 PLN128 4 1168659054 PLN128 5 1115864637 PLN128 18 1160077621 PLN128 33 1000994116 PLN128 1 2143528264 PLN128 1 2138631366 PLN128 1 2132989935 PLN128 1 2142145023 PLN128 1 2142779784 PLN128 1 124381055 PLN129 30 1068786308 PLN129 1 2112395848 PLN129 1 2144481838 PLN129 1 2133121580 PLN129 1 2141806609 PLN129 1 1870266305 PLN129 1 2134931027 PLN129 1 2108664250 PLN129 1 2146278775 PLN129 1 2117022170 PLN129 1 1576301307 PLN13 23 1086303057 PLN130 7 1072041106 PLN130 1 2067099338 PLN130 1 2134690998 PLN130 1 2136662657 PLN130 1 2140543523 PLN130 1 1531582847 PLN130 1 2146571508 PLN130 1 2138192289 PLN130 1 2101175359 PLN130 1 2146227213 PLN130 1 621086779 PLN131 20 1161844167 PLN131 1 2138605540 PLN131 1 2083688238 PLN131 1 2144314009 PLN131 1 2139184679 PLN131 1 172723629 PLN131 1 2132146989 PLN131 1 2133919239 PLN131 1 2133305249 PLN131 1 2100933269 PLN131 1 143347570 PLN132 124 1118652818 PLN132 1 2134142781 PLN132 1 2145201137 PLN132 1 2137733646 PLN132 1 1914313492 PLN132 1 2145479601 PLN132 1 2114166385 PLN132 1 2146417222 PLN132 1 1555468501 PLN132 1 2141253099 PLN132 1 2119186544 PLN133 37 1183647788 PLN133 1 2142175433 PLN133 1 1498831827 PLN133 9 1052661862 PLN133 13 1137925323 PLN133 34 858656987 PLN133 2 1034251136 PLN133 2 1041322427 PLN133 2 959575375 PLN133 2 1005137949 PLN133 2 1136683915 PLN134 134 1150551628 PLN134 2 1019386330 PLN134 3 1015418383 PLN134 2 1022027198 PLN134 2 1025363455 PLN134 2 931056427 PLN134 2 969293345 PLN134 2 1064158730 PLN134 2 968690797 PLN134 3 980008249 PLN134 2 1043031688 PLN135 20 1164850723 PLN135 2 1031876872 PLN135 2 943080858 PLN135 2 1000998827 PLN135 2 1157028134 PLN135 2 1004786053 PLN135 3 985677594 PLN135 2 1014843260 PLN135 2 1068644986 PLN135 2 948335936 PLN135 2 879747037 PLN136 21 1084415550 PLN136 2 1127570290 PLN136 2 990438732 PLN136 3 875786730 PLN136 2 991559490 PLN136 2 942009307 PLN136 2 906129229 PLN136 2 936264359 PLN136 2 928886758 PLN136 2 935093463 PLN136 2 930365420 PLN137 58 1157319736 PLN137 2 990803747 PLN137 2 885021138 PLN137 2 908456347 PLN137 2 930959077 PLN137 2 1041934893 PLN137 2 942999660 PLN137 3 908571112 PLN137 2 994915609 PLN137 2 1008745383 PLN137 2 850230395 PLN138 75 1165459334 PLN138 2 915695621 PLN138 2 1025227490 PLN138 2 862764790 PLN138 2 884517818 PLN138 2 958486939 PLN138 2 882430803 PLN138 2 805094337 PLN138 2 912116412 PLN138 2 1080442405 PLN138 2 903251998 PLN139 7 1023134224 PLN139 3 846587112 PLN139 2 997148082 PLN139 2 1024702898 PLN139 3 1046276430 PLN139 2 960152348 PLN139 2 997566044 PLN139 2 926826996 PLN139 2 970728340 PLN139 2 1076556621 PLN139 2 961846356 PLN14 85750 1022222900 PLN140 3 987843021 PLN140 3 1105984004 PLN140 2 1091311779 PLN140 2 928973494 PLN140 4 966977223 PLN140 2 1034513146 PLN140 2 973973117 PLN140 2 836784321 PLN140 2 990350501 PLN140 2 1034765442 PLN140 2 918838269 PLN141 13 1147553433 PLN141 2 998373654 PLN141 2 1023553300 PLN141 2 914623388 PLN141 2 836746646 PLN141 2 993956991 PLN141 2 952571408 PLN141 2 873792954 PLN141 3 942162386 PLN141 2 990124494 PLN141 2 909364021 PLN142 30 1169021303 PLN142 2 882617017 PLN142 2 897026796 PLN142 2 1002960583 PLN142 2 873235512 PLN142 2 976812402 PLN142 2 1096125550 PLN142 2 964192102 PLN142 2 869744809 PLN142 2 940385236 PLN142 2 956987604 PLN143 43 1175210350 PLN143 2 893651928 PLN143 11 1138345400 PLN143 17 1160613983 PLN143 17 1152282495 PLN143 17 1161769737 PLN143 17 1137473602 PLN143 16 1149378136 PLN143 17 1140788494 PLN143 17 1173897061 PLN143 17 1169465378 PLN144 27 1138426334 PLN144 9 1142566106 PLN144 1 827770304 PLN144 1 819590567 PLN144 1 657919172 PLN144 1 735222392 PLN144 1 640551262 PLN144 2 850883630 PLN144 1 641523445 PLN144 1 830702509 PLN144 1 817725293 PLN145 25 1148725445 PLN145 1 657518596 PLN145 1 728079018 PLN145 1 637620844 PLN145 2 841520699 PLN145 2 787615973 PLN145 2 1005487930 PLN145 2 870370402 PLN145 2 954925343 PLN145 2 877145967 PLN145 2 915888348 PLN146 26 1166741474 PLN146 2 951785915 PLN146 2 976596859 PLN146 2 981034558 PLN146 2 853229614 PLN146 2 968208187 PLN146 2 1065368112 PLN146 2 928206292 PLN146 3 960272742 PLN146 2 1022027198 PLN146 2 1025363455 PLN147 51 1170654916 PLN147 2 931056427 PLN147 2 969293345 PLN147 2 1064158730 PLN147 2 968690797 PLN147 3 980008249 PLN147 2 991559490 PLN147 2 942009307 PLN147 2 906129229 PLN147 2 936264359 PLN147 2 928886758 PLN148 35 1180644427 PLN148 2 935093463 PLN148 2 930365420 PLN148 2 990803747 PLN148 2 885021138 PLN148 2 908456347 PLN148 2 930959077 PLN148 2 1041934893 PLN148 2 942999660 PLN148 3 908571112 PLN148 2 934307380 PLN149 35 1178309823 PLN149 2 919820886 PLN149 2 904199719 PLN149 2 879641827 PLN149 2 1019726094 PLN149 2 948044567 PLN149 2 935988512 PLN149 2 1001554393 PLN149 2 1004892626 PLN149 2 870794531 PLN149 2 886494923 PLN15 232746 566509409 PLN150 34 1165044314 PLN150 2 1089597455 PLN150 2 891403268 PLN150 3 916201336 PLN150 2 994915609 PLN150 2 1008745383 PLN150 2 850230395 PLN150 2 915695621 PLN150 2 1025227490 PLN150 2 862764790 PLN150 2 884517818 PLN151 34 1166648442 PLN151 2 958486939 PLN151 2 882430803 PLN151 2 805094337 PLN151 2 912116412 PLN151 2 1080442405 PLN151 2 903251998 PLN151 3 846587112 PLN151 2 1034251136 PLN151 2 1041322427 PLN151 2 959575375 PLN152 34 1154235685 PLN152 2 1005137949 PLN152 2 1136683915 PLN152 2 1019386330 PLN152 3 1015418383 PLN152 2 997148082 PLN152 2 1024702898 PLN152 3 1046276430 PLN152 2 960152348 PLN152 2 997566044 PLN152 2 926826996 PLN153 35 1181945520 PLN153 2 970728340 PLN153 2 1076556621 PLN153 2 961846356 PLN153 3 1105984004 PLN153 2 1091311779 PLN153 2 928973494 PLN153 4 994697394 PLN153 2 1128818178 PLN153 2 1018548947 PLN153 2 883277256 PLN154 33 1182117489 PLN154 2 1015247550 PLN154 2 1033440010 PLN154 2 938819340 PLN154 3 859495519 PLN154 2 1034513146 PLN154 2 973973117 PLN154 2 836784321 PLN154 2 990350501 PLN154 2 1034765442 PLN154 2 973886503 PLN155 16 963201441 PLN155 2 992822994 PLN155 2 897431557 PLN155 2 808457311 PLN155 2 953662853 PLN155 2 1058778957 PLN155 2 930200695 PLN155 3 895052557 PLN155 2 1043031688 PLN155 2 1031876872 PLN155 2 943080858 PLN156 1 660154351 PLN156 2 1000998827 PLN156 2 1157028134 PLN156 2 1004786053 PLN156 3 985677594 PLN156 2 787615973 PLN156 2 1005487930 PLN156 2 870370402 PLN156 2 954925343 PLN156 2 877145967 PLN156 2 915888348 PLN157 1 785289892 PLN157 2 951785915 PLN157 2 976596859 PLN157 2 981034558 PLN157 2 853229614 PLN157 2 968208187 PLN157 2 1065368112 PLN157 2 928206292 PLN157 3 960272742 PLN157 4 1031468481 PLN157 29 1161715798 PLN158 1 752191036 PLN158 18 1164014015 PLN158 86 1098733546 PLN158 12 1140796870 PLN158 53 1160691643 PLN158 29 1105078032 PLN158 50 1145575965 PLN158 43 1177757480 PLN158 43 1150824379 PLN158 34 1155874556 PLN158 50 1155922795 PLN159 2 1138634422 PLN159 47 1132536680 PLN159 23 1141693484 PLN159 26 1169836001 PLN159 5 177893042 PLN159 1 1999785258 PLN159 1 1545728702 PLN159 1 1499997841 PLN159 1 1493209057 PLN159 1 1187610474 PLN159 1 943684407 PLN16 1149 781282806 PLN160 1 581969875 PLN160 8 1161825966 PLN160 39 1170204862 PLN160 39 1150468932 PLN160 50 1175229069 PLN160 53 1182975790 PLN160 11 787764687 PLN160 1 656850665 PLN160 1 633960920 PLN160 1 609171657 PLN160 2 1143703028 PLN161 1 742820188 PLN161 2 979242293 PLN161 3 990086045 PLN161 4 1070469512 PLN161 30 961812843 PLN161 2 1109448078 PLN161 1 767071137 PLN161 1 671256291 PLN161 1 670741101 PLN161 1 671191297 PLN161 1 771176557 PLN162 1 722258891 PLN162 1 643128204 PLN162 1 694350238 PLN162 1 641290954 PLN162 2 1174904300 PLN162 1 745638687 PLN162 8 1174732410 PLN162 35 1182932636 PLN162 18 1181205473 PLN162 41 1176106470 PLN162 8 972308232 PLN163 1 529961705 PLN163 5 998918288 PLN163 4 1175221657 PLN163 19 1182622585 PLN163 57 1044582350 PLN163 4 954531898 PLN163 5 1025819629 PLN163 6 984147449 PLN163 5 1137917005 PLN163 5 1007898041 PLN163 6 1070397818 PLN164 1 696896727 PLN164 5 1111212694 PLN164 6 1089162517 PLN164 3 421610440 PLN164 1 956684326 PLN164 1 561974515 PLN164 1 718270646 PLN164 1 682093502 PLN164 1 700447244 PLN164 1 683485999 PLN164 1 723946829 PLN165 1 768317091 PLN165 1 751391258 PLN165 1 651249186 PLN165 2 1175723351 PLN165 2 1136845382 PLN165 44 1170528899 PLN165 54 1049025390 PLN165 68 1088778107 PLN165 73 1119209590 PLN165 22 1127767597 PLN165 46 1093558514 PLN166 1 635914663 PLN166 68 1114528363 PLN166 41 1064490534 PLN166 10 1140443142 PLN166 29 1112900486 PLN166 70 1142119072 PLN166 99 1179912936 PLN166 96 1181404594 PLN166 67 1084884007 PLN166 2 933307241 PLN166 7 1182242757 PLN167 1 873778448 PLN167 22 1177390369 PLN167 8 1153933128 PLN167 37 1144473388 PLN167 49 1180784520 PLN167 55 1171927849 PLN167 47 1114711079 PLN167 13 1109766498 PLN167 8 1107099447 PLN167 16 1149081006 PLN167 29 1127504010 PLN168 1 759363255 PLN168 13 1018612861 PLN168 16 1052342486 PLN168 5 693259785 PLN168 2 1045973173 PLN168 2 1158403266 PLN168 80 1164277484 PLN168 199 1115126474 PLN168 18 1171120860 PLN168 21 1146591206 PLN168 31 1102785788 PLN169 1 661150927 PLN169 8 1076126098 PLN169 8 864666226 PLN169 3 1111279011 PLN169 34 1158611344 PLN169 47 1164946828 PLN169 32 1163219703 PLN169 48 929772883 PLN169 4 1128758998 PLN169 6 1144601540 PLN169 3 940719410 PLN17 1327 988962589 PLN170 1 822617018 PLN170 5 1181840911 PLN170 4 1038695499 PLN170 4 1011553213 PLN170 102 1156287238 PLN170 31 1179681258 PLN170 42 689746606 PLN170 1 1074544454 PLN170 1 1022901297 PLN170 1 981102465 PLN170 1 976125608 PLN171 1 788135348 PLN171 1 917323440 PLN171 1 850457102 PLN171 1 839193984 PLN171 1 817723161 PLN171 1 817139115 PLN171 1 814406492 PLN171 1 772677518 PLN171 1 772908146 PLN171 1 765793897 PLN171 1 761983751 PLN172 1 505466611 PLN172 1 764473882 PLN172 4 1011158055 PLN172 4 1008776197 PLN172 6 815519305 PLN172 2 991469964 PLN172 2 816205905 PLN172 3 1056510218 PLN172 3 989952844 PLN172 3 956055548 PLN172 3 919956468 PLN173 1 723777933 PLN173 7 1163446212 PLN173 28 1167164746 PLN173 16 1110397238 PLN173 39 1181990064 PLN173 67 1182319274 PLN173 74 1160385311 PLN173 73 1003005145 PLN173 6 1144285054 PLN173 5 693883568 PLN173 2 1069887694 PLN174 5 1107711193 PLN174 2 1168781261 PLN174 16 1182073380 PLN174 45 1176527092 PLN174 34 1121126959 PLN174 9 1099497021 PLN174 23 1182637469 PLN174 14 985562895 PLN174 4 1148967398 PLN174 7 1119025184 PLN174 5 1091663592 PLN175 9 1071213085 PLN175 6 1099009318 PLN175 27 1135567827 PLN175 13 1133007134 PLN175 15 1135637088 PLN175 41 1163273408 PLN175 22 1080875863 PLN175 22 1103049530 PLN175 1 949323565 PLN175 1 915317115 PLN175 1 901665926 PLN176 8 1159618597 PLN176 1 822089110 PLN176 1 755633405 PLN176 1 854068172 PLN176 2 1141141404 PLN176 2 1041566903 PLN176 2 1001403931 PLN176 2 875973322 PLN176 43 1173385605 PLN176 30 1092520979 PLN176 19 1076669045 PLN177 10 1173442874 PLN177 25 1151243202 PLN177 41 1092457164 PLN177 8 1107304518 PLN177 14 1177666894 PLN177 69 1014292140 PLN177 1 572725250 PLN177 1 685330109 PLN177 1 696943691 PLN177 1 629773018 PLN177 1 636614816 PLN178 8 1171373280 PLN178 1 579256678 PLN178 4 1005532762 PLN178 4 1052014573 PLN178 8 1098262961 PLN178 26 1152835142 PLN178 53 1178352975 PLN178 46 1144195760 PLN178 10 1088275942 PLN178 2 808999894 PLN178 28 1110443664 PLN179 10 1161735710 PLN179 24 1082876757 PLN179 1 636807515 PLN179 2 1164863489 PLN179 2 1091053465 PLN179 2 1110446937 PLN179 1 650429017 PLN179 1 615497416 PLN179 1 605521199 PLN179 2 1151975812 PLN179 2 1040516887 PLN18 446 1087262647 PLN180 8 1129219417 PLN180 1 638826493 PLN180 1 605724068 PLN180 2 1161881882 PLN180 2 1174936293 PLN180 2 1161162149 PLN180 1 618366599 PLN180 1 606666664 PLN180 2 1134915552 PLN180 2 1149087886 PLN180 1 652904783 PLN181 8 1069494202 PLN181 1 620394872 PLN181 1 604515745 PLN181 2 1143962729 PLN181 2 1109768142 PLN181 1 623097078 PLN181 2 1164411152 PLN181 2 1089609646 PLN181 2 1104012305 PLN181 1 653771317 PLN181 1 619592024 PLN182 9 1074448447 PLN182 1 602189318 PLN182 2 1138238587 PLN182 2 1141977764 PLN182 1 662784976 PLN182 1 616351571 PLN182 1 604894944 PLN182 2 1131415633 PLN182 2 1143337624 PLN182 1 655822004 PLN182 1 616990145 PLN183 120 1182682135 PLN183 1 608259649 PLN183 2 1145732503 PLN183 43 1149278425 PLN183 31 1159664024 PLN183 22 1179063734 PLN183 32 1053349457 PLN183 5 1058925349 PLN183 58 1171284441 PLN183 40 350193506 PLN183 1 1034507165 PLN184 304 1178993407 PLN184 1 739697766 PLN184 1 726504577 PLN184 1 697169871 PLN184 1 657249472 PLN184 4 1183264416 PLN184 59 1158848735 PLN184 2 740850932 PLN184 1 613116700 PLN184 2 1110847379 PLN184 1 588160925 PLN185 87 1119865306 PLN185 2 1151556468 PLN185 2 1144988165 PLN185 2 920960533 PLN185 2 964492557 PLN185 2 1026741635 PLN185 2 924313884 PLN185 2 1063012415 PLN185 2 1039365721 PLN185 2 984082969 PLN185 2 1129535037 PLN186 17 1172352472 PLN186 1 606904469 PLN186 1 704570097 PLN186 2 1075296834 PLN186 2 959428510 PLN186 2 1120194583 PLN186 2 907700912 PLN186 2 932374047 PLN186 1 584039244 PLN186 2 1095368857 PLN186 2 1067733679 PLN187 34 1172788025 PLN187 2 1002164729 PLN187 2 1135772918 PLN187 1 615082505 PLN187 1 702454015 PLN187 100106 917060652 PLN187 169964 682034018 PLN188 20 1135334274 PLN189 8 1125895389 PLN19 427 1135560877 PLN190 81 1182409497 PLN191 101 1180182470 PLN192 64 1171807776 PLN193 45 1170100474 PLN194 45 1168710177 PLN195 46 1177197899 PLN196 46 1178718944 PLN197 43 1179244142 PLN198 86 1154304978 PLN199 31 1166191555 PLN2 215256 731597975 PLN20 114 1118994310 PLN200 52 1151546761 PLN201 237254 751755908 PLN202 509375 411687646 PLN203 233960 710006777 PLN204 182277 355325139 PLN205 10166 1087116362 PLN206 17 1127522877 PLN207 513 1081243566 PLN208 4 638455445 PLN209 1 612216829 PLN21 114 1149208425 PLN210 2 1145038356 PLN211 2 1052833268 PLN212 869 1141292333 PLN213 456840 457872076 PLN214 466095 397289620 PLN215 445882 415414704 PLN216 408094 446013967 PLN217 383699 477174351 PLN218 339946 528656374 PLN219 259010 622054429 PLN22 162 1078695112 PLN220 49593 1024902656 PLN221 4968 1091848545 PLN222 1304 747796448 PLN223 1 522466905 PLN224 1 675310294 PLN225 1 628753756 PLN226 1 624247919 PLN227 2 1172266179 PLN228 8564 784313867 PLN229 1 727344967 PLN23 10 1072770395 PLN230 1 946003158 PLN231 1 965754312 PLN232 1 906459801 PLN233 1 876148008 PLN234 1 885153844 PLN235 1 899925126 PLN236 4163 1100106582 PLN237 544 1118705916 PLN238 362 1080454048 PLN239 44 568723033 PLN24 8 1134128946 PLN240 1 696809892 PLN241 1 655542733 PLN242 1 648987779 PLN243 1 622068216 PLN244 1 583456046 PLN245 132 1176770373 PLN246 1 675310294 PLN247 1 628753756 PLN248 1 624247919 PLN249 2 1172266179 PLN25 78 1117210407 PLN250 345 729691402 PLN251 1 521073757 PLN252 1 672273650 PLN253 1 634137895 PLN254 1 624121443 PLN255 2 1171800569 PLN256 2 1153005584 PLN257 1 661076038 PLN258 1 626572591 PLN259 1 612852138 PLN26 20 1139906759 PLN260 2 1169525711 PLN261 2 1136827172 PLN262 1 653624577 PLN263 1 616219606 PLN264 1 610044819 PLN265 2 1134152592 PLN266 2 1156707404 PLN267 1 685423969 PLN268 1 640667275 PLN269 1 639123876 PLN27 198 1029168242 PLN270 1 612949391 PLN271 1 577192767 PLN272 2 1141642242 PLN273 1 648922534 PLN274 1 604770208 PLN275 2 1173859433 PLN276 2 1159392798 PLN277 2 1164574848 PLN278 1 615767531 PLN279 1 605571303 PLN28 129 1027400970 PLN280 2 1142007082 PLN281 4 1166534982 PLN282 1 710194481 PLN283 1 661081403 PLN284 1 659460550 PLN285 1 630572514 PLN286 1 598618390 PLN287 1 658974642 PLN288 1 559656399 PLN289 1 717517502 PLN29 230 970536985 PLN290 1 672450454 PLN291 1 665297378 PLN292 1 636785599 PLN293 1 599706080 PLN294 1 675658265 PLN295 1 523168208 PLN296 1 671211297 PLN297 1 630677708 PLN298 1 623428415 PLN299 2 1162824663 PLN3 139579 751171144 PLN30 32 1032549426 PLN300 2 1124081839 PLN301 1 640830439 PLN302 1 597781253 PLN303 2 1170541913 PLN304 2 1151597807 PLN305 1 537457279 PLN306 1 685947972 PLN307 1 649921694 PLN308 1 641099225 PLN309 1 611845738 PLN31 76 928976765 PLN310 1 581041262 PLN311 2 1176958498 PLN312 1 667717957 PLN313 1 631819663 PLN314 1 624692602 PLN315 2 1159089013 PLN316 2 1154165677 PLN317 1 670202054 PLN318 1 631946783 PLN319 1 626743494 PLN32 4 1108823292 PLN320 2 1167772850 PLN321 2 1151941538 PLN322 1 671530377 PLN323 1 631910401 PLN324 1 622474059 PLN325 2 1160377439 PLN326 2 1159528938 PLN327 1 684336246 PLN328 1 636053469 PLN329 1 629969872 PLN33 5 1159558460 PLN330 2 1172688001 PLN331 2 1160045407 PLN332 1 665715246 PLN333 1 624683667 PLN334 1 621078253 PLN335 2 1159864294 PLN336 2 1170185454 PLN337 1 697540743 PLN338 1 655862368 PLN339 1 646765634 PLN34 75 1132167485 PLN340 1 618540729 PLN341 1 587963859 PLN342 455 1147653963 PLN343 31 909553549 PLN344 1 705338699 PLN345 1 493450010 PLN346 1 804285258 PLN347 1 810734643 PLN348 1 673981989 PLN349 1 754496630 PLN35 73 1176935891 PLN350 1 855759449 PLN351 1 614042580 PLN352 1 743847818 PLN353 1 673340788 PLN354 1 515668560 PLN355 1 713320806 PLN356 1 703598484 PLN357 1 570159854 PLN358 1 625793224 PLN359 1 721110502 PLN36 167 1039907946 PLN360 1 459355444 PLN361 1 745201001 PLN362 1 749284433 PLN363 1 643344672 PLN364 1 595297365 PLN365 1 688905267 PLN366 1 491807393 PLN367 1 769338634 PLN368 1 671568023 PLN369 1 635285330 PLN37 8 1067069293 PLN370 1 745618965 PLN371 1 839470345 PLN372 1 646400022 PLN373 1 747589525 PLN374 2 1171764895 PLN375 1 703962928 PLN376 1 702438406 PLN377 2 1178978634 PLN378 2 1173154747 PLN379 1 734536914 PLN38 106 1131642630 PLN380 1 738743901 PLN381 1 636778132 PLN382 1 602900890 PLN383 1 697493198 PLN384 1 490518203 PLN385 1 784661008 PLN386 1 810500911 PLN387 1 655314739 PLN388 1 752710991 PLN389 1 890847171 PLN39 31 1147557767 PLN390 1 621781073 PLN391 1 743084022 PLN392 1 676741658 PLN393 1 509452426 PLN394 1 710124532 PLN395 2 1058788934 PLN396 1 620140791 PLN397 1 716573881 PLN398 1 476726550 PLN399 1 756324664 PLN4 30383 957547964 PLN40 307 1036243037 PLN400 1 977471539 PLN401 2 1144819353 PLN402 1 646234737 PLN403 1 605172934 PLN404 2 1165717241 PLN405 2 1153140076 PLN406 1 590561804 PLN407 2 1176631761 PLN408 1 782694893 PLN409 1 796420183 PLN41 481 1074884690 PLN410 1 650274702 PLN411 1 739889549 PLN412 1 848590828 PLN413 1 610626473 PLN414 1 738023571 PLN415 2 1173882462 PLN416 1 701434008 PLN417 1 690770133 PLN418 1 567265955 PLN419 1 612987783 PLN42 228 1075729921 PLN420 1 704156067 PLN421 1 475327881 PLN422 1 732118298 PLN423 1 733931846 PLN424 1 636796232 PLN425 1 599764323 PLN426 1 691313424 PLN427 1 493357854 PLN428 1 782685093 PLN429 1 786410271 PLN43 416 1181505501 PLN430 1 648139033 PLN431 1 744407562 PLN432 1 835583350 PLN433 1 623221719 PLN434 1 741299132 PLN435 1 669032550 PLN436 1 517040482 PLN437 1 711661679 PLN438 1 708205786 PLN439 2 1156892395 PLN44 203 1099630913 PLN440 2 1178356817 PLN441 1 737453356 PLN442 1 736349413 PLN443 1 639162162 PLN444 1 586755746 PLN445 1 704478343 PLN446 1 492109999 PLN447 1 791475352 PLN448 1 785940626 PLN449 1 661246824 PLN45 361 1062439255 PLN450 1 756990402 PLN451 1 858776195 PLN452 1 621195942 PLN453 1 754256086 PLN454 1 670301833 PLN455 1 509263899 PLN456 1 708234589 PLN457 1 725120110 PLN458 1 575129590 PLN459 1 620883766 PLN46 69 1113727739 PLN460 1 727285804 PLN461 1 479660269 PLN462 1 745978486 PLN463 1 750160716 PLN464 1 642428577 PLN465 1 591313643 PLN466 1 705330581 PLN467 1 495656580 PLN468 1 803232604 PLN469 1 790745243 PLN47 512 1105465963 PLN470 1 657494025 PLN471 1 759305888 PLN472 1 856542542 PLN473 1 628321883 PLN474 1 754364263 PLN475 1 697113365 PLN476 1 504254270 PLN477 1 715354979 PLN478 1 713929667 PLN479 1 572943128 PLN48 146 1102088900 PLN480 1 626959190 PLN481 1 715714221 PLN482 1 483823121 PLN483 1 742917797 PLN484 1 748536659 PLN485 1 643784981 PLN486 1 600654286 PLN487 2 1171400808 PLN488 1 794150360 PLN489 1 799857935 PLN49 196 1042792452 PLN490 1 655329108 PLN491 1 749763888 PLN492 1 838116175 PLN493 1 610468321 PLN494 1 736551279 PLN495 2 1171154657 PLN496 2 1170482349 PLN497 1 566465558 PLN498 1 614421429 PLN499 2 1179310235 PLN5 4401 1036101149 PLN50 9 1125786477 PLN500 1 735408736 PLN501 1 969998116 PLN502 11 635028102 PLN503 1 595339094 PLN504 1 698605642 PLN505 1 499102108 PLN506 1 791748890 PLN507 1 797311483 PLN508 1 656817438 PLN509 1 753360318 PLN51 10 1132483282 PLN510 1 845838138 PLN511 1 619661694 PLN512 1 752772853 PLN513 1 689709469 PLN514 1 509595892 PLN515 1 712797596 PLN516 1 710493282 PLN517 1 570643040 PLN518 1 619886155 PLN519 1 705533140 PLN52 10 1166678141 PLN520 1 484551304 PLN521 1 740148362 PLN522 1 757233630 PLN523 1 642499559 PLN524 1 594006513 PLN525 1 693261537 PLN526 1 492948387 PLN527 1 781462734 PLN528 1 802944975 PLN529 1 650275864 PLN53 10 1167983468 PLN530 1 756841830 PLN531 1 850623622 PLN532 1 614136911 PLN533 1 723255126 PLN534 2 1177410070 PLN535 1 712168462 PLN536 1 712339524 PLN537 1 564869106 PLN538 1 619418949 PLN539 1 715454519 PLN54 6 1041755176 PLN540 1 478264344 PLN541 1 734693445 PLN542 1 749685439 PLN543 1 633598967 PLN544 1 782818162 PLN545 1 1022071454 PLN546 1 971920087 PLN547 1 827198496 PLN548 1 867619200 PLN549 1 806566123 PLN55 6 1019781615 PLN550 1 1015700474 PLN551 1 742303966 PLN552 1 956173857 PLN553 1 916702776 PLN554 1 874517040 PLN555 1 816294110 PLN556 1 750216944 PLN557 196 1003376355 PLN558 2 1182091663 PLN559 1 621516506 PLN56 127 1089315331 PLN560 1 610333535 PLN561 2 1150013201 PLN562 120 946417647 PLN563 5 1140594043 PLN564 773 1136041142 PLN565 18 958385885 PLN566 3 1008669690 PLN567 27314 1072986454 PLN568 2028 954547119 PLN569 1 594102056 PLN57 226 1167288149 PLN570 1 689851870 PLN571 1 495453186 PLN572 1 780798557 PLN573 1 801256715 PLN574 1 651852609 PLN575 1 750843639 PLN576 1 830829764 PLN577 1 615552423 PLN578 1 744588157 PLN579 1 673617499 PLN58 24 1016258271 PLN580 1 509857067 PLN581 1 709773743 PLN582 1 713149757 PLN583 1 566080677 PLN584 1 618079260 PLN585 1 720988478 PLN586 1 473592718 PLN587 1 736706236 PLN588 1 750620385 PLN589 2578 1146365542 PLN59 4 1037436174 PLN590 19719 1013320098 PLN591 1 585266722 PLN592 1 681112512 PLN593 1 775448786 PLN594 1 790338525 PLN595 1 746673839 PLN596 1 836514780 PLN597 1 736872137 PLN598 1 676292951 PLN599 1 669155517 PLN6 84 1095629617 PLN60 47 1162999683 PLN600 1 701372996 PLN601 1 615672275 PLN602 1 698614761 PLN603 1 728031845 PLN604 134546 917931176 PLN605 273409 596364068 PLN606 305512 565789263 PLN607 244195 638988463 PLN608 208904 670827594 PLN609 168027 730241839 PLN61 266 1013815657 PLN610 174631 723980992 PLN611 153389 756383086 PLN612 173847 723745445 PLN613 163257 742124302 PLN614 123455 800367044 PLN615 194385 718502935 PLN616 170309 729764949 PLN617 72280 948966038 PLN618 2 567273866 PLN619 1 678170541 PLN62 36 1138919263 PLN620 1 639558213 PLN621 1 629672760 PLN622 2 1174163216 PLN623 2 1166970321 PLN624 1 684376481 PLN625 1 642597466 PLN626 1 631979072 PLN627 1 607115911 PLN628 1 582960187 PLN629 1 640026769 PLN63 8 1102481801 PLN630 1 608979116 PLN631 1 720972993 PLN632 1 501257520 PLN633 1 804602427 PLN634 1 808121247 PLN635 1 649118519 PLN636 1 758906661 PLN637 1 861141126 PLN638 1 642382296 PLN639 1 759893476 PLN64 4 1072033847 PLN640 1 689766370 PLN641 1 531462149 PLN642 1 714517032 PLN643 1 717288350 PLN644 1 586345039 PLN645 1 626266972 PLN646 1 738085275 PLN647 1 505809789 PLN648 1 759124079 PLN649 1 751612808 PLN65 4 968911036 PLN650 12 1160338339 PLN651 685 1037884752 PLN652 2 1145861525 PLN653 2 1112884977 PLN654 2 941790226 PLN655 2 872653306 PLN656 2 944711370 PLN657 2 896921305 PLN658 2 995026189 PLN659 2 869378871 PLN66 23 1166540265 PLN660 2 922541915 PLN661 2 917029648 PLN662 2 1113527553 PLN663 1 667652801 PLN664 2 1153333809 PLN665 2 976557482 PLN666 2 971318115 PLN667 2 905021021 PLN668 2 779060037 PLN669 2 1026993414 PLN67 259 1173013079 PLN670 2 1040398764 PLN671 2 906287378 PLN672 2 1107801300 PLN673 2 1085890887 PLN674 2 1048094875 PLN675 2 1011185181 PLN676 2 1092181461 PLN677 2 1026383973 PLN678 2 1018992133 PLN679 21 1150858229 PLN68 20 1010819222 PLN680 1 794474755 PLN681 1 760111594 PLN682 1 769810128 PLN683 1 715684684 PLN684 1 623890083 PLN685 1 755457679 PLN686 1 717109572 PLN687 1 817712742 PLN688 1 864624966 PLN689 1 701857263 PLN69 2 1182090258 PLN690 1 726425509 PLN691 1 738041677 PLN692 1 767912069 PLN693 2 1167186906 PLN694 2 1167934623 PLN695 2 1091547167 PLN696 3 1082389428 PLN697 4 1174948639 PLN698 3 1022191755 PLN699 320 1104176749 PLN7 175 1160007531 PLN70 2 1171115910 PLN700 142 1040534860 PLN701 403 1143989685 PLN702 25 965865578 PLN703 2 1083817966 PLN704 2 1135086767 PLN705 2 1031765593 PLN706 149 1154467731 PLN707 31 1157770692 PLN708 1045 845678948 PLN709 1 703076930 PLN71 2 1040680739 PLN710 1 495911329 PLN711 1 796169439 PLN712 1 779372321 PLN713 1 665561653 PLN714 1 757165295 PLN715 1 852704148 PLN716 1 623698249 PLN717 1 745048881 PLN718 1 677947850 PLN719 1 524289323 PLN72 46 1128549117 PLN720 1 726838826 PLN721 1 701430346 PLN722 1 584133940 PLN723 1 622677745 PLN724 1 745712656 PLN725 1 490622797 PLN726 1 748850018 PLN727 1 753856519 PLN728 700 674126380 PLN729 1 593930347 PLN73 25 1176429757 PLN730 1 702775664 PLN731 1 494594617 PLN732 1 792837209 PLN733 1 812232696 PLN734 1 661835603 PLN735 1 750337041 PLN736 1 854463248 PLN737 1 623248023 PLN738 1 749950614 PLN739 1 673746810 PLN74 57 1173826657 PLN740 1 520815567 PLN741 1 712547961 PLN742 1 703299309 PLN743 1 569771178 PLN744 1 620176429 PLN745 1 717542863 PLN746 1 493761083 PLN747 1 746502734 PLN748 1 752612656 PLN749 573 686952725 PLN75 37 1116966990 PLN750 2 990024350 PLN751 2 888868060 PLN752 2 933784370 PLN753 2 956308001 PLN754 1 589118817 PLN755 1 638425132 PLN756 1 716105986 PLN757 1 613160974 PLN758 2 1177939381 PLN759 2 1016319037 PLN76 87 1169259589 PLN760 2 936303591 PLN761 2 797242864 PLN762 242 1168816031 PLN763 442 902950534 PLN764 1 593930347 PLN765 1 702775664 PLN766 1 494594617 PLN767 1 792837209 PLN768 1 812232696 PLN769 1 661835603 PLN77 49 1164459601 PLN770 1 750337041 PLN771 1 854463248 PLN772 1 623248023 PLN773 1 749950614 PLN774 1 673746810 PLN775 1 520815567 PLN776 1 712547961 PLN777 1 703299309 PLN778 1 569771178 PLN779 1 620176429 PLN78 70 1095902581 PLN780 1 717542863 PLN781 1 493761083 PLN782 1 746502734 PLN783 1 752612656 PLN784 233 1180834457 PLN785 6503 509584943 PLN786 1 657893865 PLN787 2 1156686622 PLN788 2 1150914040 PLN789 69 1177968415 PLN79 26 1161773173 PLN790 59 1176019204 PLN791 43 1178202862 PLN792 63 1150528314 PLN793 42 1160008281 PLN794 42 1159676245 PLN795 34 1160973286 PLN796 40 1141073775 PLN797 22 1158196445 PLN798 39 1163413684 PLN799 1574 1071063404 PLN8 11 1122979570 PLN80 88 1138225224 PLN800 29 1141110474 PLN801 102 1109427475 PLN802 18 1136907998 PLN803 18 1120554374 PLN804 283 1028960077 PLN805 4 1080552710 PLN806 37 1137925102 PLN807 16 1169275918 PLN808 136 1137571571 PLN809 17 1105635108 PLN81 82 1097597467 PLN810 24 1171571936 PLN811 189 1083652115 PLN812 1 709345803 PLN813 1 499575344 PLN814 1 795989443 PLN815 1 809120074 PLN816 1 670531570 PLN817 1 759055895 PLN818 1 872909281 PLN819 1 637083831 PLN82 41 1171508271 PLN820 1 765902670 PLN821 1 688536368 PLN822 1 533804092 PLN823 1 714878730 PLN824 1 728610199 PLN825 1 586077705 PLN826 1 622419581 PLN827 1 733835468 PLN828 1 506756789 PLN829 1 759450946 PLN83 16 1136277802 PLN830 1 768174826 PLN831 3 659068422 PLN832 1 865431811 PLN833 1 841368522 PLN834 1 772393794 PLN835 1 766078222 PLN836 1 735900830 PLN837 1 693266847 PLN838 1 690056233 PLN839 1 654671025 PLN84 16 1131951762 PLN840 1 681539918 PLN841 1 650134427 PLN842 1 643737533 PLN843 2 1092839925 PLN844 2 1066926645 PLN845 2 971611548 PLN846 13 427663120 PLN847 1 1574527093 PLN848 1 1805244829 PLN849 1 1716769615 PLN85 16 1128011803 PLN850 1 1637815978 PLN851 1 1645877737 PLN852 1 1365994436 PLN853 1 1520236431 PLN854 21 825294730 PLN855 1 660114068 PLN856 1 623862790 PLN857 1 606413785 PLN858 2 1155915948 PLN859 2 1148187217 PLN86 16 1134775406 PLN860 1 662966845 PLN861 1 626943711 PLN862 1 613583204 PLN863 2 1152592070 PLN864 2 1147808788 PLN865 1 656479363 PLN866 1 621609376 PLN867 1 611088072 PLN868 2 1140013277 PLN869 2 1154214120 PLN87 16 1132578817 PLN870 1 661498744 PLN871 1 626053568 PLN872 1 608346219 PLN873 2 1151823422 PLN874 2 1162621306 PLN875 1 661546608 PLN876 1 633922074 PLN877 1 612932250 PLN878 2 1146351859 PLN879 2 1158675416 PLN88 16 1142305581 PLN880 1 664715623 PLN881 1 631770265 PLN882 1 613234972 PLN883 1 604325310 PLN884 1 582152544 PLN885 2 1158575799 PLN886 1 661621317 PLN887 1 626868012 PLN888 1 607094319 PLN889 2 1149874108 PLN89 16 1149281142 PLN890 2 1149787837 PLN891 1 656602423 PLN892 1 622110859 PLN893 1 612883152 PLN894 2 1142529769 PLN895 2 1154234909 PLN896 1 656789389 PLN897 1 625372561 PLN898 1 603451504 PLN899 2 1159731212 PLN9 4 948160392 PLN90 16 1160778218 PLN900 2 1150269419 PLN901 1 657552530 PLN902 1 618447767 PLN903 1 613586716 PLN904 2 1143934454 PLN905 2 1152640102 PLN906 1 676241010 PLN907 1 632313166 PLN908 1 603807353 PLN909 2 1155326502 PLN91 69 1087966874 PLN910 2 1150412865 PLN911 1 662000247 PLN912 1 633487160 PLN913 1 612164168 PLN914 2 1159122729 PLN915 2 1150238410 PLN916 1 660449817 PLN917 1 627269420 PLN918 1 602651360 PLN919 2 1162506895 PLN92 1 646201372 PLN920 2 1158496591 PLN921 1 664401522 PLN922 1 626503588 PLN923 1 611188438 PLN924 2 1171231026 PLN925 2 1156345588 PLN926 1 657436430 PLN927 1 621715108 PLN928 1 610707416 PLN929 2 1147845639 PLN93 1 587623253 PLN930 2 1151723189 PLN931 1 660500976 PLN932 1 634743673 PLN933 1 616002081 PLN934 2 1150169128 PLN935 2 1153490048 PLN936 1 669356984 PLN937 1 631173187 PLN938 1 607766370 PLN939 2 1145806163 PLN94 1 663525381 PLN940 2 1143277701 PLN941 1 664077638 PLN942 1 624178744 PLN943 1 609451706 PLN944 2 1144639091 PLN945 1 631526965 PLN946 1 660034972 PLN947 1 625104971 PLN948 1 608830648 PLN949 2 1146797356 PLN95 2 1170194602 PLN950 2 1146984767 PLN951 1 526310788 PLN952 1 664689228 PLN953 1 632403820 PLN954 1 613638454 PLN955 2 1172960765 PLN956 2 1147017396 PLN957 1 660476038 PLN958 1 624334204 PLN959 1 613769411 PLN96 52 1140868282 PLN960 2 1147499918 PLN961 2 1148490360 PLN962 1 663019822 PLN963 1 626669531 PLN964 1 612901747 PLN965 2 1150057662 PLN966 2 1157797487 PLN967 1 667210568 PLN968 1 635382001 PLN969 1 614569426 PLN97 53 1137938586 PLN970 2 1169192410 PLN971 2 1163716432 PLN972 1 626973123 PLN973 1 611284754 PLN974 2 1150481064 PLN975 1 659290088 PLN976 2 1150737255 PLN977 1 660553991 PLN978 1 632999331 PLN979 1 616334843 PLN98 23 1161219862 PLN980 2 1174596045 PLN981 2 1159220941 PLN982 1 659217363 PLN983 1 627225202 PLN984 1 611858135 PLN985 2 1164391514 PLN986 2 1152376894 PLN987 1 660591081 PLN988 1 627080904 PLN989 1 609113147 PLN99 49 1182120568 PLN990 2 1138662036 PLN991 2 1154130688 PLN992 1 659787933 PLN993 1 626680366 PLN994 1 612118009 PLN995 2 1146809099 PLN996 2 1153763781 PLN997 1 662624081 PLN998 1 626502968 PLN999 1 614857888 PRI1 51161 1002824769 PRI10 13 1100500214 PRI100 15 1181012644 PRI101 13 1040825256 PRI102 9 1070180120 PRI103 120 1141288485 PRI104 12 1138941381 PRI105 21 1179091292 PRI106 13 1107729811 PRI107 11 1140716802 PRI108 175 1113439382 PRI109 17 1146053835 PRI11 7 1032781085 PRI110 16 1112303007 PRI111 89 1149798270 PRI112 14 1095631751 PRI113 14 1109144986 PRI114 287 1130768822 PRI115 9 1109550286 PRI116 50 1056773376 PRI117 11 1058599569 PRI118 12 1147175924 PRI119 129 1045453423 PRI12 5 1067810412 PRI120 14 1045565768 PRI121 15 1112017113 PRI122 78 1007102649 PRI123 11 1122198877 PRI124 16 1180382249 PRI125 113 1148762732 PRI126 13 1108403327 PRI127 26 1141760953 PRI128 13 1092694835 PRI129 14 1140995957 PRI13 9 1180671468 PRI130 319 1020829798 PRI131 18 1131592109 PRI132 10 1101606557 PRI133 28 1007822526 PRI134 12 1135296282 PRI135 14 1158573682 PRI136 31 1042760633 PRI137 21 1149879308 PRI138 73 1157793061 PRI139 17 1073496211 PRI14 8 1107000153 PRI140 19 1184147845 PRI141 367 1164747047 PRI142 11 995319435 PRI143 15 1180327720 PRI144 73 978026046 PRI145 14 980737478 PRI146 15 1167618994 PRI147 151 1130654396 PRI148 10 1178420820 PRI149 46 1165457402 PRI15 11 1174619811 PRI150 16 1138886962 PRI151 18 1150234449 PRI152 326 1139459030 PRI153 11 1105326025 PRI154 18 1061935040 PRI155 27 1084071148 PRI156 13 1132102457 PRI157 75 1176492073 PRI158 18 1128354402 PRI159 14 1172029366 PRI16 6 1064076226 PRI160 27 1121725746 PRI161 13 1014482922 PRI162 9 1081708515 PRI163 294 1181073471 PRI164 92 1144808360 PRI165 24 1059032867 PRI166 17 1095246750 PRI167 264 1160885053 PRI168 63 1069216739 PRI169 13 1061440347 PRI17 11 1177365167 PRI170 16 1154534859 PRI171 74 1130528088 PRI172 12 1052421338 PRI173 14 1157378407 PRI174 240 1142043667 PRI175 353 1092575962 PRI176 17 1151712823 PRI177 20 1150571825 PRI178 10 1077063477 PRI179 24 1106755904 PRI18 11 1103395128 PRI180 13 1064310573 PRI181 17 1123386703 PRI182 57 1172654739 PRI183 16 1165794253 PRI184 569 1102965079 PRI185 18 1182712802 PRI186 52 1095510295 PRI187 10 1118000252 PRI188 168 1146745968 PRI189 9 1110809597 PRI19 8 1081303381 PRI190 43 1017369865 PRI191 21 985643222 PRI192 320 1077277149 PRI193 99 1167993912 PRI194 15 1078999347 PRI195 178 1175521079 PRI196 16 1117724155 PRI197 9 1092641025 PRI198 133 1132456182 PRI199 11 1090965131 PRI2 7910 1072145329 PRI20 6 1136611601 PRI200 11 1136520153 PRI201 25 1109223510 PRI202 31 1170866006 PRI203 22 1089981244 PRI204 11 1160827036 PRI205 97 1174530068 PRI206 357 1132322130 PRI207 16 1149860906 PRI208 19 1108664381 PRI209 270 1167059546 PRI21 225210 749803460 PRI210 8 960754211 PRI211 17 1142089276 PRI212 113 1123613306 PRI213 11 1179737992 PRI214 10 1154243139 PRI215 117 1174221652 PRI216 13 1063356666 PRI217 296 1133458643 PRI218 14 1161335653 PRI219 11 1114428479 PRI22 177388 651434890 PRI220 247 1172005160 PRI221 11 1062830725 PRI222 163 1059056445 PRI223 9 1102388911 PRI224 8 1105952181 PRI225 25 1058189466 PRI226 11 1135739344 PRI227 10 1046394222 PRI228 53 1067234263 PRI229 10 1147368977 PRI23 110372 845213566 PRI230 363 1165083272 PRI231 12 1077163217 PRI232 11 1162634480 PRI233 23 1161865142 PRI234 12 1126515186 PRI235 12 1163211790 PRI236 476 1131507684 PRI237 10 1120271414 PRI238 15 1154374540 PRI239 317 1011640206 PRI24 160758 712037189 PRI240 14 1151842759 PRI241 30 1092825541 PRI242 16 1082447657 PRI243 14 1158135268 PRI244 899 1183467936 PRI245 19 1122161472 PRI246 20 1183066230 PRI247 75 1153125911 PRI248 20 1161072802 PRI249 504 1131568942 PRI25 79142 974538523 PRI250 19 1168418729 PRI251 17 1087040239 PRI252 148 1105519326 PRI253 14 1164645498 PRI254 21 1181530736 PRI255 346 1159179407 PRI256 19 1163796128 PRI257 160 1102067593 PRI258 11 1063084062 PRI259 19 1064156912 PRI26 739 1177886289 PRI260 450 1025005459 PRI261 22 1126793321 PRI262 17 1179466154 PRI263 42 1161140959 PRI264 24 1120832764 PRI265 11 1155993068 PRI266 99 1145156564 PRI267 9 1102724860 PRI268 91 1183427497 PRI269 19 1154211600 PRI27 1225 1108508917 PRI270 9 1150032117 PRI271 222 1123372778 PRI272 13 1053726974 PRI273 8 1166119572 PRI274 109 1106272201 PRI275 11 1061690594 PRI276 23 1053944764 PRI277 10 1100191309 PRI278 9 1178425990 PRI279 14 1100560332 PRI28 13 1137980641 PRI280 15 1031336361 PRI281 8 1152223354 PRI282 165 1012912191 PRI283 12 1101224225 PRI284 15 1115849849 PRI285 89 1114474603 PRI286 8 1151170256 PRI287 65 1143039387 PRI288 15 1118101622 PRI289 13 1069221035 PRI29 11 1089653569 PRI290 142 1054214909 PRI291 9 1166723153 PRI292 18 1140507064 PRI293 72 963212938 PRI294 14 1148339428 PRI295 39 1041061246 PRI296 11 1095067328 PRI297 11 1094431541 PRI298 142 1014774443 PRI299 11 1090793443 PRI3 7901 1132972500 PRI30 238 1117857898 PRI300 9 1038388354 PRI301 98 1061078202 PRI302 10 1168112973 PRI303 12 1103167620 PRI304 269 1089423682 PRI305 16 1067149770 PRI306 51 1096741393 PRI307 14 1148619844 PRI308 16 1171061459 PRI309 293 1173859690 PRI31 18 1144634850 PRI310 14 1170966762 PRI311 16 1134764047 PRI312 29 1144492265 PRI313 9 1063878272 PRI314 162 1148544359 PRI315 11 1121324836 PRI316 9 1024863486 PRI317 98 1123634864 PRI318 13 1142109257 PRI319 16 1091383016 PRI32 15 1177028791 PRI320 338 1054776526 PRI321 25 1156859424 PRI322 42 1172162490 PRI323 20 1139949990 PRI324 18 1148357791 PRI325 270 1160151966 PRI326 9 1145469135 PRI327 12 1101301543 PRI328 46 1110431448 PRI329 14 1071322935 PRI33 19 1157503881 PRI330 141 1127225925 PRI331 13 1143046837 PRI332 11 1056487704 PRI333 57 1108247906 PRI334 8 1128609065 PRI335 12 985516952 PRI336 55 1107201184 PRI337 13 1122919431 PRI338 14 1146457938 PRI339 87 1030817204 PRI34 12 1136831832 PRI340 15 1183981661 PRI341 274 1177269657 PRI342 14 1129282143 PRI343 11 1153362077 PRI344 18 1157111224 PRI345 13 1182441061 PRI346 107 1108532920 PRI347 15 1145180719 PRI348 44 1099215470 PRI349 15 1130554745 PRI35 197 1025575505 PRI350 11 1053316046 PRI351 259 1127981555 PRI352 129 1123965493 PRI353 7 1093000977 PRI354 14 1087046044 PRI355 28 1038723961 PRI356 15 1023867813 PRI357 118 1085779101 PRI358 10 1183494445 PRI359 16 1055723815 PRI36 12 1138019906 PRI360 43 1095487107 PRI361 12 1142362092 PRI362 10 1127530151 PRI363 242 1070861830 PRI364 9 1145381908 PRI365 13 1053727156 PRI366 48 950507027 PRI367 8 980986954 PRI368 14 1127513488 PRI369 169 1038664996 PRI37 14 1138707002 PRI370 17 1170616704 PRI371 57 1165646147 PRI372 11 1052178143 PRI373 13 1064501084 PRI374 732 1039299363 PRI375 18 1161964578 PRI376 8 1065684687 PRI377 35 1144185055 PRI378 18 1169266590 PRI379 11 1146467318 PRI38 22 1147922733 PRI380 520 1130532285 PRI381 24 1109904261 PRI382 241 1128821518 PRI383 22 1172993976 PRI384 42 1169489004 PRI385 374 1179142470 PRI386 25 1171283457 PRI387 95 1182694674 PRI388 387 1051668593 PRI389 28 1178144342 PRI39 47 1183977449 PRI390 297 1061561299 PRI391 14 1085218529 PRI392 29 1176194437 PRI393 262 1134778600 PRI394 28 1172380884 PRI395 164 1172827096 PRI396 50 1178545833 PRI397 106 1170115500 PRI398 409 1135976160 PRI399 39 1170267735 PRI4 10360 1160614863 PRI40 188 1133631545 PRI400 88 1183543404 PRI401 419 1138396166 PRI402 20 1104618136 PRI403 290 1160228177 PRI404 20 1140254199 PRI405 29 1146876900 PRI406 593 1183236336 PRI407 83 1175880761 PRI408 194 1183366334 PRI409 267 1103620965 PRI41 14 1142991141 PRI410 88 1171815606 PRI411 645 1154675985 PRI412 31 1154431127 PRI413 76 1178147875 PRI414 423 1122531646 PRI415 29 1172448949 PRI416 355 1141845987 PRI417 14 1144954889 PRI418 27 1179386709 PRI419 259 1105338696 PRI42 40 1160458361 PRI420 19 1133950218 PRI421 54 1180118078 PRI422 529 1166706593 PRI423 31 1175912639 PRI424 240 1145065826 PRI425 21 1180894405 PRI426 47 1179227752 PRI427 324 1182866248 PRI428 241 1177607280 PRI429 58 1182337510 PRI43 20 1057613772 PRI430 402 1152830512 PRI431 44 1151634948 PRI432 37 1143620230 PRI433 16 1088880759 PRI434 29 1172575319 PRI435 319 1128405637 PRI436 19 1122111145 PRI437 237 1167529979 PRI438 22 1166218701 PRI439 35 1180090100 PRI44 200 1140863931 PRI440 338 1164714195 PRI441 21 1180589910 PRI442 335 1183831259 PRI443 217 1147408674 PRI444 30 1144456804 PRI445 449 1137912908 PRI446 25 1152222839 PRI447 67 1184077943 PRI448 97 1122866973 PRI449 18 1175183648 PRI45 11 1151193512 PRI450 270 1078319496 PRI451 18 1176136734 PRI452 34 1128529128 PRI453 336 1179599436 PRI454 26 1152198720 PRI455 100 1184022181 PRI456 223 1167431580 PRI457 19 1091959869 PRI458 192 1176329468 PRI459 316 1169332729 PRI46 14 1181280751 PRI460 49 1174191359 PRI461 151 1119576440 PRI462 34 1160083819 PRI463 240 1164766365 PRI464 22 1171522146 PRI465 37 1182812516 PRI466 423 1169577328 PRI467 50 1148816672 PRI468 557 1183750783 PRI469 307 1160761335 PRI47 54 1173482317 PRI470 43 1176325681 PRI471 489 1174210476 PRI472 23 1177973310 PRI473 63 1183861711 PRI474 160 1099347348 PRI475 22 1182587292 PRI476 380 1110685127 PRI477 21 1180196129 PRI478 35 1156225239 PRI479 577 1175380290 PRI48 607 1183152867 PRI480 29 1147606532 PRI481 333 1160165881 PRI482 21 1173091154 PRI483 22 1156431823 PRI484 276 1083400079 PRI485 14 1026150293 PRI486 28 1183275310 PRI487 386 1111964003 PRI488 17 1125549417 PRI489 128 1135628917 PRI49 31 1167460459 PRI490 14 1091125214 PRI491 30 1156269024 PRI492 307 1161203999 PRI493 20 1139087515 PRI494 47 1182040418 PRI495 602 1164413197 PRI496 41 1167807540 PRI497 331 1148540042 PRI498 27 1155946803 PRI499 33 1173630125 PRI5 152425 840442381 PRI50 15 968255797 PRI500 402 1162958913 PRI501 25 1151582193 PRI502 86 1179818100 PRI503 369 1148376489 PRI504 23 1135238555 PRI505 226 1114879275 PRI506 24 1155260752 PRI507 36 1182993398 PRI508 289 1164436387 PRI509 30 1162980653 PRI51 141 1113642329 PRI510 222 1093874982 PRI511 17 1122547959 PRI512 29 1169235295 PRI513 387 1167088006 PRI514 18 1167884431 PRI515 62 1182749845 PRI516 246 1170557969 PRI517 38 1179859497 PRI518 335 1129497602 PRI519 21 1148579718 PRI52 11 1083973634 PRI520 60 1172507724 PRI521 249 1129111945 PRI522 27 1148917466 PRI523 440 1117703618 PRI524 23 1069132309 PRI525 43 1158135491 PRI526 348 1178821458 PRI527 31 1134311829 PRI528 161 1183805148 PRI529 301 1175334531 PRI53 16 954414851 PRI530 45 1172026447 PRI531 895 1147028264 PRI532 21 1184058029 PRI533 52 1169336829 PRI534 442 1147978791 PRI535 22 1144344431 PRI536 86 1180086042 PRI537 440 1162607155 PRI538 68 1173607909 PRI539 163 1182127574 PRI54 39 1178434910 PRI540 321 1166963360 PRI541 53 1177585670 PRI542 26 1148998822 PRI543 25 1148988166 PRI544 530 1173372077 PRI545 18 1137883702 PRI546 42 1170954641 PRI547 370 1137716293 PRI548 26 1108303806 PRI549 78 1180760906 PRI55 9 1103067380 PRI550 546 1139436696 PRI551 36 1151138005 PRI552 428 1153216606 PRI553 27 1149572242 PRI554 61 1181303924 PRI555 347 1134301180 PRI556 44 1172407846 PRI557 668 1146926824 PRI558 24 1164039393 PRI559 35 1152698423 PRI56 13 1114260520 PRI560 225 1050138502 PRI561 17 1116953631 PRI562 47 1161829558 PRI563 263 1131175559 PRI564 17 1167045095 PRI565 130 1170440659 PRI566 23 1170751301 PRI567 45 1168756544 PRI568 336 1077579028 PRI569 31 1171579240 PRI57 202 1058075412 PRI570 46 1165866303 PRI571 185 1169751544 PRI572 36 1160535067 PRI573 67 1085475194 PRI574 16 1175457768 PRI575 21 1175531784 PRI576 150 1179225597 PRI577 29 1173723084 PRI578 189 1134761868 PRI579 16 1139339206 PRI58 12 1137771012 PRI580 21 1153090874 PRI581 220 1149289905 PRI582 15 1183230533 PRI583 51 1183409088 PRI584 199 1182752069 PRI585 18 1045474622 PRI586 171 1059343895 PRI587 16 1172600038 PRI588 40 1158674954 PRI589 203 1164715697 PRI59 13 1168936209 PRI590 140 1142928696 PRI591 20 1131763145 PRI592 137 1148815782 PRI593 15 1100704625 PRI594 26 1127650628 PRI595 14 1150133421 PRI596 28 1166922896 PRI597 160 1129537305 PRI598 16 1117749341 PRI599 52 1176068226 PRI6 19989 1008567045 PRI60 29 1119598237 PRI600 217 1179197902 PRI601 29 1151336253 PRI602 173 1166863352 PRI603 20 1119185302 PRI604 41 1182586466 PRI605 303 1108937327 PRI606 17 1178542928 PRI607 89 1181878085 PRI608 198 1168056922 PRI609 37 1162632930 PRI61 13 1136681750 PRI610 82 1090767801 PRI611 16 1118484017 PRI612 38 1180674386 PRI613 197 1124462681 PRI614 22 1166614165 PRI615 197 1156201482 PRI616 13 1183357777 PRI617 31 1176936859 PRI618 211 1177301751 PRI619 23 1157099048 PRI62 72 1150950945 PRI620 89 1181629503 PRI621 141 1145455058 PRI622 21 1134683646 PRI623 203 1136922984 PRI624 26 1128803731 PRI625 47 1164969225 PRI626 216 1144273751 PRI627 27 1147212275 PRI628 245 1183082543 PRI629 150 1178032495 PRI63 8 1069277973 PRI630 63 1170025397 PRI631 394 1158613244 PRI632 51 1179270913 PRI633 213 1182001532 PRI634 236 1178712747 PRI635 105 1167396875 PRI636 295 1037508240 PRI637 49 1144253249 PRI638 87 1181792319 PRI639 111 1163791102 PRI64 14 1182870917 PRI640 51 1177181081 PRI641 281 1181322695 PRI642 207 1162030194 PRI643 84 1178030256 PRI644 327 1180516469 PRI645 106 1165371512 PRI646 203 1181400504 PRI647 194 1171186638 PRI648 102 1091623059 PRI649 61 1164043386 PRI65 276 1108950718 PRI650 64 1145917483 PRI651 258 1181958699 PRI652 428 1148473811 PRI653 31 1161024218 PRI654 312 1183814897 PRI655 251 1164201158 PRI656 50 1181207252 PRI657 404 1140670929 PRI658 64 1168296557 PRI659 179 1183657962 PRI66 18 1133613294 PRI660 305 1178937361 PRI661 77 1184032239 PRI662 534 1181954998 PRI663 446 1114064345 PRI664 54 1175815478 PRI665 422 1168928105 PRI666 52 1137859327 PRI667 203 1181815950 PRI668 56 1168842034 PRI669 103 1173394187 PRI67 30 1183791123 PRI670 328 1180716257 PRI671 89 1177817236 PRI672 208 1181521116 PRI673 120 1114992882 PRI674 38 1182996135 PRI675 353 1128563635 PRI676 28 1155358462 PRI677 97 1183744343 PRI678 69287 459583772 PRI68 396 1094012951 PRI69 9 1022060953 PRI7 6 1137401032 PRI70 318 1135144509 PRI71 17 1129061517 PRI72 11 1183170586 PRI73 170 1175242492 PRI74 19 1079921441 PRI75 20 1107184059 PRI76 319 1091478744 PRI77 16 1173300867 PRI78 111 1113574380 PRI79 9 1067860042 PRI8 10 1163372937 PRI80 18 1120312625 PRI81 134 1151339059 PRI82 9 1019371483 PRI83 11 1104292429 PRI84 67 1068212420 PRI85 10 1107843258 PRI86 14 1127464071 PRI87 306 1053659872 PRI88 16 1119162041 PRI89 223 1107213108 PRI9 114467 822454647 PRI90 13 1166110364 PRI91 32 1160815068 PRI92 428 1058620120 PRI93 17 1163742934 PRI94 12 1020059052 PRI95 95 1116707204 PRI96 18 1132868537 PRI97 11 1162762611 PRI98 13 1074540305 PRI99 9 1103306497 ROD1 42159 1008837853 ROD10 163 1166541022 ROD100 8 1139757719 ROD101 9 1174668373 ROD102 7 1067359328 ROD103 10 1182029473 ROD104 4 959918585 ROD105 6 1044932681 ROD106 68 1124872912 ROD107 10 1133876088 ROD108 19 1182564383 ROD109 10 1092721418 ROD11 7 1078339014 ROD110 16 1182453566 ROD111 12 1081345329 ROD112 9 1086039483 ROD113 7 934030466 ROD114 3 957465392 ROD115 29446 1078685671 ROD12 90 1160576642 ROD13 9 1118724328 ROD14 15 1161179778 ROD15 16 1135825973 ROD16 72442 1036109422 ROD17 26813 1037075404 ROD18 12 1120355466 ROD19 8 1163882538 ROD2 5909 1093927363 ROD20 12 1101462594 ROD21 7 1065740602 ROD22 110 1130872454 ROD23 10 1095487923 ROD24 8 1173337133 ROD25 8 1063713588 ROD26 9 1146396098 ROD27 10 1068290457 ROD28 8 1081733625 ROD29 11 1082140969 ROD3 6339 1107756976 ROD30 10 1147232155 ROD31 10 1171959357 ROD32 7 1110074623 ROD33 10 1164218519 ROD34 9 1108644203 ROD35 8 1072581452 ROD36 10 1046751576 ROD37 8 1141423843 ROD38 11 1027724205 ROD39 10 1152345994 ROD4 110071 874880522 ROD40 8 1082920857 ROD41 8 1089063230 ROD42 9 1143097394 ROD43 10 1072150743 ROD44 8 1099764473 ROD45 11 1087836125 ROD46 8 1171715672 ROD47 12 1136130400 ROD48 7 1113098900 ROD49 10 1162104909 ROD5 368979 428107367 ROD50 9 1083630069 ROD51 9 1170482326 ROD52 11 1099809287 ROD53 10 1145640092 ROD54 9 1132503232 ROD55 10 1140056814 ROD56 19 1075143845 ROD57 10 1147351773 ROD58 19 1151436343 ROD59 10 1088581837 ROD6 6 1107651413 ROD60 16 1164391722 ROD61 16 1073033435 ROD62 9 1157194591 ROD63 14 1023016171 ROD64 7 1166266691 ROD65 9 1087901740 ROD66 9 1097713367 ROD67 9 1154691504 ROD68 9 1025612394 ROD69 7 1082392531 ROD7 9 1154552993 ROD70 10 1140331137 ROD71 9 1166871002 ROD72 14 1168528777 ROD73 8 1126440038 ROD74 12 1149086196 ROD75 10 1051885153 ROD76 12 1161926762 ROD77 11 1086828534 ROD78 10 1148564844 ROD79 12 1022809212 ROD8 10 1090080857 ROD80 8 1104739191 ROD81 14 1038854127 ROD82 7 1113949024 ROD83 14 1147316566 ROD84 9 1098255843 ROD85 13 1183189045 ROD86 11 1140514852 ROD87 14 1175080086 ROD88 13 1051083644 ROD89 9 1156825032 ROD9 7 1101532017 ROD90 52 1118266047 ROD91 12 1173398982 ROD92 18 1154143271 ROD93 11 1123323681 ROD94 18 1080123782 ROD95 11 1146173548 ROD96 148 1098231299 ROD97 7 1166537123 ROD98 12 1154027383 ROD99 11 1029292292 STS1 422715 213740430 STS2 348965 243835819 STS3 575308 183346888 SYN1 54450 995654191 SYN2 10 1040305979 SYN3 6 1076407027 SYN4 9 1128400530 SYN5 10 1040305979 SYN6 6 1076407027 SYN7 333 913831861 SYN8 81628 894262538 SYN9 179515 678853231 TSA1 675528 274465015 TSA10 491192 443611767 TSA11 464181 476087645 TSA12 540291 380872693 TSA13 535748 387202332 TSA14 552160 395860719 TSA15 499112 393973649 TSA16 462266 345145472 TSA17 529507 428880230 TSA18 455421 496345807 TSA19 550542 444773023 TSA2 551981 321350516 TSA20 478162 355239068 TSA21 423856 348553053 TSA22 491562 422573299 TSA23 490034 425487114 TSA24 503013 447608420 TSA25 551548 412916060 TSA26 320152 599341413 TSA27 321648 516780882 TSA28 213058 240570297 TSA29 247905 86002956 TSA3 516598 398806258 TSA30 255131 65202908 TSA31 493149 400383134 TSA32 391059 545767960 TSA33 368396 574961292 TSA34 423098 474002342 TSA35 420477 476157201 TSA36 451326 415382230 TSA37 55893 33058475 TSA4 505646 416286608 TSA5 500719 360224396 TSA6 584826 316637773 TSA7 573575 366126568 TSA8 593046 269968508 TSA9 537002 422963238 UNA1 775 4564014 VRL1 351163 457346981 VRL10 184924 672611559 VRL100 35644 649464429 VRL101 23467 657877726 VRL102 25978 663706084 VRL103 24531 665021777 VRL104 23045 658870855 VRL105 22523 663482052 VRL106 22600 662506209 VRL107 22625 663126370 VRL108 22765 662548048 VRL109 25115 658265548 VRL11 234058 544215304 VRL110 22654 663566554 VRL111 22842 661579770 VRL112 25318 662414470 VRL113 23954 663400383 VRL114 23979 663284298 VRL115 24146 662178055 VRL116 25265 663622603 VRL117 24700 668469574 VRL118 24377 666170905 VRL119 24293 667090788 VRL12 236058 536821756 VRL120 24242 666307455 VRL121 23867 666335412 VRL122 23832 665636760 VRL123 22975 669128685 VRL124 24438 664793838 VRL125 23290 664314226 VRL126 27343 660213601 VRL127 24713 664774627 VRL128 23328 663753417 VRL129 24206 660256621 VRL13 164380 570533841 VRL130 25483 660396314 VRL131 24284 666786490 VRL132 23440 663978651 VRL133 23857 667632281 VRL134 26576 664738428 VRL135 23426 662937886 VRL136 24463 664889764 VRL137 25859 660480740 VRL138 25814 667687611 VRL139 26244 669656258 VRL14 71526 649975294 VRL140 26103 664750248 VRL141 23653 664105854 VRL142 26765 662537097 VRL143 25165 661566724 VRL144 30274 655088373 VRL145 23936 665147071 VRL146 24898 661591462 VRL147 25495 664190528 VRL148 23106 665607228 VRL149 30231 665267826 VRL15 70948 637475719 VRL150 23598 662903286 VRL151 24032 665370785 VRL152 23335 673003337 VRL153 24481 666080503 VRL154 25005 667966041 VRL155 23183 672462685 VRL156 23014 672490613 VRL157 30613 658356410 VRL158 30294 660984421 VRL159 26082 666494670 VRL16 43898 655971130 VRL160 31811 659569069 VRL161 25500 668868181 VRL162 28314 663033097 VRL163 29166 661808556 VRL164 25452 659113880 VRL165 24201 666353716 VRL166 28023 663117141 VRL167 33245 654253184 VRL168 31672 656987125 VRL169 27331 663982349 VRL17 28017 665072173 VRL170 24412 671404681 VRL171 24703 683833295 VRL172 25719 670125507 VRL173 26768 662665274 VRL174 36508 654620575 VRL175 32554 670131167 VRL176 40567 658779847 VRL177 25908 667259685 VRL178 43253 659801522 VRL179 39247 661060860 VRL18 28515 663857971 VRL180 33875 666287421 VRL181 30138 670946557 VRL182 24609 665585845 VRL183 33170 664341462 VRL184 34523 665769932 VRL185 33291 661616650 VRL186 44370 657386933 VRL187 35021 665532274 VRL188 28037 666423398 VRL189 35492 978798194 VRL19 32671 659452304 VRL190 37496 1119656729 VRL191 37923 1130901802 VRL192 38040 1133843948 VRL193 37523 1119932674 VRL194 37496 1119149144 VRL195 37277 1113506534 VRL196 37149 1110012774 VRL197 37053 1109906128 VRL198 37273 1112562481 VRL199 36738 1097911112 VRL2 133016 576069916 VRL20 27200 660013873 VRL200 37068 1107525129 VRL201 36932 1102584974 VRL202 37111 1107956022 VRL203 37272 1113127768 VRL204 37014 1105781088 VRL205 37161 1110249883 VRL206 36976 1105058231 VRL207 37061 1107627844 VRL208 37039 1106892121 VRL209 36595 1093726573 VRL21 35885 653865825 VRL210 36670 1095891129 VRL211 36952 1104061053 VRL212 36970 1104582761 VRL213 37503 1119163441 VRL214 37059 1106874927 VRL215 37128 1109105553 VRL216 37082 1107169017 VRL217 37199 1111341641 VRL218 37093 1108443340 VRL219 37044 1106545638 VRL22 23938 660978838 VRL220 37584 1121105389 VRL221 37307 1114144127 VRL222 36924 1103092257 VRL223 37272 1112590106 VRL224 37292 1113124849 VRL225 37267 1112394036 VRL226 37039 1106461412 VRL227 37077 1107444282 VRL228 37303 1113460703 VRL229 36822 1100149091 VRL23 24223 663195059 VRL230 36879 1101621387 VRL231 37069 1106541221 VRL232 37261 1111715470 VRL233 36994 1104936237 VRL234 36954 1103854243 VRL235 37018 1105741589 VRL236 37119 1108863424 VRL237 37503 1115688518 VRL238 37304 1114471937 VRL239 37149 1109654670 VRL24 30484 658271040 VRL240 37020 1105636095 VRL241 37101 1107942004 VRL242 37118 1108392087 VRL243 36642 1094361532 VRL244 36967 1103739088 VRL245 37098 1107534255 VRL246 37085 1107073700 VRL247 37183 1110129527 VRL248 37088 1107071539 VRL249 37621 1121207836 VRL25 23751 662188677 VRL250 37411 1117373191 VRL251 37395 1116908974 VRL252 37227 1111782348 VRL253 36419 1087090592 VRL254 36345 1084791108 VRL255 37329 1110148929 VRL256 37909 1128944819 VRL257 37639 1122647871 VRL258 37956 1128635316 VRL259 37745 1124074772 VRL26 23993 666060116 VRL260 37858 1126763515 VRL261 37896 1129006744 VRL262 37452 1116081628 VRL263 37877 1128105873 VRL264 37544 1121021583 VRL265 37595 1124692874 VRL266 36350 1085273481 VRL267 37743 1122383100 VRL268 37531 1120899857 VRL269 37608 1123440105 VRL27 23484 664870451 VRL270 37453 1118408802 VRL271 37226 1111831054 VRL272 37313 1116010490 VRL273 36911 1105786735 VRL274 37944 1100358165 VRL275 37602 1093562417 VRL276 36008 1075590019 VRL277 35953 1074175384 VRL278 36476 1090145093 VRL279 36179 1081321085 VRL28 24749 664274634 VRL280 36378 1086217761 VRL281 36298 1084385050 VRL282 36487 1089465697 VRL283 36484 1089220209 VRL284 36488 1089372547 VRL285 36486 1089338529 VRL286 36481 1089220424 VRL287 36592 1092059667 VRL288 36706 1094842466 VRL289 37105 1105437125 VRL29 26469 663572786 VRL290 36758 1096474054 VRL291 37926 1126378428 VRL292 38141 1132545419 VRL293 38137 1132526094 VRL294 38086 1131013558 VRL295 38121 1131732569 VRL296 38101 1131917304 VRL297 38126 1131976496 VRL298 38075 1087690298 VRL299 36383 1086819903 VRL3 315094 427431117 VRL30 29542 666876704 VRL300 36682 1095968100 VRL301 36604 1093480233 VRL302 36583 1092885006 VRL303 36591 1093110632 VRL304 36577 1092689105 VRL305 36560 1092204028 VRL306 36141 1080005541 VRL307 36025 1073589988 VRL308 36086 1075002863 VRL309 36102 1071451552 VRL31 30929 663264497 VRL310 37128 1098198848 VRL311 37584 1122051304 VRL312 37513 1120444335 VRL313 36041 1077014198 VRL314 35819 1070220007 VRL315 36167 1080786611 VRL316 39034 1087110310 VRL317 40346 1102010810 VRL318 38253 1095396120 VRL319 27587 785233057 VRL32 26609 665758715 VRL320 29381 672070309 VRL321 31070 667383066 VRL322 28103 669377583 VRL323 43850 656205080 VRL324 49606 647422212 VRL325 36881 665110982 VRL326 70256 628839383 VRL327 58983 650159121 VRL328 37915 658466890 VRL329 26499 671745822 VRL33 24508 665913453 VRL330 45145 662862553 VRL331 35075 661199865 VRL332 34569 664352267 VRL333 69802 231273763 VRL34 24236 664808184 VRL35 25807 664168769 VRL36 23355 658811974 VRL37 22601 665008768 VRL38 23339 661882449 VRL39 24306 660059820 VRL4 278257 596485111 VRL40 33302 992086980 VRL41 37094 1109119992 VRL42 37112 1109234873 VRL43 37136 1109746805 VRL44 29227 860084606 VRL45 23593 666740196 VRL46 24655 664251446 VRL47 22399 660067189 VRL48 22805 659252076 VRL49 23048 663961557 VRL5 324934 471829036 VRL50 23454 660166313 VRL51 22526 663955359 VRL52 22842 665064978 VRL53 22621 661342621 VRL54 23362 664843796 VRL55 23514 667731781 VRL56 22632 662348502 VRL57 22987 665729439 VRL58 22697 664820807 VRL59 22827 662360766 VRL6 283216 469078842 VRL60 24327 666850369 VRL61 23306 660002550 VRL62 24639 669829411 VRL63 24345 666430147 VRL64 22551 661622018 VRL65 24393 668682389 VRL66 22776 664050249 VRL67 23625 665473168 VRL68 25536 663205776 VRL69 22510 662578747 VRL7 252072 510639141 VRL70 23291 665231532 VRL71 23030 664226601 VRL72 22361 663217419 VRL73 23301 668005865 VRL74 23760 664018085 VRL75 23230 664664675 VRL76 23289 664594102 VRL77 24017 660503308 VRL78 24696 665178664 VRL79 22342 663260070 VRL8 261552 494594080 VRL80 23297 666948011 VRL81 23158 665317712 VRL82 22783 664305999 VRL83 23016 666212551 VRL84 23334 664609928 VRL85 22366 662346732 VRL86 22367 665476722 VRL87 22766 667406084 VRL88 22630 661875227 VRL89 22940 673366562 VRL9 250499 526801945 VRL90 22899 664074978 VRL91 22572 665122491 VRL92 23077 665245811 VRL93 22729 668121498 VRL94 22886 661772417 VRL95 28214 670013032 VRL96 23633 666799022 VRL97 22903 663209255 VRL98 25526 662817093 VRL99 22719 661581539 VRT1 151996 879100516 VRT10 24 1183125039 VRT100 37 1154265027 VRT101 113 640305917 VRT102 2 806190538 VRT103 2 696540660 VRT104 4 904864528 VRT105 44 1019397561 VRT106 36 1178642032 VRT107 61 1042460441 VRT108 153 1133976286 VRT109 20 1151700990 VRT11 27 1031473596 VRT110 1589 1155278298 VRT111 64 1040389365 VRT112 5 1114313003 VRT113 40 1121950258 VRT114 26 1165870027 VRT115 34 993803116 VRT116 10 863470745 VRT117 99 1055299498 VRT118 45 1173161375 VRT119 34 1154532236 VRT12 22 1168150288 VRT120 37 1165711270 VRT121 20 1174931749 VRT122 18 1153973849 VRT123 22 1182636590 VRT124 312 1171570949 VRT125 40 1165814453 VRT126 41 1170464824 VRT127 19 1155157253 VRT128 42 1177238185 VRT129 40 1181828030 VRT13 47 1163387179 VRT130 52 1166638748 VRT131 30 1154120422 VRT132 26 1093949723 VRT133 25 1160740832 VRT134 37 1158359519 VRT135 24 1031287813 VRT136 48 1177450183 VRT137 37 1168924425 VRT138 18 1164074289 VRT139 26 1182902339 VRT14 25 1139276204 VRT140 39 1133969144 VRT141 36 1168754407 VRT142 31 1163137436 VRT143 36 1170882423 VRT144 36 1152871582 VRT145 21 1177136033 VRT146 17 1131769706 VRT147 40 1099550703 VRT148 14 1151376722 VRT149 40 1181857143 VRT15 27 1160142853 VRT150 43 1118286302 VRT151 21 1172396618 VRT152 21 1159704045 VRT153 37 1180805679 VRT154 36 1074349268 VRT155 305 1147865056 VRT156 37 1155455580 VRT157 53 1170748576 VRT158 39 1042530955 VRT159 5 1145352964 VRT16 32 1169570528 VRT160 8 1166817677 VRT161 22 1099238862 VRT162 24 1181050320 VRT163 28 1128461858 VRT164 23 1179977145 VRT165 17 1140261904 VRT166 47 1162361489 VRT167 33 1082875689 VRT168 40 1151038532 VRT169 35 1168555234 VRT17 16539 1109591775 VRT170 21 1052433236 VRT171 5 1056736991 VRT172 8 1141521528 VRT173 13 1130579885 VRT174 20 1160195610 VRT175 50 1171449262 VRT176 36 1181564440 VRT177 159 1113225433 VRT178 22 1003732213 VRT179 42 1170859841 VRT18 298573 690422199 VRT180 43 1076296835 VRT181 41 1138566252 VRT182 14 1179788972 VRT183 13 1137303478 VRT184 17 1162516663 VRT185 15 1104770266 VRT186 16 1019314169 VRT187 23 1178565343 VRT188 37 1182347574 VRT189 50 1134087574 VRT19 140166 939601363 VRT190 24 926554202 VRT191 4 1160654489 VRT192 6 1055180276 VRT193 11 1145381641 VRT194 18 1181285424 VRT195 15 1146666012 VRT196 27 1182848304 VRT197 21 1151141727 VRT198 16 1122899890 VRT199 42 1156993143 VRT2 30 1174650673 VRT20 393201 557792495 VRT200 18 1168032833 VRT201 24 1179938402 VRT202 27 1158754540 VRT203 31 1171954388 VRT204 14 1058831880 VRT205 7 1098198485 VRT206 10 1112454070 VRT207 21 982002519 VRT208 10 1173938281 VRT209 28 1176020601 VRT21 489230 346433233 VRT210 41 1179233542 VRT211 101 1118100577 VRT212 88 1107333274 VRT213 92 1110353805 VRT214 75 1110401066 VRT215 47 1183640734 VRT216 58 1143023906 VRT217 33 701808784 VRT218 1 1377224146 VRT219 1 1246042375 VRT22 529054 350155128 VRT220 1 1134302525 VRT221 1 1092803421 VRT222 1 995116563 VRT223 1 979649957 VRT224 3 1100551194 VRT225 3 511216884 VRT226 1 1415942608 VRT227 1 1279781030 VRT228 1 1144564707 VRT229 1 1114117749 VRT23 351465 571626733 VRT230 1 1027171557 VRT231 1 998592877 VRT232 3 1103810273 VRT233 4 510174135 VRT234 1 1950672471 VRT235 1 1882935974 VRT236 1 1702342136 VRT237 1 1361375652 VRT238 1 1317398316 VRT239 1 1293891082 VRT24 60780 1110009698 VRT240 1 1269970046 VRT241 1 1248769876 VRT242 1 1238911699 VRT243 1 1201415365 VRT244 1 1199165587 VRT245 1 1184551933 VRT246 1 1183987023 VRT247 1 1134708421 VRT248 1 1024245046 VRT249 1 993383533 VRT25 269221 908898057 VRT250 3 1080922639 VRT251 39 1080538033 VRT252 42 1162049517 VRT253 43 1144321272 VRT254 19 1033892758 VRT255 8 1159899222 VRT256 12 1157225835 VRT257 19 1098867675 VRT258 15 1097791464 VRT259 18 1112130599 VRT26 13721 1154567745 VRT260 34 1182680941 VRT261 17 1164381965 VRT262 34 1077194331 VRT263 34 1012246650 VRT264 33 1009704254 VRT265 8 201061856 VRT266 1 2146314909 VRT267 1 459926735 VRT268 1 2140055507 VRT269 1 526359502 VRT27 47 1182953113 VRT270 1 2132484007 VRT271 1 510744347 VRT272 1 2141402031 VRT273 1 154081089 VRT274 1 2143815925 VRT275 1 17068361 VRT276 1 2139332349 VRT277 1 1965638399 VRT278 1 1730884321 VRT279 1 1292683186 VRT28 42 1176638933 VRT280 1 1220333517 VRT281 1 1209226565 VRT282 7 1134997840 VRT283 26 1123273225 VRT284 25 1160795076 VRT285 6 147321427 VRT286 1 2144885605 VRT287 1 368539449 VRT288 1 2136077662 VRT289 1 338547956 VRT29 267 1168597478 VRT290 1 2137795666 VRT291 1 330263317 VRT292 1 2145962954 VRT293 1 25971532 VRT294 1 2035433746 VRT295 1 1925992481 VRT296 1 1778043439 VRT297 1 1581089616 VRT298 1 1245844088 VRT299 1 1157923350 VRT3 123 1174179528 VRT30 17 1056807004 VRT300 1 1112128736 VRT301 2 1122751352 VRT302 11 1154196115 VRT303 44 1172047204 VRT304 24 1172348617 VRT305 17 1176756037 VRT306 32 1112452156 VRT307 33 1117361619 VRT308 7 1120783487 VRT309 41 1174844090 VRT31 4 1123547344 VRT310 42 1145319211 VRT311 50 1118086011 VRT312 46 858628186 VRT313 5 1183989260 VRT314 39 1181983406 VRT315 16 1169772349 VRT316 33 1168068530 VRT317 62450 455423914 VRT32 6 1096697320 VRT33 20 1158617966 VRT34 42 1176628400 VRT35 39 827624945 VRT36 1 839681426 VRT37 1 825560060 VRT38 2 1082779519 VRT39 3 1072075408 VRT4 106340 999210135 VRT40 8 1112968075 VRT41 21 1180520471 VRT42 22 1158850226 VRT43 353 1181688611 VRT44 28 1098865212 VRT45 1 662004353 VRT46 2 911653698 VRT47 3 1021932445 VRT48 490 1179856557 VRT49 30 1161799788 VRT5 72668 919264025 VRT50 24 1180126066 VRT51 24 1139184549 VRT52 40 1180636041 VRT53 73 1164818053 VRT54 7 1156606571 VRT55 3 1012738546 VRT56 6 1130561284 VRT57 468 1183012903 VRT58 10 1163204068 VRT59 618 1178963146 VRT6 38 1174624699 VRT60 13 971142702 VRT61 5 1115794738 VRT62 6 1049980901 VRT63 34 1152243713 VRT64 20 1141871979 VRT65 38 1132348904 VRT66 226 1180434283 VRT67 21 1114739427 VRT68 21 1172326162 VRT69 53 1183886833 VRT7 42 1157042340 VRT70 20 1122316722 VRT71 17 1136974292 VRT72 22 1140340918 VRT73 23 1161212858 VRT74 23 1154719176 VRT75 119 1154956026 VRT76 90 1170752658 VRT77 16 447555359 VRT78 1 843366180 VRT79 1 842558404 VRT8 52 1150524292 VRT80 1 707956555 VRT81 1 635713434 VRT82 2 1006930617 VRT83 6 953838719 VRT84 1 690654357 VRT85 2 1036857559 VRT86 3 1135937014 VRT87 37 1176417013 VRT88 4329 1156513083 VRT89 264920 688883100 VRT9 24 1174750678 VRT90 397202 413444402 VRT91 235838 658431382 VRT92 74 1171078851 VRT93 46 1177526580 VRT94 23 1135464976 VRT95 428 1148384437 VRT96 18 1172319565 VRT97 64 1174757191 VRT98 36 1160960135 VRT99 30 1178103092 2.2.7 Selected Per-Organism Statistics The following table provides the number of entries and bases of DNA/RNA for the twenty most sequenced organisms in Release 264.0, excluding chloroplast and mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences, 'constructed' CON-division sequences, synthetic construct sequences, uncultured sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study sequences: Entries Bases Species 28009503 773933605694 Homo sapiens 1945466 296898020056 Triticum aestivum 9010325 268021106922 Severe acute respiratory syndrome coronavirus 2 113558 246951178671 Hordeum vulgare 753 212675690135 Hordeum bulbosum 1347604 126088504181 Hordeum vulgare subsp. vulgare 164 93011095388 Viscum album 29876 92980158773 Hordeum vulgare subsp. spontaneum 10099299 46318374347 Mus musculus 183077 31481051337 Escherichia coli 504 22852581183 Lissotriton helveticus 1627 22052873125 Triturus cristatus 1343 21278745710 Lissotriton vulgaris 29814 21128007178 Avena sativa 37884 21022050191 Klebsiella pneumoniae 1547 20633298192 Chenopodium quinoa 2641080 20529832955 Arabidopsis thaliana 553560 20141516169 Capra hircus 768 17031737000 Bombina variegata 2244724 16211175315 Bos taurus 2.2.8 Growth of GenBank The following table lists the number of bases and the number of sequence records in each release of GenBank, beginning with Release 3 in 1982. CON-division records are not represented in these statistics: because they are constructed from the non-CON records in the database, their inclusion here would be a form of double-counting. Also note that this table is limited to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records. From 1982 to the present, the number of bases in GenBank has doubled approximately every 18 months. Release Date Base Pairs Entries 3 Dec 1982 680338 606 14 Nov 1983 2274029 2427 20 May 1984 3002088 3665 24 Sep 1984 3323270 4135 25 Oct 1984 3368765 4175 26 Nov 1984 3689752 4393 32 May 1985 4211931 4954 36 Sep 1985 5204420 5700 40 Feb 1986 5925429 6642 42 May 1986 6765476 7416 44 Aug 1986 8442357 8823 46 Nov 1986 9615371 9978 48 Feb 1987 10961380 10913 50 May 1987 13048473 12534 52 Aug 1987 14855145 14020 53 Sep 1987 15514776 14584 54 Dec 1987 16752872 15465 55 Mar 1988 19156002 17047 56 Jun 1988 20795279 18226 57 Sep 1988 22019698 19044 57.1 Oct 1988 23800000 20579 58 Dec 1988 24690876 21248 59 Mar 1989 26382491 22479 60 Jun 1989 31808784 26317 61 Sep 1989 34762585 28791 62 Dec 1989 37183950 31229 63 Mar 1990 40127752 33377 64 Jun 1990 42495893 35100 65 Sep 1990 49179285 39533 66 Dec 1990 51306092 41057 67 Mar 1991 55169276 43903 68 Jun 1991 65868799 51418 69 Sep 1991 71947426 55627 70 Dec 1991 77337678 58952 71 Mar 1992 83894652 65100 72 Jun 1992 92160761 71280 73 Sep 1992 101008486 78608 74 Dec 1992 120242234 97084 75 Feb 1993 126212259 106684 76 Apr 1993 129968355 111911 77 Jun 1993 138904393 120134 78 Aug 1993 147215633 131328 79 Oct 1993 157152442 143492 80 Dec 1993 163802597 150744 81 Feb 1994 173261500 162946 82 Apr 1994 180589455 169896 83 Jun 1994 191393939 182753 84 Aug 1994 201815802 196703 85 Oct 1994 217102462 215273 86 Dec 1994 230485928 237775 87 Feb 1995 248499214 269478 88 Apr 1995 286094556 352414 89 Jun 1995 318624568 425211 90 Aug 1995 353713490 492483 91 Oct 1995 384939485 555694 92 Dec 1995 425860958 620765 93 Feb 1996 463758833 685693 94 Apr 1996 499127741 744295 95 Jun 1996 551750920 835487 96 Aug 1996 602072354 920588 97 Oct 1996 651972984 1021211 98 Dec 1996 730552938 1114581 99 Feb 1997 786898138 1192505 100 Apr 1997 842864309 1274747 101 Jun 1997 966993087 1491069 102 Aug 1997 1053474516 1610848 103 Oct 1997 1160300687 1765847 104 Dec 1997 1258290513 1891953 105 Feb 1998 1372368913 2042325 106 Apr 1998 1502542306 2209232 107 Jun 1998 1622041465 2355928 108 Aug 1998 1797137713 2532359 109 Oct 1998 2008761784 2837897 110 Dec 1998 2162067871 3043729 111 Apr 1999 2569578208 3525418 112 Jun 1999 2974791993 4028171 113 Aug 1999 3400237391 4610118 114 Oct 1999 3841163011 4864570 115 Dec 1999 4653932745 5354511 116 Feb 2000 5805414935 5691170 117 Apr 2000 7376080723 6215002 118 Jun 2000 8604221980 7077491 119 Aug 2000 9545724824 8214339 120 Oct 2000 10335692655 9102634 121 Dec 2000 11101066288 10106023 122 Feb 2001 11720120326 10896781 123 Apr 2001 12418544023 11545572 124 Jun 2001 12973707065 12243766 125 Aug 2001 13543364296 12813516 126 Oct 2001 14396883064 13602262 127 Dec 2001 15849921438 14976310 128 Feb 2002 17089143893 15465325 129 Apr 2002 19072679701 16769983 130 Jun 2002 20648748345 17471130 131 Aug 2002 22616937182 18197119 132 Oct 2002 26525934656 19808101 133 Dec 2002 28507990166 22318883 134 Feb 2003 29358082791 23035823 135 Apr 2003 31099264455 24027936 136 Jun 2003 32528249295 25592865 137 Aug 2003 33865022251 27213748 138 Oct 2003 35599621471 29819397 139 Dec 2003 36553368485 30968418 140 Feb 2004 37893844733 32549400 141 Apr 2004 38989342565 33676218 142 Jun 2004 40325321348 35532003 143 Aug 2004 41808045653 37343937 144 Oct 2004 43194602655 38941263 145 Dec 2004 44575745176 40604319 146 Feb 2005 46849831226 42734478 147 Apr 2005 48235738567 44202133 148 Jun 2005 49398852122 45236251 149 Aug 2005 51674486881 46947388 150 Oct 2005 53655236500 49152445 151 Dec 2005 56037734462 52016762 152 Feb 2006 59750386305 54584635 153 Apr 2006 61582143971 56620500 154 Jun 2006 63412609711 58890345 155 Aug 2006 65369091950 61132599 156 Oct 2006 66925938907 62765195 157 Dec 2006 69019290705 64893747 158 Feb 2007 71292211453 67218344 159 Apr 2007 75742041056 71802595 160 Jun 2007 77248690945 73078143 161 Aug 2007 79525559650 76146236 162 Oct 2007 81563399765 77632813 163 Dec 2007 83874179730 80388382 164 Feb 2008 85759586764 82853685 165 Apr 2008 89172350468 85500730 166 Jun 2008 92008611867 88554578 167 Aug 2008 95033791652 92748599 168 Oct 2008 97381682336 96400790 169 Dec 2008 99116431942 98868465 170 Feb 2009 101467270308 101815678 171 Apr 2009 102980268709 103335421 172 Jun 2009 105277306080 106073709 173 Aug 2009 106533156756 108431692 174 Oct 2009 108560236506 110946879 175 Dec 2009 110118557163 112910950 176 Feb 2010 112326229652 116461672 177 Apr 2010 114348888771 119112251 178 Jun 2010 115624497715 120604423 179 Aug 2010 117476523128 122941883 180 Oct 2010 118551641086 125764384 181 Dec 2010 122082812719 129902276 182 Feb 2011 124277818310 132015054 183 Apr 2011 126551501141 135440924 184 Jun 2011 129178292958 140482268 185 Aug 2011 130671233801 142284608 186 Oct 2011 132067413372 144458648 187 Dec 2011 135117731375 146413798 188 Feb 2012 137384889783 149819246 189 Apr 2012 139266481398 151824421 190 Jun 2012 141343240755 154130210 191 Aug 2012 143081765233 156424033 192 Oct 2012 145430961262 157889737 193 Dec 2012 148390863904 161140325 194 Feb 2013 150141354858 162886727 195 Apr 2013 151178979155 164136731 196 Jun 2013 152599230112 165740164 197 Aug 2013 154192921011 167295840 198 Oct 2013 155176494699 168335396 199 Dec 2013 156230531562 169331407 200 Feb 2014 157943793171 171123749 201 Apr 2014 159813411760 171744486 202 Jun 2014 161822845643 173353076 203 Aug 2014 165722980375 174108750 204 Oct 2014 181563676918 178322253 205 Dec 2014 184938063614 179295769 206 Feb 2015 187893826750 181336445 207 Apr 2015 189739230107 182188746 208 Jun 2015 193921042946 185019352 209 Aug 2015 199823644287 187066846 210 Oct 2015 202237081559 188372017 211 Dec 2015 203939111071 189232925 212 Feb 2016 207018196067 190250235 213 Apr 2016 211423912047 193739511 214 Jun 2016 213200907819 194463572 215 Aug 2016 217971437647 196120831 216 Oct 2016 220731315250 197390691 217 Dec 2016 224973060433 198565475 218 Feb 2017 228719437638 199341377 219 Apr 2017 231824951552 200877884 220 Jun 2017 234997362623 201663568 221 Aug 2017 240343378258 203180606 222 Oct 2017 244914705468 203953682 223 Dec 2017 249722163594 206293625 224 Feb 2018 253630708098 207040555 225 Apr 2018 260189141631 208452303 226 Jun 2018 263957884539 209775348 227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease) 228 Oct 2018 279668290132 209656636 229 Dec 2018 285688542186 211281415 230 Feb 2019 303709510632 212260377 231 Apr 2019 321680566570 212775414 232 Jun 2019 329835282370 213383758 233 Aug 2019 366733917629 213865349 234 Oct 2019 386197018538 216763706 235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease) 236 Feb 2020 399376854872 216214215 237 Apr 2020 415770027949 216531829 238 Jun 2020 427823258901 217122233 239 Aug 2020 654057069549 218642238 240 Oct 2020 698688094046 219055207 241 Dec 2020 723003822007 221467827 242 Feb 2021 776291211106 226241476 243 Apr 2021 832400799511 227123201 244 Jun 2021 866009790959 227888889 245 Aug 2021 940513260726 231982592 246 Oct 2021 1014763752113 233642893 247 Dec 2021 1053275115030 234557297 248 Feb 2022 1173984081721 236338284 249 Apr 2022 1266154890918 237520318 250 Jun 2022 1395628631187 239017893 251 Aug 2022 1492800704497 239915786 252 Oct 2022 1562963366851 240539282 253 Dec 2022 1635594138493 241015745 254 Feb 2023 1731302248418 241830635 255 Apr 2023 1826746318813 242554936 256 Jun 2023 1966479976146 243560863 257 Aug 2023 2112058517945 246119175 258 Oct 2023 2433391164875 247777761 259 Dec 2023 2570711588044 249060436 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 3213818003787 250803006 261 Jun 2024 3387240663231 251094334 262 Aug 2024 3675462701077 251998350 263 Oct 2024 4250942573681 252347664 264 Dec 2024 5085904976338 254365075 The following table lists the number of bases and the number of sequence records for WGS sequences processed at GenBank, beginning with Release 129.0 in April of 2002. Please note that WGS data are not distributed in conjunction with GenBank releases. Rather, per-project data files are continuously available in the WGS areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs Release Date Base Pairs Entries 129 Apr 2002 692266338 172768 130 Jun 2002 3267608441 397502 131 Aug 2002 3848375582 427771 132 Oct 2002 3892435593 434224 133 Dec 2002 6702372564 597042 134 Feb 2003 6705740844 597345 135 Apr 2003 6897080355 596818 136 Jun 2003 6992663962 607155 137 Aug 2003 7144761762 593801 138 Oct 2003 8662242833 1683437 139 Dec 2003 14523454868 2547094 140 Feb 2004 22804145885 3188754 141 Apr 2004 24758556215 4112532 142 Jun 2004 25592758366 4353890 143 Aug 2004 28128611847 4427773 144 Oct 2004 30871590379 5285276 145 Dec 2004 35009256228 5410415 146 Feb 2005 38076300084 6111782 147 Apr 2005 39523208346 6685746 148 Jun 2005 46767232565 8711924 149 Aug 2005 53346605784 10276161 150 Oct 2005 56162807647 11169448 151 Dec 2005 59638900034 12088491 152 Feb 2006 63183065091 12465546 153 Apr 2006 67488612571 13573144 154 Jun 2006 78858635822 17733973 155 Aug 2006 80369977826 17960667 156 Oct 2006 81127502509 18500772 157 Dec 2006 81611376856 18540918 158 Feb 2007 86043478524 19421576 159 Apr 2007 93022691867 23446831 160 Jun 2007 97102606459 23718400 161 Aug 2007 101964323738 25384475 162 Oct 2007 102003045298 25354041 163 Dec 2007 106505691578 26177471 164 Feb 2008 108635736141 27439206 165 Apr 2008 110500961400 26931049 166 Jun 2008 113639291344 39163548 167 Aug 2008 118593509342 40214247 168 Oct 2008 136085973423 46108952 169 Dec 2008 141374971004 48394838 170 Feb 2009 143797800446 49036947 171 Apr 2009 144522542010 48948309 172 Jun 2009 145959997864 49063546 173 Aug 2009 148165117763 48443067 174 Oct 2009 149348923035 48119301 175 Dec 2009 158317168385 54076973 176 Feb 2010 163991858015 57134273 177 Apr 2010 165536009514 58361599 178 Jun 2010 167725292032 58592700 179 Aug 2010 169253846128 58994334 180 Oct 2010 175339059129 59397637 181 Dec 2010 177385297156 59608311 182 Feb 2011 190034462797 62349795 183 Apr 2011 191401393188 62715288 184 Jun 2011 200487078184 63735078 185 Aug 2011 208315831132 64997137 186 Oct 2011 218666368056 68330215 187 Dec 2011 239868309609 73729553 188 Feb 2012 261370512675 78656704 189 Apr 2012 272693351548 80905298 190 Jun 2012 287577367116 82076779 191 Aug 2012 308196411905 84020064 192 Oct 2012 333881846451 86480509 193 Dec 2012 356002922838 92767765 194 Feb 2013 390900990416 103101291 195 Apr 2013 418026593606 110509314 196 Jun 2013 453829752320 112488036 197 Aug 2013 500420412665 124812020 198 Oct 2013 535842167741 130203205 199 Dec 2013 556764321498 133818570 200 Feb 2014 591378698544 139725795 201 Apr 2014 621015432437 143446790 202 Jun 2014 719581958743 175779064 203 Aug 2014 774052098731 189080419 204 Oct 2014 805549167708 196049974 205 Dec 2014 848977922022 200301550 206 Feb 2015 873281414087 205465046 207 Apr 2015 969102906813 243779199 208 Jun 2015 1038937210221 258702138 209 Aug 2015 1163275601001 302955543 210 Oct 2015 1222635267498 309198943 211 Dec 2015 1297865618365 317122157 212 Feb 2016 1399865495608 333012760 213 Apr 2016 1452207704949 338922537 214 Jun 2016 1556175944648 350278081 215 Aug 2016 1637224970324 359796497 216 Oct 2016 1676238489250 363213315 217 Dec 2016 1817189565845 395301176 218 Feb 2017 1892966308635 409490397 219 Apr 2017 2035032639807 451840147 220 Jun 2017 2164683993369 487891767 221 Aug 2017 2242294609510 499965722 222 Oct 2017 2318156361999 508825331 223 Dec 2017 2466098053327 551063065 224 Feb 2018 2608532210351 564286852 225 Apr 2018 2784740996536 621379029 226 Jun 2018 2944617324086 639804105 227 Aug 2018 3204855013281 665309765 228 Oct 2018 3444172142207 722438528 229 Dec 2018 3656719423096 773773190 230 Feb 2019 4164513961679 945019312 231 Apr 2019 4421986382065 993732214 232 Jun 2019 4847677297950 1022913321 233 Aug 2019 5585922333160 1075272215 234 Oct 2019 5985250251028 1097629174 235 Dec 2019 6277551200690 1127023870 236 Feb 2020 6968991265752 1206720688 237 Apr 2020 7788133221338 1267547429 238 Jun 2020 8114046262158 1302852615 239 Aug 2020 8841649410652 1408122887 240 Oct 2020 9215815569509 1432874252 241 Dec 2020 11830842428018 1517995689 242 Feb 2021 12270717209612 1563938043 243 Apr 2021 12732048052023 1590670459 244 Jun 2021 13442974346437 1632796606 245 Aug 2021 13888187863722 1653427055 246 Oct 2021 14599101574547 1721064101 247 Dec 2021 14922033922302 1734664952 248 Feb 2022 15428122140820 1750505007 249 Apr 2022 16071520702170 1781374217 250 Jun 2022 16710373006600 1796349114 251 Aug 2022 17511809676629 2024099677 252 Oct 2022 18231960808828 2167900306 253 Dec 2022 19086596616569 2241439349 254 Feb 2023 20116642176263 2337838461 255 Apr 2023 20926504760221 2440470464 256 Jun 2023 21791125594114 2611654455 257 Aug 2023 22294446104543 2631493489 258 Oct 2023 23600199887231 2775205599 259 Dec 2023 24651580464335 2863228552 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 27225116587937 3333621823 261 Jun 2024 27900199328333 3380877515 262 Aug 2024 29643594176326 3569715357 263 Oct 2024 31362454467668 3745772758 264 Dec 2024 32983029087303 3957195833 The following table provides the number of bases and the number of sequence records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing projects processed at GenBank, beginning with Release 190.0 in June of 2012. TSA sequences processed prior to Release 190.0 in June of 2012 were handled individually, and are present in the gbtsa*.seq files of GenBank releases (hence, they contribute to the statistics in the first table of this section). Subsequent to that date NCBI began processing TSA submissions using an approach that is analogous to the bulk-oriented approach used for WGS, assigning a TSA project code (for example: GAAA) to each TSA submission. Note 1 : Although we provide statistics for bulk-oriented TSA submissions as of the dates for GenBank releases, TSA files are not distributed or updated in conjunction with those releases. Rather, per-project TSA data files are continuously available in the TSA areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa ftp://ftp.ncbi.nih.gov/genbank/tsa Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TSA submissions as separate records, without a common TSA project code. In which case, they will not be included in this table. Note 3 : Statistics for bulk-oriented TSA projects originating at the European Nucleotide Archive of the INSDC were not included in this table until the October 2016 GenBank Release. Note 4 : This table is incomplete. Statistics for Releases 190.0 to 200.0 will be back-filled if time allows. Release Date Base Pairs Entries 201 Apr 2014 23632325832 29734989 202 Jun 2014 31707343431 38011942 203 Aug 2014 33676182560 40556905 204 Oct 2014 36279458440 43567759 205 Dec 2014 46056420903 62635617 206 Feb 2015 49765340047 66706014 207 Apr 2015 55796332435 71989588 208 Jun 2015 60697472570 76974601 209 Aug 2015 69360654413 87827013 210 Oct 2015 70917172944 81790031 211 Dec 2015 77583339176 87488539 212 Feb 2016 81932555094 92132318 213 Apr 2016 87811163676 98147566 214 Jun 2016 94413958919 104677061 215 Aug 2016 103399742586 113179607 216 Oct 2016 113209225762 124199597 217 Dec 2016 125328824508 142094337 218 Feb 2017 133517212104 151431485 219 Apr 2017 149038907599 165068542 220 Jun 2017 158112969073 176812130 221 Aug 2017 167045663417 186777106 222 Oct 2017 172909268535 192754804 223 Dec 2017 181394660188 201559502 224 Feb 2018 193940551226 214324264 225 Apr 2018 205232396043 227364990 226 Jun 2018 216556686631 238788334 227 Aug 2018 225520004678 249295386 228 Oct 2018 235875573598 259927414 229 Dec 2018 248592892188 274845473 230 Feb 2019 263936885705 294772430 231 Apr 2019 277118019688 311247136 232 Jun 2019 285390240861 319927264 233 Aug 2019 294727165179 331347807 234 Oct 2019 305371891408 342811151 235 Dec 2019 325433016129 367193844 236 Feb 2020 340994289065 386644871 237 Apr 2020 349692751528 396392280 238 Jun 2020 359947709062 409725050 239 Aug 2020 366968951160 417524567 240 Oct 2020 382996662270 435968379 241 Dec 2020 392206975386 446397378 242 Feb 2021 407605409948 463151000 243 Apr 2021 425076483459 481154920 244 Jun 2021 436594941165 494641358 245 Aug 2021 440578422611 498305045 246 Oct 2021 449891016597 508319391 247 Dec 2021 455870853358 514158576 248 Feb 2022 465013156502 524464601 249 Apr 2022 474421076448 534770586 250 Jun 2022 485056129761 546991572 251 Aug 2022 497501380386 560196830 252 Oct 2022 511476787957 574020080 253 Dec 2022 611850391049 649918843 254 Feb 2023 630615054587 672261981 255 Apr 2023 636291358227 678332682 256 Jun 2023 643127590034 683922756 257 Aug 2023 646176166908 686271945 258 Oct 2023 659924904311 701336089 259 Dec 2023 668807109326 715803123 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 689648317082 741066498 261 Jun 2024 695405769319 746753803 262 Aug 2024 706085554263 755907377 263 Oct 2024 812661461811 948733596 264 Dec 2024 820128973511 957403887 The following table provides the number of bases and the number of sequence records for Targeted Locus Study (TLS) sequencing projects of special marker genes processed at GenBank, beginning with Release 217.0 in December of 2016. Note 1 : Although we provide statistics for bulk-oriented TLS submissions as of the dates for GenBank releases, TLS files are not distributed or updated in conjunction with those releases. Rather, per-project TLS data files are continuously available in the TLS areas of the NCBI FTP site: ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls ftp://ftp.ncbi.nih.gov/genbank/tls Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TLS submissions as separate records, without a common TLS project code. In which case, they will not be included in this table. Note 3 : This table is incomplete. Statistics for releases prior to 217.0 will be back-filled if time allows. Release Date Base Pairs Entries 217 Dec 2016 584697919 1268690 218 Feb 2017 636923295 1438349 219 Apr 2017 636923295 1438349 (unchanged) 220 Jun 2017 824191338 1628475 221 Aug 2017 824191338 1628475 (unchanged) 222 Oct 2017 2993818315 9479460 223 Dec 2017 4458042616 12695198 224 Feb 2018 4531966831 12819978 225 Apr 2018 5612769448 14782654 226 Jun 2018 5896511468 15393041 227 Aug 2018 6077824493 15822538 228 Oct 2018 8435112913 20752288 229 Dec 2018 8511829281 20924588 230 Feb 2019 9146836085 23259929 231 Apr 2019 9623321565 24240761 232 Jun 2019 10182427815 25530139 233 Aug 2019 10531800829 26363945 234 Oct 2019 10848455369 27460978 235 Dec 2019 11280596614 28227180 236 Feb 2020 13669678196 34037371 237 Apr 2020 24615270313 65521132 238 Jun 2020 27500635128 75063181 239 Aug 2020 27825059498 75682157 240 Oct 2020 28814798868 78177358 241 Dec 2020 33036509446 88039152 242 Feb 2021 33634122995 90130561 243 Apr 2021 37998534461 102395753 244 Jun 2021 38198113354 102662929 245 Aug 2021 39930167315 106995218 246 Oct 2021 40168874815 107569935 247 Dec 2021 41143480750 109379021 248 Feb 2022 41321107981 109809966 249 Apr 2022 41324192343 109820387 250 Jun 2022 41999358847 111142107 251 Aug 2022 43852280645 115103527 252 Oct 2022 43860512749 115123306 253 Dec 2022 44009657455 115552377 254 Feb 2023 46465508548 121067644 255 Apr 2023 46567924833 121186672 256 Jun 2023 47302831210 122798571 257 Aug 2023 48289699026 124421006 258 Oct 2023 50868407906 130654568 259 Dec 2023 51568356978 132355132 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 53492243256 135115766 261 Jun 2024 54512778803 135446337 262 Aug 2024 77026446552 187321998 Data spike caused by restoration of stats for the KEQH TLS project : 48-mln records 263 Oct 2024 77037504468 187349395 264 Dec 2024 77038271475 187349466 3. FILE FORMATS The flat file examples included in this section, while not always from the current release, are usually fairly recent. Any differences compared to the actual records are the result of updates to the entries involved. 3.1 File Header Information With the exception of the lists of new, changed, and deleted accession numbers, each of the files of a GenBank release begins with the same header, except for the first line, which contains the file name, and the sixth line, which contains the title of the file. The first line of the file contains the file name in character positions 1 to 9 and the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting in column 22. The brief names of the files in this release are listed in Section 2.2. The second line contains the date of the current release in the form `month day year', beginning in position 27. The fourth line contains the current GenBank release number. The release number appears in positions 48 to 52 and consists of three numbers separated by a decimal point. The number to the left of the decimal is the major release number. The digit to the right of the decimal indicates the version of the major release; it is zero for the first version. The sixth line contains a title for the file. The eighth line lists the number of entries (loci), number of bases (or base pairs), and number of reports of sequences (equal to number of entries in this case). These numbers are right-justified at fixed positions. The number of entries appears in positions 1 to 8, the number of bases in positions 16 to 26, and the number of reports in positions 40 to 47. The third, fifth, seventh, and ninth lines are blank. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBBCT1.SEQ Genetic Sequence Data Bank December 15 2024 NCBI-GenBank Flat File Release 264.0 Bacterial Sequences (Part 1) 179284 loci, 605564943 bases, from 179284 reported sequences ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 1. Sample File Header 3.4 Sequence Entry Files GenBank releases contain one or more sequence entry data files, one for each "division" of GenBank. 3.4.1 File Organization Each of these files has the same format and consists of two parts: header information (described in section 3.1) and sequence entries for that division (described in the following sections). 3.4.2 Entry Organization In the second portion of a sequence entry file (containing the sequence entries for that division), each record (line) consists of two parts. The first part is found in positions 1 to 10 and may contain: 1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is a keyword). 2. A subkeyword beginning in column 3, with columns 1 and 2 blank (e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a subkeyword of REFERENCE). 3. Blank characters, indicating that this record is a continuation of the information under the keyword or subkeyword above it. 4. A code, beginning in column 6, indicating the nature of an entry (feature key) in the FEATURES table; these codes are described in Section 3.4.12.1 below. 5. A number, ending in column 9 of the record. This number occurs in the portion of the entry describing the actual nucleotide sequence and designates the numbering of sequence positions. 6. Two slashes (//) in positions 1 and 2, marking the end of an entry. The second part of each sequence entry record contains the information appropriate to its keyword, in positions 13 to 80 for keywords and positions 11 to 80 for the sequence. The following is a brief description of each entry field. Detailed information about each field may be found in Sections 3.4.4 to 3.4.15. LOCUS - A short mnemonic name for the entry, chosen to suggest the sequence's definition. Mandatory keyword/exactly one record. DEFINITION - A concise description of the sequence. Mandatory keyword/one or more records. ACCESSION - The primary accession number is a unique, unchanging identifier assigned to each GenBank sequence record. (Please use this identifier when citing information from GenBank.) Mandatory keyword/one or more records. VERSION - A compound identifier consisting of the primary accession number and a numeric version number associated with the current version of the sequence data in the record. This is optionally followed by an integer identifier (a "GI") assigned to the sequence by NCBI. Mandatory keyword/exactly one record. NOTE : Presentation of GI sequence identifiers in the GenBank flatfile format was discontinued as of March 2017. NID - An alternative method of presenting the NCBI GI identifier (described above). NOTE: The NID linetype is obsolete and was removed from the GenBank flatfile format in December 1999. PROJECT - The identifier of a project (such as a Genome Sequencing Project) to which a GenBank sequence record belongs. Optional keyword/one or more records. NOTE: The PROJECT linetype is obsolete and was removed from the GenBank flatfile format after Release 171.0 in April 2009. DBLINK - Provides cross-references to resources that support the existence a sequence record, such as the Project Database and the NCBI Trace Assembly Archive. Optional keyword/one or more records. KEYWORDS - Short phrases describing gene products and other information about an entry. Mandatory keyword in all annotated entries/one or more records. SEGMENT - Information on the order in which this entry appears in a series of discontinuous sequences from the same molecule. Optional keyword (only in segmented entries)/exactly one record. NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. SOURCE - Common name of the organism or the name most frequently used in the literature. Mandatory keyword in all annotated entries/one or more records/includes one subkeyword. ORGANISM - Formal scientific name of the organism (first line) and taxonomic classification levels (second and subsequent lines). Mandatory subkeyword in all annotated entries/two or more records. In the event that the organism name exceeds 68 characters (80 - 13 + 1) in length, it will be line-wrapped and continue on a second line, prior to the taxonomic classification. Unfortunately, very long organism names were not anticipated when the fixed-length GenBank flatfile format was defined in the 1980s. The possibility of linewraps makes the job of flatfile parsers more difficult : essentially, one cannot be sure that the second line is truly a classification/lineage unless it consists of multiple tokens, delimited by semi-colons. The long-term solution to this problem is to introduce an additional subkeyword, possibly 'LINEAGE'. But because changes like this can be very disruptive for customers, implementation has not yet been scheduled. REFERENCE - Citations for all articles containing data reported in this entry. Includes seven subkeywords and may repeat. Mandatory keyword/one or more records. AUTHORS - Lists the authors of the citation. Optional subkeyword/one or more records. CONSRTM - Lists the collective names of consortiums associated with the citation (eg, International Human Genome Sequencing Consortium), rather than individual author names. Optional subkeyword/one or more records. TITLE - Full title of citation. Optional subkeyword (present in all but unpublished citations)/one or more records. JOURNAL - Lists the journal name, volume, year, and page numbers of the citation. Mandatory subkeyword/one or more records. MEDLINE - Provides the Medline unique identifier for a citation. Optional subkeyword/one record. NOTE: The MEDLINE linetype is obsolete and was removed from the GenBank flatfile format in April 2005. PUBMED - Provides the PubMed unique identifier for a citation. Optional subkeyword/one record. REMARK - Specifies the relevance of a citation to an entry. Optional subkeyword/one or more records. COMMENT - Cross-references to other sequence entries, comparisons to other collections, notes of changes in LOCUS names, and other remarks. Optional keyword/one or more records/may include blank records. FEATURES - Table containing information on portions of the sequence that code for proteins and RNA molecules and information on experimentally determined sites of biological significance. Optional keyword/one or more records. BASE COUNT - Summary of the number of occurrences of each basepair code (a, c, t, g, and other) in the sequence. Optional keyword/exactly one record. NOTE: The BASE COUNT linetype is obsolete and was removed from the GenBank flatfile format in October 2003. CONTIG - This linetype provides information about how individual sequence records can be combined to form larger-scale biological objects, such as chromosomes or complete genomes. Rather than presenting actual sequence data, a special join() statement on the CONTIG line provides the accession numbers and basepair ranges of the underlying records which comprise the object. As of August 2005, the 2L chromosome arm of Drosophila melanogaster (accession number AE014134) provided a good example of CONTIG use. ORIGIN - Specification of how the first base of the reported sequence is operationally located within the genome. Where possible, this includes its location within a larger genetic map. Mandatory keyword/exactly one record. - The ORIGIN line is followed by sequence data (multiple records). // - Entry termination symbol. Mandatory at the end of an entry/exactly one record. 3.4.3 Sample Sequence Data File An example of a complete sequence entry file follows. (This example has only two entries.) Note that in this example, as throughout the data bank, numbers in square brackets indicate items in the REFERENCE list. For example, in ACARR58S, [1] refers to the paper by Mackay, et al. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBSMP.SEQ Genetic Sequence Data Bank December 15 1992 GenBank Flat File Release 74.0 Structural RNA Sequences 2 loci, 236 bases, from 2 reported sequences LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986 DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA. ACCESSION K03160 VERSION K03160.1 KEYWORDS 5S ribosomal RNA; ribosomal RNA. SOURCE A.auricula-judae (mushroom) ribosomal RNA. ORGANISM Auricularia auricula-judae Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes; Heterobasidiomycetidae; Auriculariales; Auriculariaceae. REFERENCE 1 (bases 1 to 118) AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R. TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and their use in studying the phylogenetic position of basidiomycetes among the eukaryotes JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 34 c 34 g 23 t ORIGIN 5' end of mature rRNA. 1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga 61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt // LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990 DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence. ACCESSION M34766 VERSION M34766.1 KEYWORDS 5S ribosomal RNA. SOURCE Acetobacter sp. (strain MB 58) rRNA. ORGANISM Acetobacter sp. Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. REFERENCE 1 (bases 1 to 118) AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I., Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M. TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA sequencing JOURNAL J. Gen. Microbiol. 136, 441-446 (1990) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 40 c 32 g 17 t 2 others ORIGIN 1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat 61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 9. Sample Sequence Data File 3.4.4 LOCUS Format 3.4.4.1 : Important notice about parsing the LOCUS line Users who process the data elements of the LOCUS line should use a token-based parsing approach rather than parsing its content based on fixed column positions. Historically, the LOCUS line has had a fixed length and its elements have been presented at specific column positions. A complete description of the data fields and their typical column positions is provided in Section 3.4.4.2 . But with the anticipated increases in the lengths of accession numbers, and the advent of sequences that are gigabases long, maintaining the column positions will not always be possible and the overall length of the LOCUS line could exceed 79 characters. Consider this LOCUS line for a typical complete bacterial genome: LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Now contrast this with a hypothetical gigabase-scale WGS sequence record that utilizes the 6 + 2 + 7/8/9 accession format: LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Here, Locus-Name/Accession-Number must occupy the space at position 29 which normally separates the Locus from the Sequence Length. And if the sequence length had been 10 Gigabases or greater, the Locus-Name and Sequence Length would directly abut each other: LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 In cases like this, a space would be introduced to ensure that the two fields are separated, all other values would be shifted to the right, and the length of the LOCUS line would increase: LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Because the Locus-Name/Accession-Number is left-justified and the Sequence-Length is right-justified, *most* GenBank records will conform to the historical column positions that are described below. But since there will be exceptions, we recommend that users parse the LOCUS line based on whitespace-separated tokens. 3.4.4.2 : Data elements of the LOCUS line The data elements of the LOCUS line format and their typical/historical column positions are as follows: Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus Name (usually identical to the Accession Number) 29-29 space 30-40 Sequence Length, right-justified 41-41 space 42-43 'bp' 44-44 space 45-47 Strandedness : spaces (if not known), ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) 48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA) Left justified. 54-55 space 56-63 Molecule Topology : 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 Division Code 68-68 space 69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) These column positions are typical/nominal, not guaranteed. See Section 3.4.4.1 for important suggestions about parsing the LOCUS line. The Locus Name element was originally designed to help group entries with similar sequences: the first three characters designated the organism; the fourth and fifth characters could be used to show other group designations, such as gene product; for segmented entries (now obsolete) the last character could be one of a series of sequential integers. Here are two examples of older GenBank records that have Locus Names : LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S125 polymorphic dinucleotide repeat. ACCESSION L10620 LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S114 polymorphic dinucleotide repeat. ACCESSION L10624 But in the mid-1990s, maintaining unique Locus Names in addition to unique Accession Numbers became unsustainable and the assignment of new Locus Names ceased. The overwhelming majority of sequence records now have no Locus Name, and their Accession Number is displayed on the LOCUS line instead. For example: LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998 DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA, complete cds. ACCESSION AF035771 The Division Code element of the LOCUS format is a three-letter abbreviation whose value can be : PRI - primate sequences ROD - rodent sequences MAM - other mammalian sequences VRT - other vertebrate sequences INV - invertebrate sequences PLN - plant, fungal, and algal sequences BCT - bacterial sequences VRL - viral sequences PHG - bacteriophage sequences SYN - synthetic sequences UNA - unannotated sequences EST - EST sequences (Expressed Sequence Tags) PAT - patent sequences STS - STS sequences (Sequence Tagged Sites) GSS - GSS sequences (Genome Survey Sequences) HTG - HTGS sequences (High Throughput Genomic sequences) HTC - HTC sequences (High Throughput cDNA sequences) ENV - Environmental sampling sequences CON - Constructed sequences TSA - Transcriptome Shotgun Assembly sequences The Molecule Type for all non-coding RNA sequences is 'RNA'. Further information about the specific type of non-coding RNA can be obtained from the full-length ncRNA feature that will be present on such sequences. 3.4.5 DEFINITION Format The DEFINITION record gives a brief description of the sequence, proceeding from general to specific. It starts with the common name of the source organism, then gives the criteria by which this sequence is distinguished from the remainder of the source genome, such as the gene name and what it codes for, or the protein name and mRNA, or some description of the sequence's function (if the sequence is non-coding). If the sequence has a coding region, the description may be followed by a completeness qualifier, such as cds (complete coding sequence). There is no limit on the number of lines that may be part of the DEFINITION. The last line must end with a period. 3.4.5.1 DEFINITION Format for NLM Entries The DEFINITION line for entries derived from journal-scanning at the NLM is an automatically generated descriptive summary that accompanies each DNA and protein sequence. It contains information derived from fields in a database that summarize the most important attributes of the sequence. The DEFINITION lines are designed to supplement the accession number and the sequence itself as a means of uniquely and completely specifying DNA and protein sequences. The following are examples of NLM DEFINITION lines: NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt] 94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA Partial, 1 gene, 1873 nt] inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment 1 of 2] cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase [Acremonium chrysogenum, Genomic, 2 genes, 2639 nt] myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails, embryo, Peptide Partial, 246 aa] The first part of the definition line contains information describing the genes and proteins represented by the molecular sequences. This can be gene locus names, protein names and descriptions that replace or augment actual names. Gene and gene product are linked by "=". Any special identifying terms are presented within brackets, such as: {promoter}, {N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}. The second part of the definition line is delimited by square brackets, '[]', and provides details about the molecule type and length. The biological source, i.e., genus and species or common name as cited by the author. Developmental stage, tissue type and strain are included if available. The molecule types include: Genomic, mRNA, Peptide. and Other Genomic Material. Genomic molecules are assumed to be partial sequence unless "Complete" is specified, whereas mRNA and peptide molecules are assumed to be complete unless "Partial" is noted. 3.4.6 ACCESSION Format This field contains a series of six-character and/or eight-character identifiers called 'accession numbers'. The six-character accession number format consists of a single uppercase letter, followed by 5 digits. The eight-character accession number format consists of two uppercase letters, followed by 6 digits. The 'primary', or first, of the accession numbers occupies positions 13 to 18 (6-character format) or positions 13 to 20 (8-character format). Subsequent 'secondary' accession numbers (if present) are separated from the primary, and from each other, by a single space. In some cases, multiple lines of secondary accession numbers might be present, starting at position 13. The primary accession number of a GenBank entry provides a stable identifier for the biological object that the entry represents. Accessions do not change when the underlying sequence data or associated features change. Secondary accession numbers arise for a number of reasons. For example, a single accession number may initially be assigned to a sequence described in a publication. If it is later discovered that the sequence must be entered into the database as multiple entries, each entry would receive a new primary accession number, and the original accession number would appear as a secondary accession number on each of the new entries. In the event that a large number of continuous secondary accession numbers exist, a range can be employed: SecAccession1-SecAccession2 In such cases, the alphabetic prefix letters of the initial and terminal accession numbers within the range *MUST* be identical. For example: AE000111-AE000510O ^^ ^^ Additionally, the value of the numeric portion of the initial secondary within the range must be less than the value of the numeric portion of the terminal secondary. 3.4.7.1 VERSION Format This line contains a compound identifier consisting of the accession number plus the sequential version number of the associated sequence. LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999 DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds. ACCESSION AF181452 VERSION AF181452.1 ^^^^^^^^^^ Compound Accession.Version Number A compound Accession.Version consists of two parts: a stable, unchanging primary-accession number portion (see Section 3.4.6 for a description of accession numbers), and a sequentially increasing numeric version number. The accession and version numbers are separated by a period. The initial version number assigned to a new sequence is one. An accession number allows one to retrieve the same biological object in the database, regardless of any changes that are made to the entry over time. But those changes can include changes to the sequence data itself, which is of fundamental importance to many database users. So a numeric version number is associated with the sequence data in every database entry. If an entry (for example, AF181452) undergoes two sequence changes, its compound accession number on the VERSION line would start as AF181452.1 . After the first sequence change this would become: AF181452.2 . And after the second change: AF181452.3 . Numeric NCBI "GI" sequence identifiers also used to be included on the VERSION line, but that practice was discontinued in March of 2017. GenBank Releases contain only the most recent versions of all sequences in the database. However, older versions can be obtained via Accession.Version-based queries with NCBI's web-Entrez and network-Entrez applications. A sequence 'revision history' resource is also available, within Entrez:Nucleotide. For example: http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist NOTE: All the version numbers for the compound Accession.Version identifier system were initialized to a value of one (".1") in February 1999, when the system was first introduced. 3.4.7.2 DBLINK Format This line contains cross-references to other underlying resources that support the existence of a GenBank sequence record. For example: LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012 DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence. ACCESSION ANHA01000001 ANHA01000000 VERSION ANHA01000001.1 DBLINK BioProject: PRJNA177352 BioSample: SAMN01795900 A DBLINK cross-reference consists of two data fields delimited by a colon. The first field provides the cross-reference type ("BioProject"), while the second contains the actual cross-reference identifier ("PRJNA177352"). The second field can consist of multiple comma-separated identifiers, if a sequence record has multiple DBLINK cross-references of a given type. For example: DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999 And, as in this example, there can be multiple distinct types of DBLINK cross-references. Each new type will start on a new line, with the first colon-delimited token being the name of the cross-referenced resource. As of April 2013, the supported DBLINK cross-reference types are "Project" (predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive", "Sequence Read Archive", and "Assembly". DBLINK cross-references of type 'BioProject' are BioProject Accession Number identifiers within the Entrez:BioProject resource at the NCBI: http://www.ncbi.nlm.nih.gov/bioproject At the above URL, a search for PRJNA177352 would provide information about the Campylobacter coli sequencing project (underway or completed), the center(s) performing the sequencing and annotation, information about the organism, etc. For a more detailed overview of NCBI's BioProject resource: http://www.ncbi.nlm.nih.gov/books/NBK54016/ DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within the Assembly resource at NCBI: http://www.ncbi.nlm.nih.gov/assembly At the above URL, a search for GCA_000321225.1 would provide assembly details and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly submitted by the center(s) that performed the assembly. For a more detailed overview of NCBI's Assembly resource: http://www.ncbi.nlm.nih.gov/assembly/help/ 3.4.8 KEYWORDS Format The KEYWORDS field does not appear in unannotated entries, but is required in all annotated entries. Keywords are separated by semicolons; a "keyword" may be a single word or a phrase consisting of several words. Each line in the keywords field ends in a semicolon; the last line ends with a period. If no keywords are included in the entry, the KEYWORDS record contains only a period. 3.4.9 SEGMENT Format NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. The SEGMENT keyword is used when two (or more) entries of known relative orientation are separated by a short (<10 kb) stretch of DNA. It is limited to one line of the form `n of m', where `n' is the segment number of the current entry and `m' is the total number of segments. 3.4.10 SOURCE Format The SOURCE field consists of two parts. The first part is found after the SOURCE keyword and contains free-format information including an abbreviated form of the organism name followed by a molecule type; multiple lines are allowed, but the last line must end with a period. The second part consists of information found after the ORGANISM subkeyword. The formal scientific name for the source organism (genus and species, where appropriate) is found on the same line as ORGANISM. The records following the ORGANISM line list the taxonomic classification levels, separated by semicolons and ending with a period. 3.4.11 REFERENCE Format The REFERENCE field consists of five parts: the keyword REFERENCE, and the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional), PUBMED (optional), and REMARK (optional). The REFERENCE line contains the number of the particular reference and (in parentheses) the range of bases in the sequence entry reported in this citation. Additional prose notes may also be found within the parentheses. The numbering of the references does not reflect publication dates or priorities. The AUTHORS line lists the authors in the order in which they appear in the cited article. Last names are separated from initials by a comma (no space); there is no comma before the final `and'. The list of authors ends with a period. The TITLE line is an optional field, although it appears in the majority of entries. It does not appear in unpublished sequence data entries that have been deposited directly into the GenBank data bank, the European Nucleotide Archive, or the DNA Data Bank of Japan. The TITLE field does not end with a period. The JOURNAL line gives the appropriate literature citation for the sequence in the entry. The word `Unpublished' will appear after the JOURNAL subkeyword if the data did not appear in the scientific literature, but was directly deposited into the data bank. For published sequences the JOURNAL line gives the Thesis, Journal, or Book citation, including the year of publication, the specific citation, or In press. For Book citations, the JOURNAL line is specially-formatted, and includes: editor name(s) book title page number(s) publisher-name/publisher-location year For example: LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003 DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene, partial sequence. ACCESSION AY277550 .... REFERENCE 1 (bases 1 to 1440) AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C. TITLE Classifying bacterial isolates from hypogean environments: Application of a novel fluorimetric method dor the estimation of G+C mol% content in microorganisms by thermal denaturation temperature JOURNAL (in) Saiz-Jimenez,C. (Ed.); MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54; A.A. Balkema, The Netherlands (2003) The presence of "(in)" signals the fact that the reference is for a book rather than a journal article. A semi-colon signals the end of the editor names. The next semi-colon signals the end of the page numbers, and the colon that immediately *precedes* the page numbers signals the end of the book title. The publisher name and location are a free-form text string. Finally, the year appears at the very end of the JOURNAL line, enclosed in parentheses. The MEDLINE line provides the National Library of Medicine's Medline unique identifier for a citation (if known). Medline UIs are 8 digit numbers. The PUBMED line provides the PubMed unique identifier for a citation (if known). PUBMED ids are numeric, and are record identifiers for article abstracts in the PubMed database : http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed Citations in PubMed that do not fall within Medline's scope will have only a PUBMED identifier. Similarly, citations that *are* in Medline's scope but which have not yet been assigned Medline UIs will have only a PUBMED identifier. If a citation is present in both the PubMed and Medline databases, both a MEDLINE and a PUBMED line will be present. The REMARK line is a textual comment that specifies the relevance of the citation to the entry. 3.4.12 FEATURES Format GenBank releases use a feature table format designed jointly by GenBank, the European Nucleotide Archive, and the DNA Data Bank of Japan. This format is in use by all three databases. The most complete and accurate Feature Table documentation can be found on the Web at: http://www.insdc.org/documents/feature-table The feature table contains information about genes and gene products, as well as regions of biological significance reported in the sequence. The feature table contains information on regions of the sequence that code for proteins and RNA molecules. It also enumerates differences between different reports of the same sequence, and provides cross-references to other data collections, as described in more detail below. The first line of the feature table is a header that includes the keyword `FEATURES' and the column header `Location/Qualifiers.' Each feature consists of a descriptor line containing a feature key and a location (see sections below for details). If the location does not fit on this line, a continuation line may follow. If further information about the feature is required, one or more lines containing feature qualifiers may follow the descriptor line. The feature key begins in column 6 and may be no more than 15 characters in length. The location begins in column 22. Feature qualifiers begin on subsequent lines at column 22. Location, qualifier, and continuation lines may extend from column 22 to 80. Feature tables are required, due to the mandatory presence of the source feature. The sections below provide a brief introduction to the feature table format. 3.4.12.1 Feature Key Names The first column of the feature descriptor line contains the feature key. It starts at column 6 and can continue to column 20. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.2 3.4.12.2 Feature Location The second column of the feature descriptor line designates the location of the feature in the sequence. The location descriptor begins at position 22. Several conventions are used to indicate sequence location. Base numbers in location descriptors refer to numbering in the entry, which is not necessarily the same as the numbering scheme used in the published report. The first base in the presented sequence is numbered base 1. Sequences are presented in the 5' to 3' direction. Location descriptors can be one of the following: 1. A single base; 2. A contiguous span of bases; 3. A site between two bases; 4. A single base chosen from a range of bases; 5. A single base chosen from among two or more specified bases; 6. A joining of sequence spans; 7. A reference to an entry other than the one to which the feature belongs (i.e., a remote entry), followed by a location descriptor referring to the remote sequence; A site between two residues, such as an endonuclease cleavage site, is indicated by listing the two bases separated by a carat (e.g., 23^24). A single residue chosen from a range of residues is indicated by the number of the first and last bases in the range separated by a single period (e.g., 23.79). The symbols < and > indicate that the end point of the range is beyond the specified base number. A contiguous span of bases is indicated by the number of the first and last bases in the range separated by two periods (e.g., 23..79). The symbols < and > indicate that the end point of the range is beyond the specified base number. Starting and ending positions can be indicated by base number or by one of the operators described below. Operators are prefixes that specify what must be done to the indicated sequence to locate the feature. The following are the operators available, along with their most common format and a description. complement (location): The feature is complementary to the location indicated. Complementary strands are read 5' to 3'. join (location, location, .. location): The indicated elements should be placed end to end to form one contiguous sequence. order (location, location, .. location): The elements are found in the specified order in the 5 to 3 direction, but nothing is implied about the rationality of joining them. 3.4.12.3 Feature Qualifiers Qualifiers provide additional information about features. They take the form of a slash (/) followed by a qualifier name and, if applicable, an equal sign (=) and a qualifier value. Feature qualifiers begin at column 22. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.3 Qualifiers convey many types of information. Their values can, therefore, take several forms: 1. Free text; 2. Controlled vocabulary or enumerated values; 3. Citations or reference numbers; 4. Sequences; Text qualifier values must be enclosed in double quotation marks. The text can consist of any printable characters (ASCII values 32-126 decimal). If the text string includes double quotation marks, each set must be `escaped' by placing a double quotation mark in front of it (e.g., /note="This is an example of ""escaped"" quotation marks"). Some qualifiers require values selected from a limited set of choices. For example, as of June 2022 the `/exception' qualifier has only four allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement required for product', and 'annotated by transcript or proteomic data'. These are known as controlled vocabulary qualifier values. Controlled qualifier values are case sensitive. Citation or published reference numbers for the entry should be enclosed in square brackets ([]) to distinguish them from other numbers. A literal sequence of bases (e.g., "atgcatt") should be enclosed in quotation marks. Literal sequences are distinguished from free text by context. Qualifiers that take free text as their values do not take literal sequences, and vice versa. 3.4.12.4 Cross-Reference Information One type of information in the feature table lists cross-references to the annual compilation of transfer RNA sequences in Nucleic Acids Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl. Each tRNA entry of the feature table contains a /note= qualifier that includes a reference such as `(NAR: 1234)' to identify code 1234 in the NAR compilation. When such a cross-reference appears in an entry that contains a gene coding for a transfer RNA molecule, it refers to the code in the tRNA gene compilation. Similar cross-references in entries containing mature transfer RNA sequences refer to the companion compilation of tRNA sequences published by D.H. Gauss and M. Sprinzl in Nucleic Acids Research. 3.4.12.5 Feature Table Examples In the first example a number of key names, feature locations, and qualifiers are illustrated, taken from different sequences. The first table entry is a coding region consisting of a simple span of bases and including a /gene qualifier. In the second table entry, an NAR cross-reference is given (see the previous section for a discussion of these cross-references). The third and fourth table entries use the symbols `<`and `>' to indicate that the beginning or end of the feature is beyond the range of the presented sequence. In the fifth table entry, the symbol `^' indicates that the feature is between bases. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- CDS 5..1261 /product="alpha-1-antitrypsin precursor" /map="14q32.1" /gene="PI" tRNA 1..87 /note="Leu-tRNA-CAA (NAR: 1057)" /anticodon=(pos:35..37,aa:Leu) mRNA 1..>66 /note="alpha-1-acid glycoprotein mRNA" transposon <1..267 /note="insertion element IS5" misc_recomb 105^106 /note="B.subtilis DNA end/IS5 DNA start" conflict 258 /replace="t" /citation=[2] ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 10. Feature Table Entries The next example shows the representation for a CDS annotated on a scaffold/ CON-division entry built from contigs of the LQNL01 WGS project: 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017 DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold O_flexuosa-1.0_Cont1703, whole genome shotgun sequence. ACCESSION KZ271580 LQNL01000000 VERSION KZ271580.1 DBLINK BioProject: PRJNA230512 BioSample: SAMN04226856 KEYWORDS WGS; HIGH_QUALITY_DRAFT. ... mRNA complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /product="hypothetical protein" CDS complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /codon_start=1 /product="hypothetical protein" /protein_id="OZC04795.1" /db_xref="GI:1233056989" /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK IVEIPTEIPVEEVLEEKPIVTAKIITGLF" CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586, gap(100),LQNL01005324.1:1..24917) // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 11. Scaffold/CON-division join() sequence 3.4.13 ORIGIN Format The ORIGIN record may be left blank, may appear as `Unreported.' or may give a local pointer to the sequence start, usually involving an experimentally determined restriction cleavage site or the genetic locus (if available). The ORIGIN record ends in a period if it contains data, but does not include the period if the record is left empty (in contrast to the KEYWORDS field which contains a period rather than being left blank). 3.4.14 SEQUENCE Format The nucleotide sequence for an entry is found in the records following the ORIGIN record. The sequence is reported in the 5' to 3' direction. There are sixty bases per record, listed in groups of ten bases followed by a blank, starting at position 11 of each record. The number of the first nucleotide in the record is given in columns 4 to 9 (right justified) of the record. 3.4.15 CONTIG Format As an alternative to SEQUENCE, a CONTIG record can be present following the ORIGIN record. A join() statement utilizing a syntax similar to that of feature locations (see the Feature Table specification mentioned in Section 3.4.12) provides the accession numbers and basepair ranges of other GenBank sequences which contribute to a large-scale biological object, such as a chromosome or complete genome. Here is an example of the use of CONTIG : CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076, AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696, AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641, [ lines removed for brevity ] AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856) However, the CONTIG join() statement can also utilize a special operator which is *not* part of the syntax for feature locations: gap() : Gap of unknown length. gap(X) : Gap with an estimated integer length of X bases. To be represented as a run of n's of length X in the sequence that can be constructed from the CONTIG line join() statement . gap(unkX) : Gap of unknown length, which is to be represented as an integer number (X) of n's in the sequence that can be constructed from the CONTIG line join() statement. The value of this gap operator consists of the literal characters 'unk', followed by an integer. Here is an example of a CONTIG line join() that utilizes the gap() operator: CONTIG join(complement(AADE01002756.1:1..10234),gap(1206), AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633), AADE01005641.1:1..2377) The first and last elements of the join() statement may be a gap() operator. But if so, then those gaps should represent telomeres, centromeres, etc. Consecutive gap() operators are illegal. 4. ALTERNATE RELEASES NCBI is supplying sequence data in the GenBank flat file format to maintain compatibility with existing software which require that particular format. Although we have made every effort to ensure that these data are presented in the traditional flat file format, if you encounter any problems in using these data with software which is based upon the flat file format, please contact us at: info@ncbi.nlm.nih.gov The flat file is just one of many possible report formats that can be generated from the richer representation supported by the ASN.1 form of the data. Developers of new software tools should consider using the ASN.1 form directly to take advantage of those features. Documentation and a Software Developer's Toolkit for ASN.1 are available through NCBI. The Software Developer's Toolkit and PostScript documentation for Linux, MacOS and Microsoft Windows systems is available in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++ directory. The file is 'ncbi_cxx--18_0_0.tar.gz'. 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries and Index The /gene qualifier for many GenBank entries contains values other than the official gene symbol, such as the product or the standard name of the gene. 6. GENBANK ADMINISTRATION The National Center for Biotechnology Information (NCBI), National Library of Medicine, National Institutes of Health, is responsible for the production and distribution of the NIH GenBank Sequence Database. NCBI distributes GenBank sequence data by anonymous FTP, e-mail servers and other network services. For more information, you may contact NCBI at the e-mail address: info@ncbi.nlm.nih.gov . 6.1 Registered Trademark Notice GenBank (R) is a registered trademark of the U.S. Department of Health and Human Services for the Genetic Sequence Data Bank. 6.2 Citing GenBank If you have used GenBank in your research, we would appreciate it if you would include a reference to GenBank in all publications related to that research. When citing data in GenBank, it is appropriate to give the sequence name, primary accession number, and the publication in which the sequence first appeared. If the data are unpublished, we urge you to contact the group which submitted the data to GenBank to see if there is a recent publication or if they have determined any revisions or extensions of the data. It is also appropriate to list a reference for GenBank itself. The following publication, which describes the GenBank database, should be cited: Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L, Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research, Volume 52, Issue D1, January 2024, pp. D134-D137. PMID: 37889039 PMCID: PMC10767886 DOI: 10.1093/nar/gkad903 The following statement is an example of how one might cite GenBank data. It cites the sequence, its primary accession number, the group who determined the sequence, and GenBank. The numbers in parentheses refer to the GenBank citation above and to the REFERENCE in the GenBank sequence entry. `We scanned the GenBank (1) database for sequence similarities and found one sequence (2), GenBank accession number V00002, which showed significant similarity...' (1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024) (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982) 6.3 GenBank Distribution Formats and Media Complete flat file releases of the GenBank database are available via NCBI's anonymous ftp server: ftp://ftp.ncbi.nih.gov Each release is cumulative, incorporating all previous GenBank data. No retrieval software is provided. GenBank distribution via CD-ROM ceased as of GenBank Release 106.0 (April, 1998). 6.4 Other Methods of Accessing GenBank Data Entrez is a molecular biology database system that presents an integrated view of DNA and protein sequence data, 3D structure data, complete genomes, and associated PubMed articles. The system is produced by the National Center for Biotechnology Information (NCBI), and is available only via the Internet (using the Web-Entrez and Network-Entrez applications). Accessing Entrez is easy: Simply direct your web browser of choice to: http://www.ncbi.nlm.nih.gov/ The Web version of Entrez has all the capabilities of the network version, but with the visual style of the World Wide Web. If you prefer the "look and feel" of Network-Entrez, you may download Network-Entrez from the NCBI's FTP server: ftp://ftp.ncbi.nih.gov/ Versions are available for PC/Windows, Macintosh and several Unix variants. For information about Network-Entrez, Web-Entrez or any other NCBI services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov . 6.5 Request for Corrections and Comments We welcome your suggestions for improvements to GenBank. We are especially interested to learn of errors or inconsistencies in the data. BankIt or Genome Workbench can be used to submit revisions to previous submissions. In addition, suggestions and corrections can be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to indicate the primary accession number of the entry to which your comments apply; it is helpful if you also give the entry name and the current contents of any data field for which you are recommending a change. 6.6 Credits and Acknowledgments Credits - GenBank Submission Coordination Ilene Mizrachi GenBank Annotation Staff Michael Baxter, Shelby Bidwell, Larissa Brown, Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston, Erica Lam, Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley, Beverly Underwood, and Linda Yankie GenBank Release Coordination Mark Cavanaugh Data Management and Preparation Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi, Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov, Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov, Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov, Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko, Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou Database Administration Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov, Benjamin Slade, Constantin Vasilyev Customer Support David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers, Majda Valjavec-Gratian Project Direction/Leadership Steve Sherry : Acting Director, NLM Kim Pruitt : Acting Director, NCBI Valerie Schneider : Acting Branch Chief, NCBI/IEB Eugene Yaschenko : Chief Technology Officer, NCBI/IRB Acknowledgments - Contractor support for GenBank production and distribution has been provided by Management Systems Designers, Inc., ComputerCraft Corporation, and The KEVRIC Company, Inc. 6.7 Disclaimer The United States Government makes no representations or warranties regarding the content or accuracy of the information. The United States Government also makes no representations or warranties of merchantability or fitness for a particular purpose or that the use of the sequences will not infringe any patent, copyright, trademark, or other rights. The United States Government accepts no responsibility for any consequence of the receipt or use of the information. For additional information about GenBank releases, please contact NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at: GenBank National Library of Medicine Bldg. 38A Rm. 8N-809 8600 Rockville Pike Bethesda, MD 20894