Caracterimai
Caracterimai
ADVERTIMENT. La consulta d’aquesta tesi queda condicionada a l’acceptació de les següents condicions d'ús: La difusió
d’aquesta tesi per mitjà del servei TDX (www.tdx.cat) i a través del Dipòsit Digital de la UB (diposit.ub.edu) ha estat
autoritzada pels titulars dels drets de propietat intel·lectual únicament per a usos privats emmarcats en activitats
d’investigació i docència. No s’autoritza la seva reproducció amb finalitats de lucre ni la seva difusió i posada a disposició
des d’un lloc aliè al servei TDX ni al Dipòsit Digital de la UB. No s’autoritza la presentació del seu contingut en una finestra
o marc aliè a TDX o al Dipòsit Digital de la UB (framing). Aquesta reserva de drets afecta tant al resum de presentació de
la tesi com als seus continguts. En la utilització o cita de parts de la tesi és obligat indicar el nom de la persona autora.
ADVERTENCIA. La consulta de esta tesis queda condicionada a la aceptación de las siguientes condiciones de uso: La
difusión de esta tesis por medio del servicio TDR (www.tdx.cat) y a través del Repositorio Digital de la UB
(diposit.ub.edu) ha sido autorizada por los titulares de los derechos de propiedad intelectual únicamente para usos
privados enmarcados en actividades de investigación y docencia. No se autoriza su reproducción con finalidades de lucro
ni su difusión y puesta a disposición desde un sitio ajeno al servicio TDR o al Repositorio Digital de la UB. No se autoriza
la presentación de su contenido en una ventana o marco ajeno a TDR o al Repositorio Digital de la UB (framing). Esta
reserva de derechos afecta tanto al resumen de presentación de la tesis como a sus contenidos. En la utilización o cita de
partes de la tesis es obligado indicar el nombre de la persona autora.
WARNING. On having consulted this thesis you’re accepting the following use conditions: Spreading this thesis by the
TDX (www.tdx.cat) service and by the UB Digital Repository (diposit.ub.edu) has been authorized by the titular of the
intellectual property rights only for private uses placed in investigation and teaching activities. Reproduction with lucrative
aims is not authorized nor its spreading and availability from a site foreign to the TDX service or to the UB Digital
Repository. Introducing its content in a window or frame foreign to the TDX service or to the UB Digital Repository is not
authorized (framing). Those rights affect to the presentation summary of the thesis as well as to its contents. In the using or
citation of parts of the thesis it’s obliged to indicate the name of the author.
FACULTAD DE FARMACIA
FACULTAD DE FARMACIA
Memoria presentada por Isabel Cristina Vélez Bermúdez para optar al grado de Doctor por la
Universidad de Barcelona.
Dra. Montserrat Pagès Torrens Dr. Albert Ferrer Isabel Cristina Vélez Bermúdez
- Maya Angelou
Agradecimientos
Y como dijo Newton…“si he logrado ver más lejos, ha sido porque he subido a
hombros de gigantes”…y por eso quiero aprovechar este espacio para agradecer a todos
aquellos gigantes que me han acompañado durante el desarrollo de esta tesis doctoral.
A mi co-directora de tesis Marta Riera. Gracias Marta, por haberme iniciado en la vida
de laboratorio, por orientarme y por haberme permitido desarrollar mis ideas, además
por apoyarme, aconsejarme y entenderme durante todos estos años.
Quiero también dar las gracias a la Dra. Josefa Badía, por toda la ayuda que me ha
brindado, ya que con esto ha hecho de mi paso por la Universidad de Barcelona una
grata experiencia.
Gracias a mis compañeros de laboratorio. Agnese tan única, gracias por hacer que mis
últimos días en el lab fueran tan divertidos. A Elena tan tierna y dulce, gracias Elen por
todo el cariño y el apoyo que me has brindado. A Mic y Tommi, les doy gracias por
hacer mis tardes divertidas en el lab, por los consejos, por ayudarme y tolerarme con
paciencia durante todos estos años. Y a los que ya no están…Cris gracias por toda la
ayuda que me brindaste al comienzo de esta tesis y Sami gracias por compartir conmigo
tus conocimientos de proteómica, eres un hombre admirable, un luchador. A Eva, a
Vicky, Adela y Lola muchas gracias por su apoyo durante todos estos años, aprendí
mucho de cada una.
Quiero agradecer también al Doctor David Caparrós. Gracias David por el apoyo y los
consejos. También a Silvia, Joan y Pedro por el aporte que hicieron a este trabajo.
Muchas gracias a los Doctores Jesús Herney Moreno y Oscar Arango. Gracias Dr.
Moreno por todo el cariño, el soporte emocional y por compartir conmigo tu familia y
las cenas en Topanga en mis visitas a Colombia. Oscar, te debo mucho, gracias por el
apoyo institucional y emocional con el que me has respaldado durante todos estos años
porque con esto me has ayudado a llegar hasta este punto.
A mis hermanos, no de sangre pero de vida… Belmiro, Anahit, Beatriz, Imen y Ana
Isabel…tengo tanto que decirles a cada uno, son lo mejor de todo este final…un tesoro
invaluable para mí… Bel, no te diré que eres un gran científico, o que eres muy listo o
que tienes un corazón de oro porque todo eso ya lo sabes!...lo que si te diré es gracias
por enseñarme que compartir es importante, que tener gustos diferentes o particulares
no hace a las personas anormales sino únicas y especiales, que Pesoa no era un poeta,
sino un gran poeta, que en Portugal no solo nacen portugueses sino grandes amigos.
Anahit, my Lady…eres única en tu “especie”, mi amiga…mi hermana, te debo tanto
que no tengo palabras suficientes para expresar todo mi agradecimiento, que suerte
tengo por haberte conocido, gracias por estar siempre a mi lado en las buenas y en las
malas, te quiero muchísimo. Bea, mi chuli tierna y encantadora, eres para mí un ser muy
importante, muchas gracias por haber hecho de mi vida algo especial, por haberme
ayudado y enseñado tantas cosas…agradezco la oportunidad de ser tu amiga. Imen, mi
dulce e incondicional amiga, no sé por dónde empezar…gracias por existir!, eres una
excelente persona, mi ángel…gracias por enseñarme, ayudarme y orientarme en el
laboratorio, pero sobre todo gracias por ser mi amiga…mi hermana!, por compartir
conmigo a tu familia y toda tu vida. Anita, tú ya sabes que eres parte de mi vida, nos
conocemos hace tanto que da igual que estemos lejos físicamente, porque nunca lo
estaremos espiritualmente. Gracias por estar conmigo en los momentos más importantes
y por apoyarme y regañarme cuando lo he merecido.
A Inecita y María…mis amigas hermosas, qué haría yo sin ustedes chicas?, gracias por
escucharme, animarme, cuidar de mi en tiempos difíciles, espero conservarlas en mi
vida siempre porque las dos son muy valiosas para mí.
A mis papás…mami, gracias por enseñarme que emprender es más que una palabra, que
amor es igual a incondicional, que las mujeres duras existen, que tesón se escribe con
esfuerzo y sobre todo por demostrarme con tu ejemplo que cada día podemos ser
mejores. Papi, siempre dicen que el alumno supera al maestro, pero en mi caso no es
así, siempre serás mi maestro, agradezco a la vida cada día que me permite compartir
contigo, así sea desde la distancia. Gracias a los dos por confiar en mí, por apoyar mis
proyectos y mis locuras, por cuidar de mis perros, por estar siempre presentes durante
todas las etapas de mi vida, por inculcarme valores y por motivarme cada instante a ser
una mejor persona. Me siento muy orgullosa de ser su hija y nunca me cansaré de darles
las gracias a los dos por todo lo que hacen cada día por mí, solo me resta decirles que
los amo mucho.
…Y eran una… y eran una… y eran una sola sombra larga… y eran una sola sombra
larga… y eran una sola sombra larga…como decía nuestro poeta José Asunción
Silva…eso somos nosotros Jorge… eres mi complemento, parte de mi, hemos crecido
juntos y aprendido muchas cosas juntos, además no puedes negar que somos un gran
equipo!. Gracias por emprender conmigo este reto, por cuidarme, por amarme
incondicionalmente, por ser mi amigo leal, por sacar siempre lo mejor de mí, en pocas
palabras por hacer de mi mundo un lugar mejor.
En fin…a todos aquellos que han hecho de mi vida durante estos años en Barcelona un
lugar de aprendizaje…de cosas buenas y malas, que han enriquecido mi vida personal y
laboral…MUCHAS GRACIAS!!
Tabla de contenido
1. Introducción.................................................................................................................26
1.1 Percepción y señalización por jasmonato ............................................................. 30
1.2 La familia TIFY en plantas ................................................................................... 32
1.3 Regulación de factores de transcripción mediante fosforilación .......................... 43
1.4 Regulación transcripcional.................................................................................... 47
2. Objetivos .....................................................................................................................50
Capítulo I .........................................................................................................................52
3. Caracterización molecular de la proteína ZmZIM91 de maíz .....................................52
3.1 Resultados ............................................................................................................. 52
3.1.1 Obtención del cDNA completo de ZmZIM91 ................................................ 52
3.1.2 Localización subcelular de ZmZIM91 ........................................................... 52
3.1.3 ZmZIM91 pertenece a la subfamilia ZML de maíz ....................................... 54
3.1.4 Dominios proteicos de ZmZIM91 .................................................................. 56
3.1.5 ZmZIM91 se degrada en presencia de metil jasmonato por la vía del
proteasoma 26S ....................................................................................................... 64
3.1.6. Identificación del consenso in vitro de unión a ADN para las proteínas
ZmZIM91 de maíz y AtZIM de Arabidopsis mediante la técnica protein-binding
microarray (PBM11)............................................................................................... 68
3.1.7 Regulación de ZmZIM91 por la proteína quinasa CK2 de maíz ................... 70
3.1.7.1 Interacción de ZmZIM91 con las subunidades reguladoras CK2β1,
CK2β2, CK2β3 y la catalítica CK2α1 ................................................................. 70
3.1.7.2 CK2β1 y CK2β2 son capaces de relocalizar a ZmZIM91 en gránulos en el
núcleo .................................................................................................................. 71
3.1.7.3 La subunidad catalítica CK2α1 no puede relocalizar a la proteína
ZmZIM91 ............................................................................................................ 75
3.1.7.4 El holoenzima CK2α1β1 afecta la localización subcelular de la proteína
ZmZIM91 ............................................................................................................ 75
3.1.7.5 ZmZIM91 es sustrato in vitro de la proteína quinasa CK2 de maíz ........ 78
3.1.7.6 La fosforilación in vivo de ZmZIM91 por la proteína quinasa CK2 de
maíz es afectada mediante tratamientos con MeJA ............................................. 79
3.2 Discusión de resultados ........................................................................................ 82
3.2.1 El dominio ZIM/TIFY en ZmZIM91 ............................................................. 82
3.2.2 La proteína ZmZIM91 se degrada en presencia de MeJA ............................. 83
3.2.3 La variación de la secuencia en el N-teminal del dominio Jas de ZmZIM91
interviene en la interacción con COI1 ..................................................................... 84
3.2.4 Señales de Localización Nuclear (NLS) y de Exportación Nuclear (NES) de la
proteína ZmZIM91 .................................................................................................. 85
3.2.5 La proteína ZmZIM91 puede unir ADN ........................................................ 86
3.2.6 Modelos hipotéticos de regulación por MeJA de ZmZIM91 ......................... 87
3.2.7 La proteína ZmZIM91 interacciona y es fosforilada por la proteína quinasa
CK2 ......................................................................................................................... 88
3.2.8 La fosforilación de ZmZIM91 por la proteína quinasa CK2 es regulada por
estrés biótico y abiótico ........................................................................................... 89
Capítulo II........................................................................................................................92
4. Caracterización funcional de la proteína ZmZIM91 de maíz......................................92
4.1 Resultados ............................................................................................................. 92
4.1.1 ChIP-Seq de ZmZIM91 a partir de protoplastos de maíz transfectados ........ 92
4.1.1.1 Elaboración de ChIP utilizando protoplastos de maíz que sobre-
expresaban 35S::ZmZIM91:GFP y 35S::GFP ..................................................... 92
4.1.1.2 Construcción de librerías a partir del ChIP de protoplastos de maíz
usando la tecnología de ILLUMINA-SOLEXA .................................................... 95
4.1.1.3 Mapeo de datos de lecturas cortas en el genoma de maíz e identificación
de picos. ............................................................................................................... 97
4.1.1.4 Información y localización de sitios de unión obtenidos a partir de los
análisis estadísticos del ChIP-Seq proveniente de protoplastos de maíz............. 98
4.1.1.5 Localización de los picos en el genoma de maíz ................................... 100
4.1.1.6 Clasificación y anotación de genes diana seleccionados ....................... 101
4.1.1.7 Validación de genes diana de ZmZIM91 identificados en el ChIP-Seq
proveniente de protoplastos de maíz ................................................................. 104
4.1.1.8 Construcción de nuevas librerías de ChIP de ZmZIM91 a partir de
protoplastos de maíz .......................................................................................... 113
4.1.2 Identificación de genes diana de ZmZIM91 en el genoma de maíz usando
ChIP-Seq de ZmZIM91 proveniente de hojas de plantas de maíz de 9 días ......... 115
4.1.2.1 Preparación y control de calidad de librerías de ChIP de ZmZIM91 a
partir de hojas de plantas maíz .......................................................................... 115
4.1.2.2 Análisis de datos de ChIP-Seq de ZmZIM91 proveniente de hojas de
plantas de maíz de 9 días ................................................................................... 116
4.1.2.3 Identificación de genes diana in vivo de ZmZIM91 .............................. 117
4.1.2.4 ZmZIM91 interactúa con el promotor del gen ZmCOMT in vivo ......... 119
4.1.2.5 ZmZIM91 reprime al promotor del gen de maíz ZmCOMT in vivo ...... 120
4.1.2.6 ZmZIM91 se une al promotor del gen ZmA1 in vivo ........................... 121
4.1.2.7 ZmZIM91 reprime al promotor del gen de maíz ZmA1 in vivo ............ 122
4.1.2.8 La interacción in vivo entre ZmZIM91 y los promotores de ZmCOMT y
de ZmA1 se reduce en presencia de MeJA ........................................................ 123
4.1.3 Identificación de otras proteínas que interactúan con ZmZIM91 ................ 124
4.2 Discusión de resultados ...................................................................................... 127
4.2.1 Identificación de genes diana de ZmZIM91 mediante la técnica de ChIP-Seq de
protoplastos de maíz ................................................................................................. 127
4.2.2 Identificación de genes diana de ZmZIM91 mediante la técnica de ChIP-Seq de
hojas de maíz ............................................................................................................ 128
4.2.3 Diferencias entre las técnicas de ChIP-Seq empleadas ................................ 135
4.2.4 Hipótesis de la existencia de un módulo regulatorio entre ZmZIM91,
ZmMYB31 y ZmMYB42...................................................................................... 137
5. Conclusiones .............................................................................................................142
6. Materiales y métodos................................................................................................144
6.1 Cepas de bacterias y levaduras ........................................................................... 144
6.1.1 Cepas bacterianas ......................................................................................... 144
6.1.2 Saccharomyces cerevisiae ............................................................................ 144
6.2 Plásmidos y construcciones ................................................................................ 145
6.2.1 Plásmidos ..................................................................................................... 145
6.2.2 Construcciones ............................................................................................. 147
6.2.3 Cebadores. .................................................................................................... 151
6.3 Métodos .............................................................................................................. 154
6.3.1 Técnicas empleadas para el clonaje de ADN. .............................................. 154
6.3.2 Preparación de células competentes ............................................................. 154
6.3.2.1 Obtención de células competentes por choque térmico de Escherichia coli
........................................................................................................................... 154
6.3.2.2 Obtención de células competentes por choque térmico de Agrobacterium
tumefaciens ........................................................................................................ 154
6.3.2.3 Transformación de células competentes de Escherichia Coli por choque
térmico ............................................................................................................... 155
6.3.2.4 Transformación de células competentes de Agrobacterium tumefaciens
por choque térmico ............................................................................................ 155
6.3.3 Obtención de ADN plasmídico .................................................................... 156
6.3.4 Reacción en cadena de la polimerasa (PCR)................................................ 156
6.3.5 Digestión enzimática del ADN plasmídico .................................................. 158
6.3.6 Electroforesis de fragmentos de ADN y ARN en gel de agarosa ................ 158
6.3.7 Extracción y purificación de fragmentos de ADN, reacción de ligación y
recombinaciones .................................................................................................... 159
6.3.8 Cuantificación de ácidos nucleícos .............................................................. 159
6.3.9 Extracción y purificación de ARN de maíz ................................................. 159
6.3.10 Elaboración de cDNA ................................................................................ 160
6.3.11 Transformación transiente en protoplastos de maíz ................................... 160
6.3.12 Transformación transitoria por biolística en epidermis de cebolla ............ 162
6.3.13 Transformación transitoria de hojas de tabaco mediante infiltración de
Agrobacterium ....................................................................................................... 163
6.3.14 Obtención de proteínas recombinantes ...................................................... 163
6.3.14.1 Sobreexpresión de proteínas recombinantes fusionadas a His o GST en
E.Coli BL21 ....................................................................................................... 163
6.3.14.1.1 Extracción y purificación de proteínas recombinantes fusionadas a
His o GST y sobreexpresadas en E.Coli BL21 .............................................. 164
6.3.14.1.2 Obtención de proteínas recombinantes fusionadas a His ............. 164
6.3.14.1.3 Obtención de proteínas recombinantes fusionadas a GST............ 165
6.3.15 Obtención de anticuerpos policlonales contra la proteína ZmZIM91 ........ 166
6.3.16 Purificación de anticuerpos policlonales contra la proteína ZmZIM91 .... 166
6.3.17 Análisis de proteínas mediante western blot .............................................. 167
6.3.17.1 Obtención de extractos proteicos vegetales ......................................... 168
6.3.17.2 Cuantificación de proteínas ................................................................. 168
6.3.17.3 Electroforesis de proteínas en gel SDS-PAGE y tinción de comassie 168
6.3.17.4 Visualización de las proteínas por tinción de coomassie .................... 169
6.3.17.5 Transferencia de proteínas y tinción de ponceau ................................ 169
6.3.17.6 Hibridación e inmunodetección mediante ECL................................... 170
6.3.18 Ensayos de fosforilación ............................................................................ 170
6.3.18.1 Ensayo quinasa in vitro ....................................................................... 171
6.3.18.2 Ensayo quinasa en gel ......................................................................... 171
6.3.18.2.1 Preparación del gel SDS-PAGE copolimerizado con ZmZIM91 . 172
6.3.18.2.2 Renaturalización y reacción de fosforilación................................ 173
6.3.18.2.3 Tratamiento de geles quinasa en gel con DRB ............................. 173
6.3.19 Ensayos de interacción proteína-proteína .................................................. 174
6.3.19.1 Sistema de doble híbrido ..................................................................... 174
6.3.19.2 Complementación Bimolecular ........................................................... 174
6.3.19.3 Ensayo de interacción ‘TnT pull-down’............................................... 174
6.3.20 Determinación de motivos de unión a ADN mediante la técnica unión de
proteínas a un microarray de ADN (PBM11) ....................................................... 176
6.3.21 Experimentos de Inmunoprecipitación de la cromatina (ChIP) ................. 177
6.3.21.1 Inmunoprecipitación de la cromatina (ChIP) a partir de protoplastos
transfectados con 35S::ZmZIM91:GFP y 35S::GFP. Versión 1.0 ................... 177
6.3.21.2 Inmunoprecipitación de la cromatina (ChIP) a partir de protoplastos
transfectados con 35S::ZmZIM91:GFP y 35::GFP. Versión 2.0 ..................... 179
6.3.21.3 Inmunoprecipitación de la cromatina (ChIP) a partir de hojas de plantas
de maíz de 9 días de la variedad B73 ................................................................ 182
6.3.22 Test de enriquecimiento y análisis por PCR semi-cuantitativa y cuantitativa
de ChIP .................................................................................................................. 184
6.3.23 Preparación de ChIP-Seq para la plataforma Solexa-Illumina ................... 186
6.3.24 Ensayo de Luciferasa usando protoplastos de maíz transformados
transientemente...................................................................................................... 191
6.3.25 Captura de imágenes fluorescente mediante Microscopia Confocal ......... 191
6.3.26 Procesamiento y análisis de datos .............................................................. 192
6.3.26.1 Análisis de secuencias de nucleótidos ................................................. 192
6.3.26.2 Árbol filogenético ................................................................................ 192
6.3.26.3 Cuantificación de GFP de las imágenes obtenidas mediante microscopia
confocal ............................................................................................................. 193
6.3.26.4 Procesamiento y análisis de datos de ChIP-Seq .................................. 193
6.3.26.5 Procesamiento de datos de PCR cuantitativa de ChIP de protoplastos de
maíz ................................................................................................................... 194
6.3.26.6 Procesamiento de datos de PCR cuantitativa de ChIP de hojas de plantas
de maíz de 9 días (Fluidigm) ............................................................................. 194
6.3.26.7 Procesamiento de datos de PCR cuantitativa de ChIP de hojas de plantas
de maíz de 9 días tratadas con MeJA ................................................................ 194
6.3.26.8 Procesamiento de datos de Luciferasa ................................................. 195
6.3.26.9 Identificación de cajas GATA y GATC en promotores ...................... 195
6.3.26.10 Procesamiento y análisis de datos de regiones enriquecidas en
elementos reguladores en cis CRERs ................................................................ 196
7. Bibliografía ................................................................................................................198
Anexo I. ChIP-Seq de ZmZIM91 proveniente de protoplastos de maíz
Anexo II. ChIP-Seq de ZmZIM91 proveniente de hojas de plantas de maíz
Anexo III. Publicaciones
Lista de Tablas
Tabla 6-3. Cebadores de ADN usados para realizar los clones en este estudio.
Tabla 6-4. Cebadores utilizados para la validación por PCR semi-cuantitativa de los
picos identificados en el ChIP-Seq proveniente de protoplastos de maíz.
Tabla 6-5. Cebadores utilizados para la validación por PCR cuantitativa de los picos
identificados en el ChIP-Seq proveniente de protoplastos de maíz.
Tabla 6-6. Cebadores utilizados para la validación por PCR cuantitativa de los picos
identificados en el ChIP-Seq proveniente de hojas de plantas de maíz.
Tabla SI1. Picos seleccionados para validación del ChIP-Seq de ZmZIM91 proveniente
de protoplastos de maíz.
Lista de Figuras
Figura 1-4. Modelo de la degradación mediada por JA-Ile vía proteasoma 26S.
Figura 1-5B. Modelos de actuación del jasmonato en la regulación de los genes MYC.
Figura 3-4. Expresión de las proteínas ZML de maíz en hojas de 9 días de la variedad
B73.
Figura 3-6. Alineamiento entre las proteínas ZIM de Arabidopsis y ZML de maíz.
Figura 3-9. Alineamiento entre los dominios Jas de las proteínas AtJAI3, AtJAZ1,
AtZML2 y ZmZIM91.
Figura 3-10. Estudio de las interacciones entre las proteínas ZML, JAZ1, JAI3, JAZ9 y
COI1 de Arabidopsis.
Figura 3-15. Datos de RNA-Seq encontrados para ZmZIM91 y usados para la selección
del tejido para el análisis de la proteína por western blot.
Figura 3-24. ZmZIM91 es sustrato in vivo de la proteína quinasa CK2 y es regulada por
esta quinasa bajo tratamiento con MeJA.
Figura 3-26. Diagrama de caja de puntajes (E-scores) de todos los 8-mers posibles
conteniendo los consensos de 6-mer indicados y reconocidos por AtZIM y ZmZIM91.
Figura 3-27. ZmZIM91 es sustrato in vivo de la proteína quinasa CK2 y es regulada por
esta quinasa en sequía.
Figura 4-1. Validación mediante PCR semi-cuantitativa de las condiciones óptimas para
la preparación de ChIP de protoplastos de maíz que sobre-expresaban 35S::GFP.
Figura 4-5. Análisis de los datos de las librerías de protoplastos de maíz usando
BOWTIE y MACS.
Figura 4-9. Ejemplo de diseño de cebadores para PCR semi-cuantitativa de picos que
interceptaban entre las librerías de ZmZIM91_antiGFP y las de ZmZIM91_anti91.
Figura 4-10. Genes seleccionados para la validación por PCR cuantitativa de ChIP de
protoplastos de maíz de ZmZIM91.
Figura 4-15. Validación del pico 8 utilizando PCR semi-cuantitativa y PCR cuantitativa
de muestras de ChIP de protoplastos de maíz.
Figura 4-18. Localización en los picos 8, 14 y 21, de los motivos de unión a ADN
GATA y GATC identificados in vitro para el factor de transcripción ZmZIM91.
Figura 4-21. Pico detectado en las tres réplicas biológicas de ChIP-Seq de ZmZIM91
que flanquea el promotor del gen ZmCOMT.
Figura 4-22. Validación por PCR cuantitativa en tiempo real del promotor de ZmCOMT
en muestras de ChIP de ZmZIM91 a partir de hojas de plantas de maíz.
Figura 4-24. Validación por PCR cuantitativa en tiempo real del promotor de ZmA1 en
muestras de ChIP de ZmZIM91 a partir de hojas de plantas de maíz.
Figura 4-28. El módulo regulador putativo AC-GATA en el promotor del gen de COMT
está conservado en las gramíneas.
Figura 4-30. La represión del promotor de ZmCOMT por ZmZIM91 puede tener un
impacto significativo en la reducción del contenido de lignina en maíz.
Figura 4-31. Modelo propuesto de regulación del promotor de ZmCOMT por el factor
de transcripción ZmZIM91 de maíz.
Figura 6-1. Puesta a punto de condiciones óptimas de PCR para la obtención del clon de
ZmZIM91.
Figura 6-2. Pasos realizados para la detección de motivos de unión de ADN de factores
de transcripción mediante la técnica Unión de proteínas a un microarreglo de ADN
(PBM11).
aa: Aminoácido
ABA: Ácido abscísico
ADN: Ácido desoxiribonucleico
APS: Amonio persulfato
ATP: Adenosina-5’-trifosfato
BiFC: Complementación bimolecular de la fluorescencia
BSA: Albúmina sérica bovina
°C: Grados centígrados
CaMV 35S: Promotor 35S del virus del mosaico de la coliflor
cDNA: DNA complementario
CK2: Proteína quinasa CKII
ChIP: Inmunoprecipitación de cromatina
ChIP-Seq: Inmunoprecipitación de cromatina seguida de secuenciación
masiva paralela
CRERs Regiones enriquecidas en elementos reguladores cis
DMSO: Dimetilsulfóxido
DRB: 5,6-dicloro-1-β-D-ribofuranosil-1H-benzimidazol
DTT: Ditiotreitol
E.coli: Escherichia coli
EDTA: Ácido etilendiamino tetraacético
EGTA: Ácido etilenglicol tetraacético
FTs: Factores de Transcripción
g: Gramo
GFP: Proteína verde fluorescente
GST: Glutation-S-transferasa
HEPES: Ácido 4(2-hidroxietil)-1-piperazinaetanosulfónico
IPTG: Isopropil-β-D-1-tiogalactopiranósido
JA: Ácido jasmónico
kDA: Kilodalton
l: Litro
LUC: Luciferasa
MeJA: Metil jasmonato
MES: Ácido 2-(N-morfolino)etanosulfónico
mg: Miligramo
ml: Mililitro
MS medium: Murashige and Skoog medium
N. benthamiana: Nicotiana benthamiana
ng: Nanogramo
NGS: Nuevas tecnologías de secuenciación
NLS Señal de localización nuclear
PAGE: Gel de electroforesis de poliacrilamida
pb: Pares de bases
PBM11: Unión de proteínas a un microarreglo de ADN
PCR: Reacción en cadena de la polimerasa
PEG: Polyethylene glycol
Pfu: Unidades formadoras de placas
PMSF: Fenilmetanosulfonil fluoruro
Q-PCR: PCR cuantitativa en tiempo real
ARN: Ácido ribonucleico
SDS: Dodecilsulfato sódico
TCA: Ácido tricloroacético
TEMED: Tetrametiletilenediamina
TSS: Sitio de inicio de la transcripción
µg: Microgramo
µl: Microlitro
YFP: Proteína amarilla fluorescente
γ33P-ATP: Gama-Fosforo-33 Adenosina-5’-Trifosfato
Introducción
Introducción
Introducción
En la planta, las hormonas forman parte de una compleja red de regulación. Las
interacciones entre las distintas hormonas pueden ser moduladas por una multitud de
estímulos originados como parte del desarrollo o de señales medioambientales que
conducen a que éstas actúen de un modo aditivo o antagónico (Lackman et al., 2011).
La integración de los estímulos y señales define la amplitud y especificidad de
respuestas en diferentes contextos celulares (Kuppusamy et al., 2009; Pauwels et al.,
2009). La señalización de las diferentes rutas metabólicas por hormonas controla la
interacción de estrés biótico y abiótico (Figura 1-1). Las respuestas a estrés abiótico
están controladas en mayor parte por la fitohormona ácido abscísico (ABA), mientras
que la defensa frente a diferentes estreses bióticos es regulada por el antagonismo entre
las rutas de señalización del ácido salicílico (SA) y ácido jasmónico (JA)/Etileno
(Atkinson y Urwin, 2012).
Por otro lado, los eventos de reconocimiento molecular que causan la inmunidad de la
planta a insectos herbívoros han sido poco estudiados. Sin embargo, las plantas parecen
usar múltiples sistemas de vigilancia para reconocer insectos con un amplio rango de
estilos de vida y comportamiento alimenticio. Por tanto, el conocimiento detallado
acerca de la inmunidad de las plantas en respuesta a patógenos puede proveer nuevos
enfoques para el mejoramiento y la protección de cultivos (Howe y Jander, 2008).
26
Introducción
27
Introducción
En plantas superiores, los JAs son fitohormonas derivadas de oxipilinas que son
sintetizados vía la ruta de los octadecanoides (Figura 1-2) (Howe y Jander, 2008).
Originalmente los JAs fueron identificados como metabolitos secundarios presentes en
el perfume de las flores de jazmín (Jasminum spp.). Actualmente, se ha descubierto que
actúan como elicitores de la producción de metabolitos secundarios a través del reino
vegetal, desde las angiospermas hasta las gimnospermas (Wasternack, 2007; Zhao et al.,
2005). Las tres principales clases de metabolitos secundarios pueden ser definidos como
los terpenoides, los alcaloides y los fenilpropanoides; sin embargo, existen más. Los
JAs pueden inducir la síntesis de todas estas clases de metabolitos secundarios (Pauwels
et al., 2009; Zhao et al., 2005).
28
Introducción
29
Introducción
Las mutaciones en SGT1b y AXR1 tienen efectos pleiotrópicos que deterioran las
respuestas de la planta no sólo a JA sino también a auxinas y patógenos, sugiriendo que
las proteína AXR1 y SGT1b son reguladoras del complejo SCF y están involucradas en
diferentes vías de señalización (Austin et al., 2002; Azevedo et al., 2002; Gray et al.,
2003). La proteína AXR1 es también un regulador positivo de respuestas a auxinas y
modula la actividad de SCFTIR1 por modificación de la culina a través de la adición de la
proteína ubiquitin-like Nedd8/Rub1 (del Pozo et al., 2002; Schwechheimer et al., 2002).
30
Introducción
Por otra parte, la función conservada de SGT1 como mediadora del complejo SCF, está
respaldada por un estudio donde se mostró que la mutación del gen sgt1 de levadura
podía ser complementada con dos genes altamente homólogos al gen SGT1 de
Arabidopsis y por una investigación donde se demostró que las proteínas SGT1,
HvSGT1 y NbSGT1 co-inmunoprecipitaban con las subunidades SCF en extractos de
cebada (Hordeum vulgare) y tabaco (Nicotiana benthamiana) respectivamente
(Azevedo et al., 2002; Liu et al., 2002).
La proteína JAI3 pertenece a la familia génica llamada TIFY (Vanholme et al., 2007).
Dentro de esta familia, los miembros que son inducidos a nivel de expresión génica por
JA son llamados dominio jasmonato ZIM (Jasmonate ZIM domain - JAZ) (Chini et al.,
2007; Thines et al., 2007). En el mutante jai3 la proteína JAI3 tenía una delección de un
dominio conservado en el C-terminal de las proteínas JAZ. La proteína JAI3 endógena
se degradó rápidamente en respuesta a JA de manera dependiente de COI1, mientras la
proteína del mutante jai3 permaneció estable. La proteína JAI3 interactúa in vitro y en
levadura con COI1 pero solo en presencia de la hormona conjugada JA-Ile. Además,
también interacciona con AtMYC2 y se postula que JAI3 es un represor de AtMYC2, y
que por lo tanto cuando es degradada en respuesta a JA, deja libre a AtMYC2 para
cumplir sus funciones (Chini et al., 2007).
31
Introducción
32
Introducción
33
Introducción
TIFY 3 2 1 1 3 2 3 2 1 0 0 1
PPD 0 4 2 2 2 2 2 0 0 0 0 0
JAZ 9 8 9 12 12 7 20 14 15 15 16 23
ZML 4 4 1 3 8 4 9 5 4 6 3 3
Tabla 1-1. Lista del número de genes de la familia TIFY. a Fuentes de datos del
genoma: Physcomitrella patens (Pp), Selaginella moellendorffii (Sm), Mimulus guttatus
(Mg), Populus trichocarpa (Pt), Brachypodium distachyon (Bd), Sorghum bicolor (Sb)
desde DOE Joint Genome Institute (LGI, http://genome.jgi-psf.org); Arabidopsis
thaliana (At) desde TAIR (http://www.Arabidopsis.org); Oryza sativa (Os) desde TIGR
(http://rice.plantbiology.msu.edu); Medicago trunculata (Mt) desde
(http://www.medicago.org); Vitis vinifera (Vv) desde Genoscope (http://www.cns.fr);
Glycine max (Gm) desde Phytozome (http://www.phytozome.net); Zea Mays (Zm)
desde (http://www.maizesequence.org). b La anotación del genoma de Medicago
trunculata está incompleta (Bai et al., 2011).
Figura 1-3. Arquitectura de las proteínas que conforman la familia TIFY. En los
esquemas se observa los dominios conservados que conforman cada subfamilia. En rojo
se enmarca el dominio TIFY, en lila el dominio PPD, en amarillo el dominio Jas, en
verde el dominio CCT y en azul el dominio GATA-Zinc Finger, además (A)
corresponde a la estructura de las proteínas de la subfamilia TIFY, (B) a la subfamilia
PPD, (C) a la subfamilia ZML y (D) a la subfamilia JAZ.
34
Introducción
Existe muy poca información acerca de los miembros de la subfamilia TIFY que
poseen un dominio TIFY.
Las proteínas JAZ fueron identificadas como represoras de la vía de señalización del
ácido jasmónico, dependientes de la degradación por JA mediante la vía del proteasoma
26S (Chini et al., 2007; Yan et al., 2007). Las proteínas JAZ son consideradas dianas
del complejo SCFCOI1. Estas proteínas y COI1 interactúan directamente en presencia del
conjugado bioactivo JA-isoleucina (JA–Ile) para formar un complejo correceptor. En
35
Introducción
El dominio Jas está presente en todas las proteínas JAZ, pero JAZ7 (At2g34600) y
JAZ8 (At1g30135) no poseen los aminoácidos conservados en la posición 205 y 206
como JAZ1, los cuales se demostró que son esenciales para la interacción con COI1. La
secuencia de aminoácidos mínimos suficientes para la unión de la fitotoxina coronatina
(COR) fue localizada en una parte del N-terminal del dominio Jas extendido con dos
aminoácidos no conservados, creando una estructura bipartita consistente de un bucle y
una α-hélice anfifática. El bucle formado por la secuencia ELPIARR en JAZ1, permite
que JAZ se una a JA-Ile y COI1. Mientras el α-hélice une a COI1 cerca del sitio de
unión de JA-Ile, y su interacción es necesaria para la función co-receptora (Sheard et
al., 2010). La hormona probablemente es percibida por un complejo co-receptor que
está conformado por una proteína JAZ y COI1 (Figura 1-4).
Las proteínas F-box pueden formar substratos adaptadores junto con las proteínas Skp1
que son reclutados por culina para completar el complejo SCF E3 ubiquitina ligasa
únicamente cuando se unen a su diana. Es ampliamente aceptado que la unión con
SCFCOI1 está seguido por la poliubiquitinación de JAZ y la degradación por proteasoma
(Pauwels y Goossens, 2011).
36
Introducción
Figura 1-4. Modelo de la degradación mediada por JA-Ile vía proteasoma 26S. En
ausencia de JA-Ile, JAZ está unido a MYC2 y reprime la expresión del gen. En
presencia de JA-Ile, mientras MYC2 queda libre para realizar su función, COI1-SKP
puede formar un substrato adaptador que con JA-Ile e InsP5 como un cofactor, une el
dominio Jas de las proteínas JAZ. Posteriormente cuando se forma el complejo ligasa
SCFCOI1 E3, JAZ es presumiblemente poliubiquitinado, marcado para su degradación
por el proteasoma 26S (Adaptado de Pauwels y Goossens, 2011).
37
Introducción
Muchas proteínas JAZ interactúan directamente con proteínas MYB R2R3 como PAP1
PRODUCCIÓN DE PIGMENTO ANTOCIANINA1 (AT1G56650) y GL1
(AT3G27920), los cuales tienen papeles específicos en la síntesis de antocianinas y la
iniciación de tricomas (Pauwels y Goossens, 2011).
Las proteínas JAZ contienen un motivo conservado TIFY dentro del dominio TIFY
(Vanholme et al., 2007) que media interacciones homo y heterodiméricas entre
diferentes proteínas JAZ y otros factores de transcripción (Melotto et al., 2008; Chung y
Howe, 2009; Chini et al., 2009). El dominio TIFY también tiene como función reclutar
co-represores transcripcionales, tales como TOPLESS (TPL), a través de la proteína
Nuevo Interactor de JAZ (NINJA) mediante el motivo EAR , todo esto ha permitido
realizar un modelo más complejo y con más componentes de la percepción de JA y la
vía de señalización del mismo. NINJA, el cual es un regulador negativo de la síntesis de
JA, ha sido propuesto como un adaptador que media la unión entre las proteínas JAZ y
el complejo represor TPL (Pauwels et al., 2010). (Figura 1-5B).
38
Introducción
39
Introducción
Por último, la subfamilia ZML está formada por tres miembros en Arabidopsis (ZIM,
ZML1, y ZML2) que presentan los dominios TIFY, Jas, CCT y GATA-Zinc Finger. El
primer estudio funcional llevado a cabo para un miembro de esta subfamilia fue
realizado para el gen de Arabidopsis thaliana, AT4G24470, el cual estaba altamente
40
Introducción
Por otra parte, cuando se llevaron a cabo experimentos de microarrays usando los
mutantes de ZIM-ox, fueron identificados genes que estaban sobre-expresados como
por ejemplo XTH33 que se postula que tiene funciones en la modificación de la pared
41
Introducción
42
Introducción
Figura 1-6. Distribución del núcleo del motivo “TIFYXG”. El motivo “TIFYXG” es
un núcleo dominante del motivo en el dominio TIFY de la familia de factores de
transcripción TIFY, excepto en la subfamilia ZML en la cual “TLS[F/Y]XG” es más
prevalente (Adaptado de Bai et al., 2011).
43
Introducción
percepción de luz (Chen et al., 2004), requerimientos del desarrollo (Dievart y Clark,
2003), metabolismo del carbón (Rolland y Sheen, 2005) y ciclo celular (Koroleva et al.,
2004).
44
Introducción
45
Introducción
Muchas proteínas relacionadas con la respuesta a estrés son substratos de CK2. Las
proteínas abundantes en embriogénesis tardía (LEA)/Rab/dehidrinas están entre las más
comunes de plantas, además están involucradas en la adaptación a agua o estrés
osmótico. La proteína de maíz Rab17 es inducida por ácido abscísico (ABA) y
fuertemente fosforilada por CK2 (Plana et al., 1991). También fue demostrado que a
través de la interacción y la fosforilación, la CK2 modula funciones del desarrollo de
Rab17 en la germinación de semillas en respuesta a estrés osmótico (Riera et al., 2004).
46
Introducción
CK2β1
β β
Proteína
parcial de
ZmZIM91
47
Introducción
48
Objetivos
Objetivos
2. Objetivos
50
Capítulo I
Capítulo I
Capítulo I
3.1 Resultados
52
Capítulo I
1 M
M SS HH HH DD GG SS KK PP YY QQ PP RR RR GG PP EE RR HH PP
1 ATGTCCCACCACGACGGAAGCAAGCCATACCAGCCGCGCCGGGGGCCCGAGCGGCACCCG
21 Q
Q PP AA DD GG II AA AA SS PP PP AA AA VV AA PP SS VV EE HH
61 CAGCCAGCGGATGGGATCGCCGCCTCGCCTCCCGCCGCCGTTGCCCCGTCGGTGGAGCAC
41 L
L VV AA AA AA AA EE AA EE AA LL NN RR FF AA AA EE QQ QQ QQ
121 CTCGTGGCGGCCGCCGCCGAGGCGGAGGCATTGAACCGCTTCGCCGCGGAACAACAGCAG
61 Q
Q LL QQ GG HH EE QQ EE VV GG EE EE EE EE EE EE DD EE QQ EE
181 CAGCTGCAGGGGCACGAGCAGGAGGTTGGGGAGGAAGAGGAGGAGGAGGACGAGCAGGAA
81 DD E
E MM EE EE EE DD EE DD EE HH EE GG QQ HH GG GG II GG GG
241 GACGAGATGGAGGAGGAGGACGAGGATGAGCACGAAGGTCAGCACGGCGGCATCGGTGGG
101 E
E HH VV PP MM DD AA DD AA AA AA AA AA AA AA AA AA VV SS QQ
301 GAGCACGTTCCCATGGACGCGGATGCTGCTGCCGCGGCGGCGGCGGCCGCAGTCTCGCAG
121 M
M DD PP HH SS AA LL VV AA GG TT VV TT PP MM AA TT NN QQ LL
361 ATGGACCCGCACTCGGCGTTGGTGGCTGGGACTGTGACACCCATGGCGACCAACCAGCTC
141 TT L
L SS FF QQ GG EE VV YY VV PF DD SS VV SS PP DD KK VV QQ
421 ACCCTCTCATTCCAGGGCGAGGTCTATGTGTTCGACTCCGTCTCCCCTGATAAGGTCCAA
161 A
A VV LL LL LL LL GG GG RR EE LL SS SS LL GG GG AA SS SS SS
481 GCCGTGCTTTTGCTGCTTGGAGGGAGGGAGCTGAGCAGCCTGGGCGGAGCGTCGTCCTCT
181 A
A PP YY SS KK RR LL NN YY PP HH RR VV AA SS LL MM RR FF RR
541 GCACCTTATAGTAAGAGGTTGAATTATCCACATCGGGTGGCATCTCTGATGAGATTTAGG
201 E K
E K RR KK EE RR NN FF DD KK KK II RR YY SS VV RR KK EE VV
601 GAAAAGCGGAAGGAGCGGAACTTTGATAAGAAGATCCGATACTCTGTCCGGAAGGAAGTT
221 A
A LL RR MM QQ RR NN RR GG QQ FF TT SS SS KK PP KK PP DD EE
661 GCACTTAGGATGCAGCGTAATCGAGGTCAGTTTACATCTTCAAAACCAAAGCCTGATGAA
241 I A
I A AA SS EE MM AA SS AA DD GG SS PP NN WW AA LL VV EE GG
721 ATAGCGGCTTCAGAAATGGCATCCGCAGATGGCTCCCCGAATTGGGCATTAGTTGAAGGC
261 R
R PP PP SS AA AA EE CC HH HH CC GG TT NN AA TT AA TT PP MM
781 CGACCTCCATCTGCTGCCGAATGTCATCACTGTGGTACTAATGCAACAGCTACACCAATG
281 M
M RR RR GG PP DD GG PP RR TT LL CC NN AA CC GG LL MM WW AA
841 ATGCGTCGCGGACCTGATGGACCAAGAACATTATGCAATGCATGTGGCCTCATGTGGGCA
301 N
N KK GG LL LL RR DD VV TT KK SS PP VV PP LL QQ AA TT QQ SS
901 AATAAGGGTCTCCTGAGGGACGTAACAAAATCTCCTGTACCTCTCCAAGCTACGCAATCA
321 A
A PP HH LL DD GG GG NN GG SS AA MM SS AA PP GG SS EE LL EE
961 GCTCCGCATCTAGATGGTGGTAATGGAAGCGCCATGTCTGCGCCTGGCTCTGAGCTAGAG
341 N
N AA AA AA AA MM TT NN GG HH EE SS SS SS SS GG VV VV
1021 AATGCTGCAGCAGCCATGACCAATGGCCACGAGTCATCGAGTAGTGGTGTTTAA
53
Capítulo I
35S::ZmZIM91:GFP
35S::GFP
54
Capítulo I
55
Capítulo I
Por otra parte, de acuerdo a datos de RNA-Seq del trabajo de Li et al., 2010, se observa
que los 3 miembros de la familia ZML en maíz tienen una mayor expresión en la base
de la segunda hoja de maíz de 9 días (Figura 3-4).
ZmZML1 GRMZM2G065896
ZmZIM91 GRMZM2G058479
ZmZML3 GRMZM2G080509
Con respecto a las otras subfamilias pertenecientes a la familia TIFY, tanto ZmZIM91
como las demás proteínas ZML, contienen además del dominio TIFY y el Jas, un
dominio CCT y un putativo dominio de unión a ADN tipo GATA-Zinc Finger (Figura
3-5). El dominio CCT fue descubierto por primera vez en el factor de transcripción
TOC1 y las proteínas CONSTANS (CO), las cuales son conocidas por estar
involucradas en la señalización fotoperiódica de plantas, además el dominio CCT fue
implicado en la mediación de interacciones proteína-proteína (Robson et al., 2001).
GATA / ZINC
N TIFY JAS CCT
FINGER C
QLTLSFQGEVYVFDSVSPDKVQAVLLLLG SAAECHHCGTNATATPMMRRGPDGPRTLCNACGLMWANKGLLRDVTK
PHRVASLMRFREKRKERFNDKKIRYSVRKEVALRMQRNRGQFTSSKP
56
Capítulo I
Mientras el dominio TIFY en los JAZ contiene un TIFYAG conservado, en los ZML se
encuentra es el motivo TLSFQ, que además varia en dos aminoácidos en el caso de
AtZIM en Arabidopsis y ZmZML1 en maíz. Se ha demostrado que el dominio TIFY en
los JAZ de Arabidopsis es el responsable además de la dimerización de estas proteínas,
de la represión y de la interacción con NINJA, sin embargo no se ha descrito función
alguna de este dominio para los ZML en ninguna especie. Realizando un análisis de la
secuencia aminoacídica que conforma dicho dominio en ZmZIM91, se encontraron dos
putativos consensos de represión el LXLXFXGXV (LTLSFQGEV; aminoácidos 140-
148) y el XLLLXX (VLLLLG; aminoácidos 162-167) (Figura 3-7). Un motivo similar
a XLLLXX fue identificado únicamente en una proteína MYB-R3 (AtMYBL2) en el
carboxilo terminal, la cual está involucrada en la regulación negativa de la biosíntesis de
antocianinas en Arabidopsis, se trata del motivo TLLLFR (Matsui et al., 2008; Kagale y
Rozwadowski, 2010). Por otra parte, un nuevo motivo activo de represión R/KLFGV
que es similar al LXLXFXGXV fue identificado en al menos 29 factores de
transcripción de Arabidopsis miembros de las familias ABI3/VP1, ARF, HSF y MYB
(Ikeda y Ohme-Takagi, 2009).
57
Capítulo I
AtZML1 -------------------MDDLHGRNGRMHIGVAQNPMHVQYEDHGLHHIDNEN-----
AtZML2 -------------------MDDLHGSNARMHIREAQDPMHVQFEHHALHHIHNGS-----
AtZIM -------------------MFGRHSIIPNNQIGTASASAGEDHVSASATSGHIPY-----
ZmZIM91 --MSHHDGSKPYQPRRGPERHPQPADGIAAPPPAAVAPSVEHLVAAAAEAEALNRFAAEQ
ZmZML3 MSHSHHDGSKPYQPRRGPERPPQPADGIAVPPPAAVAPSVEHLVAAAAEAEALSRLGAEQ
ZmZML1 ---------------------------MAAEPAAADHDLRPPLADGAAAAGVG-------
* .
AtZML1 ---------------------------SMMDDHADGG----MDEGVETDIPSHPGNSADN
AtZML2 ---------------------------GMVDDQADDGNAGGMSEGVETDIPSHPGNVTDN
AtZIM ---------------------------DDMEEIPHPDSIYGAASDLIPDGSQLVAHRSDG
ZmZIM91 QQQLQGHEQEVGEEE-EEEDEQEDEMEEEDEDEHEGQHGGIGGEHVPMDADAAAAAAAAA
ZmZML3 QQLLQGHEQEVGEEEGEDEEEDEMEDDDDDDDEQEGQHGGIGVEHVPMDADAAAAAAVAA
ZmZML1 --------------------------------------------------AASLAAAAGA
.
AtZML1 RGEVVDR---------GIENGDQLTLSFQGQVYVFDRVSPEKVQAVLLLLGGREVPHTLP
AtZML2 RGEVVDR---------GSEQGDQLTLSFQGQVYVFDSVLPEKVQAVLLLLGGRELPQAAP
AtZIM SELLVSR---------PPEGANQLTISFRGQVYVFDAVGADKVDAVLSLLGGSTELAPGP
ZmZIM91 V-SQMDPHSALVAGTVPPMATNQLTLSFQGEVYVFDSVSPDKVQAVLLLLGGRELSS---
ZmZML3 AGAQMDPHSVLVPGTVPPMATNQLTLSFQGEVYVFDSVSPDKVQAVLLLLGGRELSS---
ZmZML1 AEALMS------------ATSEQLTLVYQGDVYVFDPVPPQKVQAVLLVLGGYEVPPGL-
:. :***: ::*:***** * .:**:*** :***
ZIM DOMAIN
AtZML1 TTLGSPHQNNRVLGLSGTPQRLSVPQR-LASLLRFREKRKGRNFDKTIRYTVRKEVALRM
AtZML2 PGLGSPHQNNRVSSLPGTPQRFSIPQR-LASLVRFREKRKGRNFDKKIRYTVRKEVALRM
AtZIM QVMELAQQQNHMP-VVEYQSRCSLPQR-AQSLDRFRKKRNARCFEKKVRYGVRQEVALRM
ZmZIM91 --------LGGASSSAPYSKRLNYPHR-VASLMRFREKRKERNFDKKIRYSVRKEVALRM
ZmZML3 --------LSGASSSAPYSKRLNFPHR-VASLMRFREKRKERNFDKKIRYNVRKEVALRM
ZmZML1 --------VNMAVSSANDEKNTTVAARRVASLMRFREKRKERCFDKRIRYSVRKEVAQKM
. .. . . * ** ***:**: * *:* :** **:*** :*
Jas DOMAIN/CCT DOMAIN
AtZML1 QRKKGQFTSAKSSNDDSGSTGSDWGSNQSWAVEGTETQKPEVLCRHCGTSEKSTPMMRRG
AtZML2 QRNKGQFTSAKSNNDEAASAGSSWGSNQTWAIESSEAQHQEISCRHCGIGEKSTPMMRRG
AtZIM ARNKGQFTSSKMTDG-AYNSGTDQDS-------AQDDAHPEISCTHCGISSKCTPMMRRG
ZmZIM91 QRNRGQFTSSKPKPDEIAASEMASADGSPNWALVEGRPPSAAECHHCGTNATATPMMRRG
ZmZML3 QRNRGQFTSSKPKPDEIAASEMAAADGSLNWALVEGRPPSAAECHHCGINATATPMMRRG
ZmZML1 KRRKGQFAG---RSDFGDGACSSAACGSP--ANGEDDHFRETHCQNCGISSRLTPAMRRG
*.:***:. . : * :** . ** ****
GATA DOMAIN
AtZML1 PDGPRTLCNACGLMWANKGTLRDLSKVPPP-----------QTPQHLSLNKNEDANLEAD
AtZML2 PAGPRTLCNACGLMWANKGAFRDLSKASP------------QTAQNLPLNKNEDANLETD
AtZIM PSGPRTLCNACGLFWANRGTLRDLSKKTEENQLALMKPDDGGSVADAANNLNTEAASVEE
ZmZIM91 PDGPRTLCNACGLMWANKGLLRDVTKSPVPLQATQS-----APHLDGGNGSAMSAPGSEL
ZmZML3 PDGPRTLCNACGLMWANKGLLRDLSKSPVPLHSIQQS----APILNGGNGSAMSALGSEL
ZmZML1 PAGPRSLCNACGLMWANKGTLRSPLNAPKMTQQLLAN----PCNMVDTDDKNSNVLPVEH
* ***:*******:***:* :*. : . . ..
AtZML1 QMMEVTGDISNTQ-------------------
AtZML2 HQIMITVANDISNSQ-----------------
AtZIM HTSMVSLANGDNSNLLGDH-------------
ZmZIM91 ENAAAAMTNGHESSSSGV--------------
ZmZML3 ENAAAAMGNGHEP-------------------
ZmZML1 NQATPKTDSMMPKEEQKLDIRLPTEEDTKAVS
Figura 3-6. Alineamiento entre las proteínas ZIM de Arabidopsis y ZML de maíz.
En color rojo se enmarcan los dominios conservados entre ambas especies. Los
aminoácidos correspondientes al dominio Jas, están inmersos dentro del dominio CCT,
y son señalados en blanco.
58
Capítulo I
A
YFPN ZmZIM91 + YFPC ZmZIM91
B
YFPN ZmZIM91 + YFPC VECTOR
-LT -LTHA
YFPN VECTOR + YFPC ZmZIM91
59
Capítulo I
Figura 3-9. Alineamiento entre los dominios Jas de las proteínas AtJAI3, AtJAZ1,
AtZML2 y ZmZIM91. La región α-hélice “α-helix region” presenta mayor grado de
conservación que la “loop region”. Esta región cumple un papel fundamental en la
interacción con el receptor E3 ubiquitina ligasa COI1, responsable de la degradación de
las proteínas JAZ en Arabidopsis vía el proteasoma 26S.
Con el fin de estudiar el papel de los ZML en la vía de señalización por ácido
jasmónico, se clonaron AtZIM, AtZML1 y AtZML2 en los vectores de expresión
pGBKT7 y pGADT7, que fueron utilizados para realizar experimentos de doble híbrido
en levadura, en los que se estudió la interacción de las proteínas de la subfamilia ZML
de Arabidopsis con JAI3, JAZ1, JAZ9 y COI1 de Arabidopsis (Figura 3-10). En estos
ensayos se pudo determinar que ZIM no interacciona con JAI3, JAZ1 y JAZ9, que
ZML1 podía interaccionar con JAI3, mientras ZML2 interaccionó con JAZ1, JAI3 y
JAI3fr5C que es una versión truncada de JAI3 que solo tiene el dominio Jas. Por otra
parte, ninguno de los miembros de la subfamilia ZML de Arabidopsis fue capaz de
interaccionar con AtCOI1, ni en presencia de altas concentraciones de CORONATINA.
60
Capítulo I
Figura 3-10. Estudio de las interacciones entre las proteínas ZML, JAZ1, JAI3,
JAZ9 y COI1 de Arabidopsis. En el panel superior se observa las interacciones entre
las proteínas ZML y JAZ1, JAZ9, JAI3 y las versiones truncadas de JAI3: JAI3fr4
(versión que contiene solo el dominio ZIM, en color azul) y JAI3fr5C (versión que
contiene solo el dominio Jas, en color rojo). En el panel inferior, es presentado el
resultado del experimento de doble híbrido, el cual muestra que los ZML de
Arabidopsis no pueden interaccionar con COI1 de Arabidopsis en presencia de 100 µM
de CORONATINA. (En colaboración con el Dr. Andrea Chini, investigador
postdoctoral en el laboratorio del Dr. Roberto Solano, Centro Nacional de
Biotecnología-CSIC, Madrid).
Por otra parte, durante el análisis de los dominios Jas y CCT, fueron identificados
dominios putativos de señales de localización nuclear (Nuclear Localization Signal,
NLS). El primero se encontró entre los aminoácidos 202–204
(PHRVASLMRFREKRKERNFDKKIRYSVRK) y acompañado de un grupo de
residuos básicos antes y después del dominio putativo de la señal de localización
nuclear, este clúster KRK fue identificado por primera vez por Boulikas (1994). La
segunda señal de localización nuclear, fue ubicada entre los aminoácidos 197 y 205
61
Capítulo I
62
Capítulo I
GFP GUS
a b
N-Ter
ZmZIM91 GFP GUS
N-Terminal
ZmZIM91_Pcambia
1303 c d
B
GFP
a b
N-Ter
ZmZIM91 GFP
c d
N-Terminal
ZmZIM91_Pcambia
1302
e f
63
Capítulo I
MeJA 25 µM
60 min
MeJA 25 µM+MG132
5µM
0 0,5 1 1,5
64
Capítulo I
a b
ZmZIM91_C-GFP
c d
Control DMSO 60 minutos
e f
Existen diferentes tipos de gránulos, por ejemplo los gránulos que corresponden a
estructuras subnucleares que están enriquecidas en factores de transcripción RNA pre
mensajeros y están localizados en regiones intercromáticas (Lamond y Spector, 2003).
Para verificar la localización de los gránulos formados por la proteína ZmZIM91
después del tratamiento con MeJA, se llevó a cabo un experimento de transfección en
tabaco, después de tres días de agroinfiltración y se realizó aplicación de 100 µM de
65
Capítulo I
ZmZIM91_C-GFP
a b c d
e f g h
66
Capítulo I
En las muestras tratadas con 0,01% de metil jasmonato, a 30 minutos se puede ver un
incremento de la proteína, mientras que a 1 hora se observa la degradación de la
proteína. Al adicionar el inhibidor del proteasoma 26S (100 µM de MG132), a 1 hora
después de la aplicación del tratamiento, se ve que la proteína ZmZIM91 se conserva
(Figura 3-16). Los resultados indican que el proteasoma 26S media la degradación de
ZmZIM91 en respuesta a metil jasmonato, al igual que lo hace en el caso de las
proteínas JAZ de Arabidopsis (Chini et al., 2007; Yan et al., 2007; Thines et al., 2007)
y además confirma los resultados obtenidos en los protoplastos de maíz presentados
anteriormente.
A B
ZmZIM91
ZmZML3
67
Capítulo I
0.5 h
0.5 h
0h
1h
1h
Anti_ZmZIM91
β-Actin
0.5 h
0.5 h
0h
1h
1h
Anti_ZmZIM91
β-Actin
3.1.6. Identificación del consenso in vitro de unión a ADN para las proteínas
ZmZIM91 de maíz y AtZIM de Arabidopsis mediante la técnica protein-binding
microarray (PBM11)
68
Capítulo I
A B
0.4
ZmZIM91
E-score
0.2
0.0
ZIM ZIM
-0.2 ZmZIM91
C D
0.50 0.50
0.25 0.25
E-score
E-score
0.00 0.00
-0.25 -0.25
ZIM
ZmZIM91 ZIM
-0.50
ZmZIM91
-0.50
PBM
TGATCA
CGATCG
CGATCC
CGATCA
CAGATC
AGATCC
AGATCT
AGATCG
GGATCC
AGATCA
GGATCA
CAGATA
CGATAA
TGATAA
AGATAA
AGATAT
AGATAC
CGATAC
CGATAG
AGATAG
GGATAA
PBM
GGATAC
Figura 3-17. Identificación de los motivos in vitro de unión a ADN de AtZIM y
ZmZIM91. (A) Representación de la matriz de posición de peso correspondiente a
ZmZIM91 y AtZIM. Ambas proteínas muestran alta afinidad de unión al elemento 5’-
AGATCT-3’, seguido por el elemento 5’-GATATC-3’. (B) Diagrama de caja de
enriquecimiento de todos los posibles 6-mers que contienen el consenso de 4-mer
indicado. Las cajas representan cuartiles desde 25% a 75%, y la línea negra representa
la distribución media (cuartil 50%). Las barras indican cuartiles de 1 a 25% (arriba) y 75
a 100% (a bajo) y los puntos denotan los valores extremos de la distribución. Las cajas
en azul corresponden a AtZIM y las verdes a ZmZIM91. Ambas proteínas presentan alta
y similar afinidad por el consenso 5’-GATC-3’ y de baja a media por el elemento 5’-
GATA-3’ y una no unión a un irrelevante elemento 5’-GTAC-3’. PBM indica la
distribución de los puntajes (E-scores) de todos los posibles 6-mers representados en el
microarray. (C) El diagrama de caja de puntajes (E-scores) de todos los posibles 8-mers
que contienen los 6-mer del consenso 5’-AGATCT-3’. Ambas proteínas muestran
afinidades similares por el elemento indicado. (D) El diagrama de caja de puntajes (E-
scores) de todos los posibles 8-mers que contienen los 6-mer del consenso 5’-
GATATC-3’. Ambas proteínas muestran afinidades similares por el elemento indicado
(En colaboración con el Dr. José Manuel Franco, la Dra. Irene Vidrieros y el Dr.
Roberto Solano. Servicio de Genómica del Centro Nacional de Biotecnología-CSIC,
Madrid).
69
Capítulo I
70
Capítulo I
A
35S::ZmZIM91:GFP 35S::YFPN ZmZIM91+35S::YFPC CK2β1
35S::CK2β1:GFP
B Proteínas
Fusionfusionadas
proteins
β1 β2 β3 α GST
ZmZIM91.1
ZmZIM91
Figura 3-18. ZmZIM91 interacciona con la proteína quinasa CK2 de maíz. En (A)
utilizando la técnica de complementación bimolecular en hojas de tabaco, se muestra la
interacción entre ZmZIM91 y CK2β1. En la parte izquierda, se muestra la localización
tanto de 35S::ZmZIM91:GFP como de 35S::CK2β1:GFP y en la parte derecha la
interacción entre ambas proteínas (núcleo y panorama respectivamente). En (B) se
enseña la interacción entre ZmZIM91 y CK2β1, CK2β2, CK2β3 y CK2α1 mediante un
experimento de pull down, el control negativo con la GST sola no presenta interacción.
71
Capítulo I
72
Capítulo I
a b c
B
d e f
C
g h i
73
Capítulo I
a b c
B
d e f
C
g h i
D
j k l
74
Capítulo I
75
Capítulo I
a b c
B
d e f
C
g h i
D
j k l
76
Capítulo I
a b c
B
d e f
Por otra parte, para confirmar el resultado anterior, se llevó a cabo otra aproximación
que consistió en agroinfiltrar hojas de tabaco con 35S::ZmZIM91:GFP,
35S::CK2β1:MYC y 35S::CK2α1:DsRed (Figura 3-22), los resultados muestran que
CK2α1 se va desplazando desde el nucléolo hasta el núcleo y posteriormente sale junto
con ZmZIM91 al citoplasma, este efecto es debido probablemente a CK2β1, la cual se
ha visto que puede transportar sus sustratos y relocalizarlos como en el caso de la
subunidad catalítica CK2α1 (Riera et al., 2011).
77
Capítulo I
a b c
B
d e f
78
Capítulo I
GATA/Zinc
ZIM Jas CCT Finger
A N-Ter C-Ter
(TIFY)
P P P P
B
k Da
kDa
68
ZmZIM91
47 kDa
47 kDa
45
36
29
20
14
Con el fin de conocer si ZmZIM91 era sustrato in vivo de la proteína quinasa CK2, se
realizaron ensayos quinasa en gel los cuales permitieron detectar la actividad de
proteínas quinasas nativas que fosforilan a ZmZIM91. A diferencia del ensayo de
fosforilación in vitro, la señal detectada en el ensayo en gel aparece en el lugar
correspondiente a la/s quinasa/s y no al sustrato.
Ya que los resultados expuestos hasta el momento indican que la proteína ZmZIM91
está afectada por MeJA, se quiso determinar si la fosforilación de ZmZIM91 por CK2
79
Capítulo I
variaba en presencia de MeJA. Para esto, se procedió a realizar el ensayo quinasa en gel
utilizando extractos de raíz de plántulas de maíz de 6 días tratados con 100 µM de
MeJA y como extractos de raíz de plántulas de maíz de 6 días con DMSO (debido a que
el MeJA estaba diluido con DMSO). Los extractos fueron tomados a diferentes tiempos:
0 minutos, 15 minutos, 30 minutos, 1 hora y 4 horas. En este experimento, se usó
también 5,6-dicloro-1-(b-d-ribofuranosil) benzimidazol (DRB), un inhibidor específico
de CK2 que permitiría ubicar la banda exacta correspondiente a CK2 para hacer los
respectivos análisis de su comportamiento de fosforilación de ZmZIM91 bajo
tratamientos con MeJA (Meggio et al., 1990; Szyszka et al., 1995).
Los resultados obtenidos en el caso del gel que no fue tratado con el inhibidor de CK2,
exhiben un incremento de fosforilación de la muestra tratada con MeJA a 30 minutos en
comparación con la control, mientras que a 1 hora de tratamiento con MeJA se observa
una disminución de la fosforilación, finalmente a las 4 horas tanto en la muestra tratada
como en la control se evidencia un incremento de la actividad de la CK2 (Figura 3-24,
parte A). Lo anterior, fue concluido con ayuda del gel hecho en paralelo con las mismas
condiciones que el anterior, pero tratado con 50 µM de DRB confirma que la banda que
se ve afectada por el tratamiento con MeJA, corresponde a la proteína quinasa CK2α
(Figura 3-24, parte B) ya que tiene un tamaño de 38 kDa y disminuye tanto en las
muestras tratadas como en las control.
80
Capítulo I
Control MeJA
IN GEL ZmZIM91
CK2
38 kDa.
B
Control MeJA
IN GEL ZmZIM91 +
CK2
38 kDa.
81
Capítulo I
La familia TIFY específica de plantas está compuesta por cuatro subfamilias (TIFY,
PPD, JAZ y ZML) en Arabidopsis, que han sido implicadas en diferentes respuestas a
estrés (Ye et al., 2009), de las cuales la subfamilia JAZ ha sido la mejor caracterizada.
Sin embargo, pese a la importancia del maíz como cultivo para la alimentación y la
generación de biocombustibles y al impacto que puede tener tanto el estrés biótico como
abiótico en su producción, no había sido llevado a cabo un estudio de los TIFY en esta
especie. Uno de los principales aportes de esta investigación radica en ampliar el
conocimiento sobre la subfamilia ZML en maíz, en el cual han sido identificados tres
miembros de la subfamilia ZML (Bai et al., 2011), los cuales de acuerdo al árbol
filogenético muestran alta conservación con respecto a los homólogos en Arabidopsis.
82
Capítulo I
La respuesta a estrés biótico causada por insectos herbívoros e infección por patógenos,
es mediada por una variedad de hormonas, entre las cuales está el jasmonato (Bari et al.,
2009; Pieterse et al., 2009). Los JAs juegan una amplia variedad de papeles en la
respuesta a herida y en la producción de metabolitos secundarios (Farmer et al., 1992;
Wasternack y Hause, 2002; Lorenzo y Solano, 2005; Shan et al., 2009). La
caracterización molecular de ZmZIM91 se llevo a cabo basándose en la información
disponible sobre los genes de la subfamilia JAZ de Arabidopsis, que como es conocido
han sido implicados en la respuesta a jasmonato, ya que su degradación es promovida
por esta fitohormona y es mediada por el complejo SCFCOI1, lo que a su vez elimina la
represión de factores de transcripción como MYC2 y MYC3 (Bai et al., 2011; Thines et
al., 2007; Yan et al., 2007; Melotto et al., 2008). En Arabidopsis la mayoría de los
genes JAZ son inducidos por infección con Pseudomonas syringae (Demianski et al.,
2012), lo que indica que esta subfamilia en Arabidopsis está involucrada en la
resistencia a patógenos, mientras que en uva bajo el mismo tratamiento el número de
genes que se indujeron fue reducido (Yucheng et al., 2012). Esta diferencia de respuesta
entre especies hace que sea relevante estudiar la regulación de la familia TIFY en otras
plantas de interés agronómico como es el caso del maíz.
83
Capítulo I
El motivo LPIARR, el cual está localizado en el N-terminal del motivo Jas y que ha
sido descrito como el responsable de la interacción de los JAZ con COI1 en presencia
de la hormona JA-Ile (Pauwels y Goossens, 2011), está altamente conservado en
proteínas JAZ (JAZ1, JAZ2, JAZ3, JAZ9, JAZ10 Y JAZ12) que interaccionan
fuertemente con COI1, lo cual es consistente con la vida media de las proteínas JAZ
mediadas por JA (Chini et al., 2007; Thines et al., 2007; Chung y Howe, 2009;
Grunewald et al., 2009; Pauwels et al., 2010). La importancia del motivo LPIARR en la
degradación de los JAZ por tanto es muy relevante, lo que está respaldado por los
resultados obtenidos en el estudio realizado a JAZ8, ya que esta proteína carece de este
motivo, teniendo en su lugar la secuencia PKASM, lo cual no permite a JAZ8
interaccionar fuertemente con COI1 en presencia de JA-Ile, lo que trae como
consecuencia que JAZ8 sea más estable en presencia de la hormona (Shyu et al., 2012).
84
Capítulo I
COI1 de Arabidopsis (Figura 3-10) al igual que inter-especie entre ZmZIM91 y COI de
Arabidopsis (Figura 3-25) en presencia de diferentes concentraciones de
CORONATINA mostraron que los ZML no son capaces de interaccionar con COI1. Sin
embargo sería interesante realizar el experimento de interacción entre ZmZIM91 y
ZmCOI1, con el fin de determinar si se trata de un mecanismo conservado entre
especies. También hay que tener en cuenta que la variación en el N-terminal del
dominio Jas de ZmZIM91, puede reflejar la existencia de una funcionalidad específica
para la subfamilia ZML.
-4
Los consensos putativos de localización nuclear encontrados en entre los dominios Jas y
CCT, pueden ser los responsables de la localización de ZmZIM91 en el núcleo, sin
embargo en su región N-terminal ZmZIM91 posee tanto un motivo putativo de Señal de
Localización Nuclear (NLS) como un motivo putativo de Señal de Exportación Nuclear
(NES) que también pueden ser relevantes.
85
Capítulo I
86
Capítulo I
0.50
0.25
E-score
0.00
-0.25
GATC
GATA
-0.50
CGATCA
TGATCA
AGATCA
AGATCT
CGATCC
CGATCG
CAGATC
AGATCC
AGATCG
GGATCA
GGATCC
PBM
Figura 3-26. Diagrama de caja de puntajes (E-scores) de todos los 8-mers posibles
conteniendo los consensos de 6-mer indicados y reconocidos por AtZIM y
ZmZIM91. En verde están representados los puntajes correspondientes a los elementos
contenidos GATC y en azul están los puntajes de los mismos motivos conteniendo el
elemento GATA, donde el C en rojo fue remplazado por A (En colaboración con el Dr.
José Manuel Franco, la Dra. Irene Vidrieros y el Dr. Roberto Solano. Servicio de
Genómica del Centro Nacional de Biotecnología-CSIC, Madrid).
Los resultados obtenidos en el capítulo I del presente trabajo, permiten tener una
noción a cerca del modelo de comportamiento de ZmZIM91, por tal razón en esta parte
de la discusión se proponen dos modelos hipotéticos de regulación para ZmZIM91.
Pese a que los ZML no pueden interaccionar con COI1, es interesante tener en cuenta
que se ha demostrado que la proteína de ZmZIM91 es conservada in vivo por la
presencia de MG132, lo cual indica que se podría degradar vía proteasoma 26S. A pesar
de esto el mecanismo por el cual ZmZIM91 es degradado permanece desconocido como
en el caso de JAZ8 y otros JAZ de Arabidopsis, que se comportan de manera similar a
ZmZIM91 en presencia de MeJA.
Una de las hipótesis que se proponen para explicar el mecanismo por el cual se degrada
ZmZIM91 por MeJA, es que éste es eliminado por una vía independiente de COI1 que
tal vez está involucrado con otras proteínas F-box receptoras de JA. La vía en la cual
87
Capítulo I
este nuevo receptor funcionaría podría ser similar a la acción de COI1 sobre los
miembros de la familia JAZ que interaccionan fuertemente con COI1.
Otra hipótesis que se plantea es que la degradación de ZmZIM91 por MeJA vía el
proteasoma 26S, se lleve a cabo a través de la interacción con los JAZ, la cual fue
demostrada entre los ZML y JAZ de Arabidopsis. En el caso de ZML2 el dominio Jas
de JAI3 fue suficiente para que existiera la interacción de ambas proteínas, este es el
mismo caso de JAZ3 y MYC2 descrito por Chini et al. (2009), donde el dominio Jas
también fue suficiente para mediar la interacción independiente de la hormona JA entre
ambas proteínas. En conclusión, probablemente los JAZ interaccionen con los ZML y
en presencia de MeJA sean degradados por el proteasoma 26S en forma de una especie
de “complejo degradador” que incluiría a COI1.
Por otra parte, los ensayos de fosforilación in vitro, evidenciaron que ZmZIM91 era
sustrato tanto de CK2α1 como del holoenzima CK2α1β1, lo que era esperado si se tiene
en cuenta que ZmZIM91 posee putativos consensos de fosforilación por CK2, sin
88
Capítulo I
embargo aún queda por determinar los residuos específicos de ZmZIM91que son
fosforilados por CK2.
Posterior al tratamiento con MeJA, se llevó a cabo el experimento de quinasa en gel con
muestras de raíz tratadas con sequía para evaluar el comportamiento de la fosforilación
de ZmZIM91 por CK2 en condiciones de estrés abiótico (Figura 3-27). Se observó que
en todos los casos la fosforilación de ZmZIM91 por CK2 incrementa, caso contrario al
presentado bajo tratamiento con MeJA. Sería interesante analizar el comportamiento de
89
Capítulo I
la proteína ZmZIM91 bajo sequía para determinar si existe alguna relación entre la
conservación o degradación de ZmZIM91 y su fosforilación por CK2.
90
Capítulo II
Capítulo II
Capítulo II
4.1 Resultados
92
Capítulo II
Actina
Posteriormente, con las condiciones iniciales puestas a punto, se efectuó el ChIP usando
protoplastos de maíz transformados por una parte con 35S::ZmZIM91:GFP y por otra
con el vector 35S::GFP (Figura 4-2). Para las inmunoprecipitaciones de cada muestra se
utilizaron: 1) un anticuerpo contra la GFP (abcam), 2) los dos anticuerpos previamente
purificados de ZmZIM91 (anti_ZmZIM91#1 y anti_ ZmZIM91#2), 3) un anticuerpo
contra histona H3 (abcam) y 4) el anticuerpo secundario contra la IgG. Para evaluar la
calidad de los inmunoprecipitados con los diferentes anticuerpos usados, se realizaron
PCRs semi-cuantitativas de ChIP utilizando cebadores específicos para amplificar la
actina de maíz.
93
Capítulo II
A B ZmZIM91 GFP
Input
ZmZIM91_GFP
IgG
Anti_GFP
Anti_Histona
GFP
Anti-91#1
Anti-91#2
94
Capítulo II
95
Capítulo II
A
ZmZIM91_Input ZmZIM91_AntiGFP ZmZIM91_Anti91
Vector GFP_Anti91
ZmZIM91_Anti91
Vector GFP_Input
library nM
ZmZIM91_Input
B C
ZmZIM91_Input
21.5
ZmZIM91_AntiGFP
0
ZmZIM91_Anti91
14.5
Vector GFP_Input
66.4
Vector GFP_AntiGFP
33.2
Vector GFP_Anti91
36.8
96
Capítulo II
Para el mapeo de las lecturas cortas en el genoma de maíz de la variedad B73 fue usado
el software BOWTIE (Langmead et al., 2009).
97
Capítulo II
A B
ZmZIM91_GFP
GFP
Resultados de
Vector GFP
Resultados ZmZIM91_GFP
AntiGFP Anti91
Lecturas Lecturas
empleadas empleadas Anti GFP Anti91
para búsqueda para búsqueda Lecturas empleadas Lecturas empleadas
de picos de picos
para búsquedas de para búsqueda de
56.543 32.305 picos picos
1.062.351 154.994
Figura 4-5. Análisis de los datos de las librerías de ChIP de protoplastos de maíz
usando BOWTIE y MACS. En (A) se presentan las lecturas que alinean en el genoma
de maíz del vector GFP con el antiGFP y el anti91. En (B) Se presentan las lecturas que
alinean en el genoma de maíz después de descartar las encontradas en los
correspondientes controles negativos (vector GFP) de ZmZIM91 con el antiGFP y el
anti91 y que fueron usadas para buscar los picos en cada caso.
La cantidad de picos encontrados para ZmZIM91_anti91 fue de 1454, mientras que para
ZmZIM91_antiGFP fueron 5824 (Figura 4-6).
Picos AntiGFP
Picos Anti91.1
98
Capítulo II
Tanto para los picos obtenidos con el antiGFP como con el anti91, se llevó a cabo un
análisis de los mismos y se determinó en ambos casos la localización de los sitios
relativos de unión a los genes más cercanos. Para conocer la distribución de los picos, se
realizó una búsqueda de los picos relativa a la coordenada de inicio de los genes
localizados en la vecindad, en una ventana de 10 Kb aguas arriba y aguas abajo (Figura
4-7 A y B), esta distribución reveló que la unión de ZmZIM91 está altamente
enriquecida en las proximidades cercanas a los genes, también se determinó que la
mayoría de los picos en ambos casos se encontraban localizados en mayor proporción
aguas arriba de los genes, seguido por una gran cantidad de picos dentro del gen y en un
porcentaje muy similar a los encontrados aguas abajo (Figura 4-7 C y D).
Posteriormente, se realizó un cruce con los picos obtenidos para las librerías generadas
con los ChIPs de ZmZIM91 generados con los dos anticuerpos y se obtuvo que 82
interceptaban (Figura 4-6). Dada la complejidad de esta técnica y para tratar de asegurar
la identificación de un candidato fiable, se decidió trabajar sólo con los picos que
interceptaban, aunque se estima que al llevar a cabo esta estrategia, fueron descartados
candidatos positivos.
99
Capítulo II
A B
C D
A continuación, con los picos de ZmZIM91 que interceptaban en las librerías generadas
con los ChIPs de ZmZIM91 generados con los dos anticuerpos usados, fueron
elaborados dos tipos de archivos con el programa MACS: los bed que son los que dan
100
Capítulo II
información de la posición del pico y los wig que son los picos en sí. Ambos archivos
fueron usados en el programa IGV 2.1 y a partir de esto fueron generados los gráficos
de localización de los picos en cada cromosoma tanto para la librería de
ZmZIM91_antiGFP como para la de ZmZIM91_anti91 y para las librerías de los
controles de ambos con el vector de GFP (Figura 4-8).
Cromosoma 1 Cromosoma 2
Cromosoma 3 Cromosoma 4
Cromosoma 5 Cromosoma 6
Cromosoma 7 Cromosoma 8
Cromosoma 9 Cromosoma 10
Figura 4-8. Localización de picos en cada cromosoma del genoma de maíz. En lila
se presenta en primer lugar los picos correspondientes a las librerías de
ZmZIM91_antiGFP y en segundo las de ZmZIM91_anti91. En rojo se muestran los
controles con el vector de GFP, primero los correspondientes a las librerías
GFP_antiGFP y luego a las de GFP_anti91.
101
Capítulo II
zona 5´ de los genes tanto los picos para la librería de ZmZIM91_antiGFP (Tabla 4-1)
como los de la librería de ZmZIM91_anti91 (Tabla 4-2).
Identificador
pico en Gen en la zona que
Cromosoma Posición en el genoma MACS P-Value flanquea el pico
102
Capítulo II
Identificador
pico en Gen en la zona que
Cromosoma Posición en el genoma MACS P-Value flanquea el pico
103
Capítulo II
interesantes para este trabajo porque están involucrados en la respuesta a estrés. Estos
picos fueron localizados en el genoma de maíz con ayuda del software IGV 2.1. Las
imágenes se muestran en el Anexo I, Figuras SI1 a SI16.
La primera validación de los picos fue llevada a cabo mediante PCR semi-cuantitativa
de ChIP, para esto fueron diseñados cebadores en la zona central del alineamiento entre
las secuencias obtenidas para las librerías de ZmZIM91_antiGFP y las de
ZmZIM91_anti91 (ver materiales y métodos), un ejemplo de esto es mostrado en la
Figura 4-9.
>MACS_peak_188 91
TGCACTGTTATGGATAATTGATTGATTATACAAGCTAGAGCGCGTGGCTGCTAAAAATCATATTGCAAACTGATTGTGACTATGGGCGTGGTAGGGAA
ACAACCCCAGGAATATCAACGTGCCGTGTTTGGTTTCGGTACCTACAGCTTTCTTGACTTGGTTGCCGAGTTACTGCTCTTTTGGTACTACATAAGAC
CAATCTGTGGTATCCAAACAATTGGTGCTGTTTCAGTCTGCTGTCTCTGTTGGTCAATGTCTACTTGTAATACCGAACTGCAGTAAATGATAGTTTTG
TTTGACTGCAAAATTGACTAGTTTACCTACGCCTTAGGTGGAGGGTAGGAGCTATCT
MACS_peak_824 GTTTAGTTGATGACTTAATCATGTTTTATTTGTTACTGCTATTATCGCTAAGCATCTTGC 60
MACS_peak_188 ---------------------------------------------------------TGC 3
***
MACS_peak_824 ------------------------------------------------
MACS_peak_188 AAAATTGACTAGTTTACCTACGCCTTAGGTGGAGGGTAGGAGCTATCT 351
104
Capítulo II
Los datos obtenidos con la PCR semi-cuantitativa del ChIP de ZmZIM91 a partir de
protoplastos de maíz (Anexo I, Figura SI17), permitieron descartar algunos picos, ya
que o bien no amplificaban en el ChIP o amplificaban tanto en el control negativo
(GFP_antiGFP, GFP_anti91) como en las muestras de protoplastos que sobre-
expresaban 35S::ZmZIM91:GFP (ZmZIM91_antiGFP, ZmZIM91_anti91).
Posteriormente, con el fin de verificar los resultados obtenidos por PCR semi-
cuantitativa de ChIP de protoplastos de maíz, se eligieron tres picos candidatos que se
consideraban de gran interés debido a que en las zonas que flanqueaban estos picos se
encontraban genes relacionados con estrés. Los picos seleccionados fueron el 8, el 14 y
el 21, de los que se llevó a cabo la validación por PCR cuantitativa de ChIP de
ZmZIM91 de protoplastos de maíz.
En la Figura 4-10, se muestra la lista de los genes que flanquean las regiones donde se
encuentran los picos seleccionados para la validación por PCR cuantitativa de ChIP,
además de su función putativa, el respectivo homólogo en Arabidopsis y la expresión en
la hoja de maíz obtenida del trabajo de Lie et al, 2010.
Homólogo en
Gen Función putativa Arabidopsis
Pico 8
Quinasa 2 asociada a pared,
GRMZM2G176225 fosforilación de proteína, respuesta AT1G21270 (WAK2)
a estímulos por ácido salicílico
ABCG40, transportador de la
GRMZM2G003411 familia ABC involucrado en el AT1G15520
Pico 14
transporte de ABA
GRMZM5G862817 AT2G02230
ATPP2-B1, unión a carbohidrato
(dominio F-Box)
Figura 4-10. Genes seleccionados para la validación por PCR cuantitativa de ChIP
de ZmZIM91a partir de protoplastos de maíz. Los genes seleccionados para la
validación se flanquean las regiones de los picos encontrados en el ChIP-Seq de
ZmZIM91 proveniente de protoplastos de maíz. A la izquierda se enseña los patrones de
expresión de cada gen obtenidos del estudio de Lie et al., 2010 y a la derecha en la tabla
se puede ver el nombre del gen, la función putativa sacada de los homólogos en
Arabidopsis, los cuales están identificados en la última columna.
105
Capítulo II
106
Capítulo II
107
Capítulo II
108
Capítulo II
La PCR cuantitativa a tiempo real (qRT-PCR) para los tres picos, fue hecha utilizando
tres réplicas biológicas y tres réplicas técnicas, sobre las muestras de ChIP de
protoplastos de maíz: GFP_antiGFP, ZmZIM91_antiGFP, GFP_anti91 y
ZmZIM91_anti91 usando SYBR Green chemistry. El vector vacío fue usado como
control negativo con el fin de asegurarse de que el respectivo pico no correspondía a un
artefacto. También se utilizó un control negativo interno de la PCR cuantitativa de ChIP
llamado copia, que es un elemento retrotransponible usado como control en este tipo de
aproximaciones. Los resultados obtenidos de la PCR cuantitativa de ChIP utilizando
cebadores específicos (ver materiales y métodos), permitieron confirmar como positivos
los picos 8, 14 y 21 (Figuras 4-15, 4-16 y 4-17) confirmando a su vez los resultados
obtenidos con la PCR semi-cuantitativa de ChIP.
109
Capítulo II
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 8
35S::GFP
GFP_AntiGFP
GFP_Anti91
ZmZIM91_Anti 91
ZmZIM91_AntiGFP
GFP_Anti91
ZmZIM91_AntiGFP GFP_AntiGFP
ZmZIM91_Anti 91
0,000 0,010 0,020 0,030 0,040 0,050 0,060 0,070 0,080 0,090
110
Capítulo II
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 14
35S::GFP
GFP_AntiGFP
GFP_Anti91 ZmZIM91_Anti91
ZmZIM91_AntiGFP
ZmZIM91_AntiGFP GFP_Anti91
GFP_AntiGFP
ZmZIM91_Anti91
111
Capítulo II
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 21
35S::GFP
GFP_AntiGFP
GFP_Anti91
ZmZIM91_Anti 91
ZmZIM91_AntiGFP
GFP_Anti91
ZmZIM91_AntiGFP GFP_AntiGFP
ZmZIM91_Anti 91
0,000 0,200 0,400 0,600 0,800 1,000 1,200 1,400 1,600 1,800
Posteriormente, para estos picos se realizó la búsqueda in silico de los motivos GATC y
GATA de unión a ADN identificadas in vitro para ZmZIM91 mediante el experimento
de PBM11.
112
Capítulo II
En los picos 14 y 21, se identificaron cajas GATA y GATC en las secuencias obtenidas
con el antiGFP y el anti91, sin embargo en su mayoría eran motivos GATC (Figura 4-
18). En el caso del pico 8, no se encontraron motivos de unión a ADN GATA y GATC.
Figura 4-18. Localización en los picos 8, 14 y 21, de los motivos de unión a ADN
GATA y GATC identificados in vitro para el factor de transcripción ZmZIM91. En
la imagen se muestra la localización de los sitios de unión a ADN de ZmZIM91. En los
picos 14 y 21 fueron identificados tanto en la secuencia obtenida con el antiGFP como
en la secuencia obtenida con el el anti91, los motivos de unión a ADN de ZmZIM91,
GATA y GATC. En el pico 8 no fueron detectadas cajas GATA y GATC. En azul se
presentan la caja GATA y en rojo se muestran las cajas GATC.
Con el fin de obtener réplicas biológicas del primer ChIP-Seq de ZmZIM91 proveniente
de protoplastos, se generaron dos réplicas biológicas más, modificando la elaboración
de las librerías reduciendo la cantidad de adaptadores presentes en la muestra para
mejorar la eficiencia de la secuenciación (ver materiales y métodos). La calidad de estas
librerías fue analizada mediante bioanalyzer (Figura 4-19), donde se pudo observar que
no tenían picos de contaminación por adaptadores y que además presentaban una mayor
concentración. En el momento de escritura de esta tesis doctoral, las muestras fueron
enviadas a secuenciar y por lo tanto no se tienen datos a cerca de los nuevos resultados
obtenidos que permitan sacar conclusiones acerca del mejoramiento de la técnica.
113
Capítulo II
A B C D
91FL_Anti 91 BR2 (B)
114
Capítulo II
En esta parte del trabajo, se exponen los resultados obtenidos del ChIP-Seq de
ZmZIM91 proveniente de hojas de plantas de maíz de 9 días, usando el anticuerpo
contra la proteína endógena de ZmZIM91 (ver materiales y métodos) que de acuerdo
con el ChIP de ZmZIM91 a partir de protoplastos de maíz, era el anticuerpo endógeno
que mejor funcionaba. En este caso se utilizó como control el Input y las librerías fueron
realizadas de acuerdo con el protocolo expuesto en los materiales y métodos.
Para identificar las regiones genómicas a las que se une in vivo ZmZIM91, se realizaron
experimentos de ChIP-seq con la tecnología Illumina-Solexa, que combina la
inmunoprecipitación de la cromatina (ChIP) con secuenciación masiva paralela, con el
objetivo de identificar los sitios de unión a ADN de dicho factor de transcripción.
115
Capítulo II
B73_Anti 91.1 (A) B73_Anti 91.2 (B) B73_Anti 91.3 (C) B73_Anti 91.4 (D)
A B C D E
Para el mapeo de las lecturas cortas en el genoma de maíz de la variedad B73 fue
empleado el software BOWTIE (Langmead et al., 2009) (Tabla 4-3).
116
Capítulo II
Total de
Múltiples % lecturas
Nombre de Total lecturas
Único alineado_BOWTIE % alineadas % alineadas
la librería lecturas alineadas
BOWTIE BOWTIE
BOWTIE
ZmZIM91.1 72.457.244 6.735.490 9,30% 20.648.167 28,50% 37,79% 27.383.657
ZmZIM91.2 53.387.067 7.789.658 14,59% 14.719.861 27,57% 42,16% 22.509.519
ZmZIM91.4 36.464.983 3.090.484 8,48% 4.802.202 13,17% 21,64% 7.892.686
Input 68.205.250 18.170.029 26,64% 48.688.410 71,39% 98,03% 66.858.439
Los análisis de los resultados de las tres réplicas biológicas de ChIP-Seq de ZmZIM91
provenientes de hojas de plantas de maíz, permitieron identificar entre los promotores
más enriquecidos en las tres librerías secuenciadas, el promotor del gen de la enzima
Caffeic Acid Omethyltransferase (COMT) y el del gen DFR (A1) (Tabla 4-4). COMT es
un gen involucrado en la biosíntesis de lignina. Una de las alteraciones más marcadas a
la estructura de la lignina viene de la baja expresión de la enzima caffeic acid
Omethyltransferase (COMT). Un estudio realizado por Piquemal et al. (2002), permitió
concluir que la baja expresión de la enzima COMT altera los perfiles de la lignina y el
117
Capítulo II
De igual forma, se llevo a cabo una búsqueda en los picos de otros promotores
enriquecidos en los ChIP-Seq de ZmZIM91 y se encontró que los promotores de
MYB42 y R estaban enriquecidos en las tres réplicas biológicas, mientras que el
promotor de C1 estaba enriquecido en dos de las réplicas y finalmente se encontró que
los promotores de P1, de ZmNAC115, de una proteína de unión a ARN y de CESAA6
estaban enriquecidos en una de las réplicas biológicas (Tabla 4-4). Las proteínas CESA
forman una familia génica amplia cuyo número varía entre especies, en maíz se han
identificado doce genes que codifican para la celulosa sintasa, estando implicadas en la
síntesis de celulosa y por tanto en la formación de pared celular.
Por otra parte y de acuerdo a los datos arrojados por el software MACS, se llevó a cabo
la búsqueda en el genoma de maíz de otros picos que también estaban muy enriquecidos
en las tres réplicas biológicas de ZmZIM91 utilizando el software IGV 2.1. Los
resultados se muestran en el Anexo II Figura SII1 a SII16, donde además se indica el
gen o los genes que se localizan en las zonas que flanquean los picos, su respectivo
homólogo en Arabidopsis y el putativo proceso biológico en el que está involucrado.
118
Capítulo II
Replicas biológicas
Identificador del gen en maíz Búsqueda con IGV Nombre del gen diana
de ZmZIM91
GRMZM2G113137 GRMZM2G113137_T01 1 CESAA6
GRMZM2G026930 GRMZM2G026930_T01 3 DFR (A1)
AC196475.3_FG004 AC196475.3_FG004 3 COMT
GRMZM2G419239 GRMZM2G419239_T01 3 MYB42
GRMZM2G084799 GRMZM2G084799 1 P1
GRMZM2G005066 GRMZM2G005066 2 C1
GRMZM5G822829 GRMZM5G822829 3 R
GRMZM2G069047 GRMZM2G069047 1 ZmNAC115
Proteína que contiene un
GRMZM2G069102 GRMZM2G069102_T01 1 dominio de reconocimiento a
ARN, putativo, expresado.
119
Capítulo II
B 25,00
% de enriquecimiento de ZmCOMT con respecto a Input
20,00
15,00
ACTIN UTR
10,00 COPIA
NBZ
COMT-3'-UTR
5,00
COMT
0,00
ACTIN UTR COPIA NBZ COMT-3'-UTR COMT
-5,00
Figura 4-22. Validación por PCR cuantitativa en tiempo real del promotor de
ZmCOMT en muestras de ChIP de ZmZIM91 a partir de hojas de plantas de maíz.
En (A) se muestra el esquema del promotor del gen ZmCOMT, las cajas en color lila
representan los sitios GATA y GATC. En (B) se muestra la PCR cuantitativa del
promotor de ZmCOMT de cuatro réplicas biológicas de muestras de ChIP de
ZmZIM91, al igual que la de los controles negativos. La gráfica se calculó como
porcentaje de enriquecimiento de ZmCOMT con respecto al Input.
La validación por PCR cuantitativa de ChIP confirmó que ZmZIM91 podía unirse al
promotor del gen ZmCOMT, por consiguiente para determinar cuál era el papel
regulador de ZmZIM91 sobre ZmCOMT, fue llevado a cabo un ensayo de expresión
transiente en protoplastos de maíz, donde el promotor de ZmCOMT (1 kb desde la
región reguladora 5´) estaba fusionado al gen reportero de la luciferasa y ZmZIM91
estaba fusionado a la GFP. Como resultado se obtuvo que ZmZIM91 es capaz de
reducir la expresión del promotor de ZmCOMT aproximadamente en un 50% (Figura 4-
23), lo que convierte a ZmZIM91 en un represor de la expresión de ZmCOMT.
120
Capítulo II
1,4
pCOMT:LUC+ ZIM91
1,2
0,8
0,6
0,4
0,2
Para realizar la validación del promotor del gen ZmA1, fueron llevados a cabo
experimentos independientes de nano PCR cuantitativa de ChIP de ZmZIM91 a partir
de hojas de plantas de maíz (Fluidigm), en estos experimentos se usaron como control
negativo actina UTR, copia, NBZ y ZmCOMT-3´UTR. Los datos fueron procesados
siguiendo los parámetros descritos en los materiales y métodos.
Los resultados muestran que el promotor del gen ZmA1 se encuentra enriquecido 5,5
veces en los ChIPs de ZmZIM91. En el promotor del gen ZmA1 fueron identificadas
cajas GATA y GATC, indicando que in vivo ZmZIM91 podría unirse al promotor del
gen ZmA1 a través de los motivos de unión a ADN GATA y GATC (Figura 4-24).
121
Capítulo II
6,00
5,00
4,00
ACTIN UTR
3,00 COPIA
NBZ
2,00
COMT-3'-UTR
1,00 A1
0,00
ACTIN UTR COPIA NBZ COMT-3'-UTR A1
-1,00
-2,00
Figura 4-24. Validación por PCR cuantitativa en tiempo real del promotor de
ZmA1 en muestras de ChIP de ZmZIM91 a partir de hojas de plantas de maíz. En
(A) se muestra el esquema del promotor del gen ZmA1, las cajas en color lila
representan los sitios GATA y GATC. En (B) se muestra la PCR cuantitativa del
promotor de ZmA1 de cuatro réplicas biológicas de muestras de ChIP de ZmZIM91, al
igual que la de los controles negativos. La gráfica se calculó como porcentaje de
enriquecimiento de ZmA1 con respecto al Input.
Con el fin de estudiar el papel de ZmZIM91 sobre el promotor del gen ZmA1, se realizó
un ensayo de luciferasa, utilizando expresión transciente en protoplastos de maíz.
Teniendo en cuenta que el nivel basal del promotor de ZmA1 es muy bajo, se usó para
realizar el experimento el complejo activador C1+R que además permitiría estimar de
una forma más clara la acción de ZmZIM91 sobre el promotor de ZmA1. Lo que se
observó fue que ZmZIM91 podía generar una fuerte reducción de la activación que
producía el complejo C1+R sobre el promotor de ZmA1 (Figura 4-25), indicando esto
que ZmZIM91 puede actuar como un represor de la transcripción del gen ZmA1.
122
Capítulo II
3,000
2,500 A1
2,000 A1+CR
1,500 A1+CR+ZmZIM91
1,000
0,500
0,000
A1 A1+CR A1+CR+ZmZIM91
Figura 4-25. ZmZIM91 reprime el promotor del gen de ZmA1. Mediante un ensayo
de luciferasa en protoplastos de maíz, se determinó que ZmZIM91 era capaz de reprimir
el promotor del gen de ZmA1. Debido a que el nivel basal del promotor del gen de
ZmA1 es muy bajo (en color azul), se usó el complejo C+R para activarlo (en color
verde) y se adicionó a ZmZIM91, el cual es capaz de reprimir el promotor de ZmA1
interfiriendo en la activación del mismo por el complejo C+R (en color lila).
123
Capítulo II
A2,00 B 2,00
1,80 1,80
1,60 1,60
1,40 1,40
Fold Difference
Fold Difference
1,20 1,20
1,00 1,00
ZmZIM91
Zm91 ZmZIM91
Zm91
0,80 0,80
0,60 0,60
0,40 0,40
0,20 0,20
0,00 0,00
Promotor
COMTde ZmCOMT
Promoter Promotor de ZmA1
A1 Promoter
Debido a que resultados de ChIP-Seq de ZmZIM91 indicaban que este factor se unía al
promotor del gen ZmCOMT, se procedió a realizar un análisis en la literatura tanto del
gen como de los factores que se habían descrito como reguladores de su promotor,
encontrando que los factores MYB-R2R3 del subgrupo cuatro regulaban este gen a
nivel transcripcional, específicamente se conocía que el factor de transcripción
ZmMYB31 que es capaz de unirse in vivo al promotor del gen ZmCOMT (Fornalé et al.,
2010), así como ZmMYB42 (Gray et al., 2012; Sonbol et al., 2009). Los MYB-R2R3
del subgrupo cuatro han sido descritos como represores de genes de la biosíntesis de
lignina.
A YFP N ZmMYB31+ YFP C ZmZIM91 YFP N ZmZIM91+ YFP C VECTOR YFP N VECTOR+ YFP C ZmMYB31
ZmMYB31 YN YC YN+YC
ZmZIM91
ZmMYB42
YN YC YN+YC
ZmZIM91
125
Capítulo II
este putativo módulo estaba conservado evolutivamente, para lo cual se evaluó in silico
la presencia de dichas cajas en el promotor de COMT en otras especies de gramíneas.
126
Capítulo II
Los datos obtenidos anteriormente para ZmZIM91 permitían sugerir que estaba
involucrado en la regulación de genes de respuesta a estrés, ya que como se describió en
el capítulo I, fue identificado en un cribado de doble híbrido de una librería de hoja
estresada por sequía utilizando la subunidad reguladora β1 de la proteína quinasa CK2
de maíz, de la que se sabe que está implicada en diferentes procesos biológicos
incluyendo estrés. Parte del proceso de determinación de la relevancia biológica del
factor ZmZIM91 era la identificación de sus genes diana, para ello se utilizó la técnica
de ChIP-Seq, que permite la identificación de las regiones de unión de factores de
transcripción en el genoma (Buck y Lieb, 2004; Jiang y Pugh, 2009).
127
Capítulo II
Debido a que la mayoría de los genes que fueron seleccionados de acuerdo a la posición
de los picos en sus regiones 5´ no estaban caracterizados en maíz, fue necesario realizar
una búsqueda de sus homólogos en Arabidopsis. Interesantemente se encontró que estos
genes fueron catalogados como de respuesta a patógenos, en un trabajo donde se realizó
un análisis global de la expresión génica en Arabidopsis de genes de respuesta a
patógenos y ciclo celular durante la infección por pequeños virus de ADN
(Geminivirus) que usan la maquinaria de replicación de la planta para amplificar sus
genomas (Ascencio-Ibáñez et al., 2008). En esta investigación se llevó a cabo un
análisis de microarray del transcriptoma de Arabidopsis thaliana en respuesta a
infección por cabbage leaf curl virus (CaLCuV), descubriendo 5,365 genes (con una
tasa de falsos positivos de 0.005) diferencialmente expresados en hojas infectadas de
roseta después de 12 días de post-inoculación. Lo que conlleva a pensar que ZmZIM91
podría estar modulando genes de respuesta a patógenos, esta hipótesis sería coherente si
se tiene en cuenta que ZmZIM91 responde a MeJA, al igual que muchos genes
implicados en defensa como por ejemplo MYC2 que induce respuestas mediadas por JA
tales como defensa contra patógenos necrotrópicos (Lorenzo et al., 2004; Boter et al.,
2004; Dombrecht et al., 2007).
128
Capítulo II
129
Capítulo II
Control Herida
0h 0.5h 1h 0.5h 1h
Anti_ZmZIM91
β-Actin
130
Capítulo II
La lignina es uno de los biopolímeros más abundantes del planeta, es probable que se
encuentre bajo la regulación de diferentes mecanismos, uno de ellos podría ser
manejado por ZmZIM91. De igual forma, la presencia de lignina no es deseable en la
biomasa destinada a la alimentación animal, por lo cual también es interesante el estudio
de probables modificaciones biotecnológicas con miras a reducir el contenido de
lignina. En este contexto, se sugiere que la sobre-expresión de ZmZIM91 puede ayudar
a obtener plantas que sean más digeribles, lo cual rebajaría los costos de producción de
biocombustibles, convirtiendo a ZmZIM91 en una herramienta biotecnológica útil para
el aprovechamiento del maíz en la producción de biocombustibles.
131
Capítulo II
Figura 4-30. La represión del promotor de ZmCOMT por ZmZIM91 puede tener
un impacto significativo en la reducción del contenido de lignina en maíz.
(Adaptado de Fornalé, S. et al., 2010).
132
Capítulo II
Por otra parte, los datos obtenidos de la PCR cuantitativa de las muestras de ChIP de
ZmZIM91 de hojas de maíz tratadas con MeJA a 1 hora, evidenciaron una menor
interacción de ZmZIM91 con los promotores de los genes de ZmCOMT y ZmA1,
demostrando la importancia del efecto de la hormona sobre la regulación de ambos
promotores.
Los genomas de las eucariotas poseen cientos de E3 ligasas las cuales proveen
especificidad para los procesos de degradación de las proteínas. En este trabajo se pudo
demostrar que ZmZIM91 era degradado por la vía del proteasoma 26S, aunque no se
conoce el funcionamiento del mecanismo. En este contexto, es importante mencionar
que en un trabajo realizado en Arabidopsis acerca del gen diana de ZmZIM91, COMT,
se observó que dicho gen aumentaba su expresión en condiciones de herida, pero que
sin embargo en mutantes de coi1 sometidos a herida, la expresión de COMT decrecía, lo
cual indicaba que la expresión del gen COMT era dependiente de COI1 (Reymond et
al., 2000). Esto indica la existencia de una conexión entre la inducción de ZmCOMT por
herida y la respuesta a la aplicación de MeJA. Lo anterior podría apoyar la hipótesis del
complejo degradador planteado en la discusión de resultados del capítulo I conformado
por ZmZIM91/JAZ/COI1, teniendo en cuenta que sin la presencia de COI1 no se
pueden degradar los represores y por lo tanto los niveles de COMT se mantienen bajos.
133
Capítulo II
MeJA
ZIM
Sin
CT
GATA
0 horas GATC El promotor de ZmCOMT está
reprimido
B ZmZIM91 es degradado
UBI
por la vía del proteasoma UBI
UBI
26S
ZmZIM91 está
ZIM
interaccionando con las
proteínas ZmJAZ?
?
CT
MeJA
GATA Datos preliminares en Arabidopsis
Con GATC muestran que AtZIM interacciona con
algunosAtJAZ
134
Capítulo II
Por otra parte, para validar los picos obtenidos con el ChIP-Seq de protoplastos, se
validó el pico 14, usando tanto PCR semi-cuantitativa (Figura 4-32A) como PCR
cuantitativa (Figura 4-32B) en las muestras de ChIP de ZmZIM91 realizado con hojas
de maíz. Los resultados confirmaron el enriquecimiento del pico 14 en los ChIP de hoja
de maíz, siendo el resultado igual al obtenido en las PCR cuantitativas de ChIP de
protoplastos.
135
Capítulo II
A INPUT Anti_ZmZIM91
Pico 14
INPUT
INPUT
ZmZIM91_Anti91
ANTI_91FL 91FL
INPUT
INPUT
ANTI_91FL 91FL
ZmZIM91_Anti91
Analizando y comparando los datos obtenidos con las dos técnicas de ChIP-Seq, se
encontró que la cantidad de lecturas obtenidas en los ChIP-Seq provenientes de hojas de
maíz que alineaban con el genoma de maíz fueron mayores que las que se obtuvieron
con el ChIP-Seq proveniente de protoplastos de maíz. En cuanto a las librerías de ChIP
de ZmZIM91 utilizando hojas de maíz, se obtuvo que para B73_ZmZIM91.1 eran
27.383.657 lecturas, el equivalente a un 37,79%; para B73_ZmZIM91.2 eran
22.509.519 lecturas, el equivalente a un 42,16%; para B73_ZmZIM91.4 eran 7.892.686
lecturas, el equivalente a un 21,64% y finalmente para el Input eran 66.858.439 lecturas,
136
Capítulo II
Otro punto importante a destacar en cuanto las muestras de ChIP-Seq efectuado con
protoplastos de maíz, es la variación de la cantidad de lecturas obtenidas entre los
anticuerpos usados (anti91 y antiGFP), ya que probablemente en el caso de
ZmZIM91_anti91 el hecho de que la librería tuviera un banda de contaminación de 123
pares (contaminación por adaptadores), interfirió con la secuenciación de los
fragmentos de interés y en cambio favoreció la lectura de secuencias sobre-
representadas que correspondían a adaptadores. En el momento de realización de estas
librerías, debido a que la técnica del ChIP-Seq proveniente de protoplastos de maíz
estaba en construcción y puesta a punto, no fueron descontaminadas, sin embargo como
actualmente la contaminación por adaptadores ha sido detectada como uno de los
principales problemas en la obtención de la baja cantidad de lecturas que alinean con los
genomas, para elaboración de las librerías de ChIP tanto de hojas de maíz como las
réplicas biológicas restantes de ChIP-Seq efectuado a partir de protoplastos de maíz, fue
usada la tecnología de AMPure Beads, que permite eliminar la contaminación por
adaptadores, lo que aumenta la calidad de las librerías.
Datos proporcionados por esta investigación, así como trabajos previos realizados por
Fornalé et al. (2006, 2010) y Sonbol et al. (2009), sugieren que ZmZIM91, ZmMYB31
y ZmMYB42, pueden tener papeles y mecanismos similares de regulación. Además de
137
Capítulo II
138
Capítulo II
Tanto el promotor del gen ZmCOMT como el promotor del gen ZmA1, posee elementos
GATA y ACII. Un análisis a nivel filogenético más detallado sobre la conservación de
las cajas GATA (motivo de unión de ZmZIM91) y ACII (Motivo de unión de
ZmMYB31) en el promotor del gen de COMT en las gramíneas, permitió determinar
que el módulo regulador putativo compuesto por ZmZIM91/ZmMYB31o
ZmZIM91/ZmMYB42 está evolutivamente conservado. La elaboración de un serial
ChIP de ZmZIM91/ZmMYB31 o ZmZIM91/ZmMYB42, podría ser útil para demostrar
la existencia del módulo regulador propuesto en esta investigación.
139
Capítulo II
140
Conclusiones
Conclusiones
5. Conclusiones
6. Las secuencias GATC y GATA fueron identificadas como los motivos de unión
a ADN tanto in vitro como in vivo de la proteína ZmZIM91.
142
Materiales y Métodos
Materiales y métodos
6. Materiales y métodos
Medio Luria-Bertoni (LB): 10 g/l triptona, 5 g/l extracto de levadura, 10 g/l NaCl.
Ajustar el pH a 7,5 con NaOH. Para preparar medio LB sólido, añadir 15 g/l agar.
Autoclavar.
Medio Yeast Extract Broth (YEB): 5 g/l extracto de carne, 1 g/l extracto de levadura,
5 g/l peptona, 0,5% sacarosa, 2 mM MgSO4. Ajustar el pH a 7,5 con NaOH. Para
preparar medio YEB sólido, añadir 15 g/l agar. Autoclavar.
144
Materiales y métodos
6.2.1 Plásmidos
Los plásmidos usados en esta tesis se presentan a continuación en la siguiente tabla 6-1:
145
Materiales y métodos
dominio BD
146
Materiales y métodos
híbrido;
dominio BD
6.2.2 Construcciones
Las construcciones utilizadas en el presente trabajo se listan en la tabla 6-2 junto con
sus dianas de clonaje y la región.
147
Materiales y métodos
148
Materiales y métodos
HÍBRIDO
149
Materiales y métodos
150
Materiales y métodos
6.2.3 Cebadores.
Tabla 6-3. Cebadores de ADN usados para realizar los clones en este estudio.
151
Materiales y métodos
En la Tabla 6-4, se muestran los cebadores utilizados para realizar la PCR semi-
cuantitativa de ChIP de protoplastos de maíz:
Nombre del cebador Secuencia cebador Forward (5´-3´) Secuencia cebador Reverse (5´-3´)
ICVB ChIP2009_Pico 1 CAAGACGTTCAACAACTGC AACCGACATCTCCGGGTCGT
ICVB ChIP2009_Pico 2 TGGACTCGTCAAAATCAGGACAGC TGCTGCGTGCGGTGCAGAATCC
ICVB ChIP2009_Pico 3 TACAAGCTAGAGCGCGTGGC TACTGCAGTTCGGTATTACA
ICVB ChIP2009_Pico 4 GGAGGAAACCAAGAAAGAA ACCTGTCCCAAACGGCCTA
ICVB ChIP2009_Pico 5 GCTGACGACAGCCATGCAC ACCCCAGTAGTCCTAGGCA
ICVB ChIP2009_Pico 6 TCAGTCCAGGACAATTAAT CTCTGTGAGGACTGAAGAG
ICVB ChIP2009_Pico 7 CCTACAAACCTTTCAGACA TAGGCCTATTATTGGAATG
ICVB ChIP2009_Pico 8 ATTGTTTGCATATGAGTCG TTTGCCATTTGTTTCTGCG
ICVB ChIP2009_Pico 9 ATTTGCTTTCGTCTCTCTC CAGTTACCAGCATGGTCGA
ICVB ChIP2009_Pico 10 AGGCTTTTTCTACGCAATC ACCGCTATGGTGAATTGGA
ICVB ChIP2009_Pico 11 ACAGCCAATCCACACCTCGCT TTTATGCCTCGAGATCCAA
ICVB ChIP2009_Pico 12 TAGCTCGAGCTATTTGGCT GCAGAAGTGGAACCCTGGG
ICVB ChIP2009_Pico 13 GGCAAGCGATTGTTCCATC GAGCAGCTGTTTTCGTGAT
ICVB ChIP2009_Pico 14 CTGATCCTTACACAACATT CGCTGATCCTCTGTTTTGA
ICVB ChIP2009_Pico 15 TCTGTACTTTCTCCTTTCA CGGAGGGAGGCCTTTATAG
ICVB ChIP2009_Pico 16 TGTTGGGAATACTTTCAGG TGGAGGTGCTCCAGGCTTG
ICVB ChIP2009_Pico 17 GGTGTAGAAACAGACAGCC CGAGCTTGACGCGTCCGCT
ICVB ChIP2009_Pico 18 GCCAGATGCAAAAGAGAACC ATTGCCTGGCTTTGTAGCAC
ICVB ChIP2009_Pico 19 CATGCGATGCGACAGTAGAT GGATTACCATCTCCCGGTCT
ICVB ChIP2009_Pico 20 TCGAATAATGATTGTCTATTG CGTCGTCTCACGTTCGCACGT
ICVB ChIP2009_Pico 21 AACTGGAAGAGAGGTCTTA GTGTTCTCCATTGGTGATT
ICVB ChIP2009_Pico 22 GCTGCCGCCTGCCGACGCG TCCACACAACTAACGGCCC
ICVB ChIP2009_Pico 23 ACCATACCATTCCCACACT CGGTGGACGGAGAGACAGG
ICVB ChIP2009_Pico 24 GCTGTTCATTTCAGACATG TAGCACCGCATTGTAATCT
ICVB ChIP2009_Pico 25 TCTATCCTTCTCGCGTTGG TCAACAGCCACCACCAGAC
ICVB ChIP2009_Pico 26 TGTTTCACTGACTCTTGGG AAGGTGACGCTGAAAAGAA
ICVB ChIP2009_Pico 27 ACTGCTAGAATGTGGCACG TCTTCAATGCTGGGCGCTC
ICVB ChIP2009_Pico 28 ATAAGGAGGACGAAGTTGG GGATCTGGAACCCTGCAAA
ICVB ChIP2009_Pico 29 GGTCTGCAGCATCCACGGC TGGGCGTGCGGGTGGGTGC
ICVB ChIP2009_Pico 30 GCGCGGGGCTTACGTGTTC ATCATCACCCTCATCCCCC
ICVB ChIP2009_Pico 31 GCCCAGTGCTGAAGCTTAC TTTCTTCGTCGTGAAGCTT
ICVB ChIP2009_Pico 32 CGTCTTCACCGCCTCGCCT CGGGTATATAGCCGTTGCC
ICVB ChIP2009_Pico 33 TGAGATCACGCTGTCACCA TGCGCGTGATGCGGTGGAG
ICVB ChIP2009_Pico 34 ACGTAGAACTGCCACTGACG TTCTCACTGACCGACTGACG
ICVB ChIP2009_Pico 35 TCGAGATGATGCAGCTTTTG GTTCATTCATCCGAGGAAGC
ICVB ChIP2009_Pico 36 ACTCTGGACGCTTGTTTGCT GTGTCACTCAGGGTCCGTCT
ICVB ChIP2009_Pico 37 ACAGACTTGGGCAATCCATC TGGTTGCTCGAGAACTGTTG
ICVB ChIP2009_Pico 38 GGCTTCCAGCTTCTCTCTGA CTGCTGGTGACCTGAATCAA
ICVB ChIP2009_Pico 39 AGGGTCAACTCAAACCGTTG CAAACGTTGTCTCGGTCAAA
ICVB ChIP2009_Pico 40 CACAAGCAGACGTGTCCAGT CATGCATTTGGAACAGTTGG
ICVB ChIP2009_Pico 41 GGTGTGGGGATTTTGAGTTG CCAAATTCACGCCGAATC
ICVB ChIP2009_Pico 42 GAAGACAAGGCGGAGTTCTG AATTTAGCACGACGGGTTTG
ICVB ChIP2009_Pico 43 GTGGTGGTCGGGTCGAGT CTGGGTAGCCCAGTTCCAC
ICVB ChIP2009_Pico 44 ATATCCGAATGCGAGAGCAG GGAACACTGTGCTGCCTGTA
ICVB ChIP2009_Pico 45 TGCACCAAGACAGACGGATA CCGGATTGTTTGTTGTCCTT
ICVB ChIP2009_Pico 46 CCTTCGAAATCGACAGCAC AACCACATCGCACTGGTTTT
ICVB ChIP2009_Pico 47 AAACAAGTCACCCGAACGAC TCAAGAAAACCGAACCCAAC
152
Materiales y métodos
En la Tabla 6-5, se muestran los cebadores utilizados para realizar la PCR cuantitativa
de ChIP de protoplastos de maíz:
Nombre del cebador Secuencia cebador Forward (5´-3´) Secuencia cebador Reverse (5´-3´)
ICVB ChIP-QPCR_Pico 4 CCATGTAGCGGTGTAAGGG GGGACCAGACATTAGGAACC
ICVB ChIP-QPCR_Pico 7 TAAAGCCTTCTCGAGCCTCT TATCACATGTGCAGGACCAA
ICVB ChIP-QPCR_Pico 8 CAAATTGAATTGGCACCTTG TCAAATGAGAGACCAAAGTCAGA
ICVB ChIP-QPCR_Pico 10 CCTCTAGCCATTGGCAATTT GTCTGTGACCGATTGTTTGG
ICVB ChIP-QPCR_Pico 11 CCCTTCGGCTTATTATACGTG TGCCGATTCTGTAATTATGCTT
ICVB ChIP-QPCR_Pico 12 GGTGGAAACAAAGACAGGAGA GCTCAAGTTTACAGCTTTGCC
ICVB ChIP-QPCR_Pico 14 GCTCTGATATTAGGGCAGATCA GCACATTTGCTATGGCTTGT
ICVB ChIP-QPCR_Pico 15 TAGGGTTATCTGGGCCAAAC CTGCTGCTGCAGTCCTAGAG
ICVB ChIP-QPCR_Pico 16 AACAGTTACTTCGCCAACCC TGTTGAACCGAGGAGGCTAT
ICVB ChIP-QPCR_Pico 17 CATCTCGCACGTCGATAAGT TTCAGATTCCGAAACGACAG
ICVB ChIP-QPCR_Pico 20 AGTCAGTACCTAATCTGCATCCAC CACGTGGACGAGTTGCTAAG
ICVB ChIP-QPCR_Pico 21 GGATCTTAGTTAGATTTGTAGTGCGT CTGGGCATAGGCAAGACAC
ICVB ChIP-QPCR_Pico 23 GCCATACTGTCTCAGACCCA GGAAACGCACGAAGCTAAAT
ICVB ChIP-QPCR_Pico 24 GCCGATCTAGAAGCTACCCA GTGCATGCCAATCAGAGTGT
ICVB ChIP-QPCR_Pico 26 CAGGTGCATATGTTGAGCGT GTGATTCAAACGCGAGAAGA
ICVB ChIP-QPCR_Pico 28 TTGTAAAGTTGAAGCCCATTTG TCTCGTCGCCCTTTATTTCT
ICVB ChIP-QPCR_Pico 29 GCGAACGGCACGATTTAT CTGCTGTGCCTGTGCTGTA
ICVB ChIP-QPCR_Pico 34 CTATGCGACATCATGCGTTT CATCGGCACGTGAGATTC
ICVB ChIP-QPCR_Pico 35 TGGAACCCAGTACGCAATAA AGGAAGCGAGTTGGTCCTAA
ICVB ChIP-QPCR_Pico 36 GACGGCCACAAGTCAGAAA GTCCGTCTTGCTTTGCTTC
ICVB ChIP-QPCR_Pico 37 CTAGATGGCTGGATGCAGAA AGTTCCTTGGATGGTTGCTC
ICVB ChIP-QPCR_Pico 39 GGTGGCTGACCTGACTAGACT CCTACGGAACTACGGAAGGA
ICVB ChIP-QPCR_Pico 40 AAGGGCTTAGAGGTGACCAA TGGGATAGAGTGATGATGTGC
ICVB ChIP-QPCR_Pico 41 GTTGAAAGAGGAGGGATTGG CCGCGTCGCCTTTATTAT
ICVB ChIP-QPCR_Pico 42 AAACCAGCCCATAAATCCAG GCCGAAGTTCAAGAGAGGAG
ICVB ChIP-QPCR_Pico 43 TTCGCTTGGAGCTTTCTTCT GCCCAAATCTATACTGGGTAGC
ICVB ChIP-QPCR_Pico 44 ACAAGATTCGTCCTCGGAAC TGGAGGGCATTGTCATTGT
ICVB ChIP-QPCR_Pico 45 CCATTAATGAAGGCCGAGAG CGGATTGTTTGTTGTCCTTG
ICVB ChIP-QPCR_Pico 46 CCTTCGAAATCGACAGCAC TTGTCACCATCATGATCAACTC
ICVB ChIP-QPCR_Pico 47 GGATCGGAAGCTGACAGTG CACGAGGGTCCAAGTCATC
Copia-qPCR CGATGTGAAGACAGCATTCCT CTCAAGTGACATCCCATGTGT
Tabla 6-5. Cebadores utilizados para la validación por PCR cuantitativa de los
picos identificados en el ChIP-Seq proveniente de protoplastos de maíz.
153
Materiales y métodos
En la Tabla 6-6, se muestran los cebadores utilizados para realizar la PCR cuantitativa
de ChIP de hojas de plantas de maíz de 9 días:
Nombre del cebador Secuencia cebador Forward (5´-3´) Secuencia cebador Reverse (5´-3´)
COMT qPCR TCACGCAAACCTAACGCATA TATGCGCGCACTAATTCAAG
KM_qPCR_A1pr ox-A1 AGGAGCTCCAGCTAGATGTGTC CTGCAACTACCGGCATATCTCT
ICVB ChIP-QPCR_Pico 14 GCTCTGATATTAGGGCAGATCA GCACATTTGCTATGGCTTGT
Copia-qPCR CGATGTGAAGACAGCATTCCT CTCAAGTGACATCCCATGTGT
KM_qPCR_Bz1 prox-A1 CATACGGCACAGGTTTAGTCAC GATTGTCACGGGATCTGGTCTA
ZmActin TTTAAGGCTGCTGTACTGCTGTAGA CACTTTCTGCTCATGGTTTAAGG
ZmCOMT3’-UTR TCTGCGTCGAATTGTCTCTGC GAGAGCAATTAAACCGCCATGT
Tabla 6-6. Cebadores utilizados para la validación por PCR cuantitativa de los
picos identificados en el ChIP-Seq proveniente de hojas de plantas de maíz.
6.3 Métodos
154
Materiales y métodos
155
Materiales y métodos
minutos a 2000 rpm. Las células se resuspenden en 200 µl de medio YEB Rif-
antibiótico correspondiente al vector usado. Las placas son incubadas a 28°C protegidas
de la luz, durante 2 días aproximadamente (hasta la aparición de colonias). Luego, se
seleccionan algunas colonias y se inoculan en 3 ml de medio YEB suplementado con
los antibióticos correspondientes. Y finalmente se crecen los cultivos hasta saturación a
28°C y con agitación.
Para la obtención de ADN plasmídico, se sigue el protocolo del kit comercial Plasmid
Mini Kit (QIAGEN®). Asimismo, para obtener mayores cantidades de ADN plasmídico
se elaboraron MaxiPreps con el QIAGEN® Plasmid Purification Kit, usando el
protocolo propuesto por la casa comercial (Ver Handbook QIAGEN Plasmid Midi,
Maxi, Mega, and Giga Kits. For purification of ultrapure plasmid DNA).
Las enzimas ADN polimerasa termoestables empleadas fueron las comerciales Pfu DNA
Polymerase (Stratagene) y Ex TaqTM Polymerase (Takara), todas ellas con una baja
tasa de error (HF, high fidelity). Para el clonaje de fragmentos se utilizaron ambas Taq
combinadas y para la comprobación de insertos de interés en colonias se usó
únicamente la Takara.
Debido a que la secuencia de ADN de ZmZIM91 tiene un alto contenido de GC, la PCR
para la obtención del clon presentaba bandas inespecíficas (Figura 6-1A). Para solventar
dicho problema, se realizó un experimento utilizando diferentes cantidades de Betaina y
DMSO (Figura 6-1B) (Henke, 1997) y se determinó que las condiciones 1 donde se usó
DMSO al 5% eran las óptimas ya que se obtuvo una banda específica.
156
Materiales y métodos
A Marcador B Marcador
de peso de peso
molecular PCRs sin DMSO/Betaina molecular PCRs con DMSO/Betaina
1 2 3 4 5 1 2 3 4 5
1092pb
ZmZIM91
Figura 6-1. Puesta a punto de condiciones óptimas de PCR para la obtención del
clon de ZmZIM91. En (A) se observan bandas inespecíficas en las direntes PCRs
realizadas sin DMSO y sin Betaina, usando oligos específicos para la obtención del clon
completo de ZmZIM91. Para la amplificación de ZmZIM91 se utilizaron diferentes
cDNAS: 1. Raíz control, 2. Hoja control, 3. Hoja sequía, 4. Raíz sequía y 5. Hoja NaCl.
En (B) se muestran diferentes condiciones de PCRs usando oligos específicos para la
obtención del clon completo de ZmZIM91 y DMSO y/o Betaina. En todos los casos fue
utilizado cDNA de Hoja control. Las diferentes condiciones fueron: 1. DMSO 5%, 2.
DMSO 10%, 3. Betaina 1M, 4. Betaina 2M y 5. Betaina 2M+DMSO 5%.
Las condiciones generales para realizar la PCR se muestran a continuación (Tablas 6-7
y 6-8), aunque para cada caso en particular se modificó la temperatura de
emparejamiento (unos 2-5ºC por debajo de la Tm del cebador con la Tm más baja), el
tiempo de extensión (las ADN polimerasas incorporan aproximadamente 1 kb/min) o el
número de ciclos para optimizar la amplificación. El volumen de reacción utilizado fue
en la mayoría de casos de 50 µl.
PCR MIX
cDNA molde 1 µl
dNTPs 4 µl
Buffer 10X 5 µl
Pfu 0,5 µl
H2O Hasta 50 µl
157
Materiales y métodos
(1) El número de ciclos de amplificación depende del tipo de PCR: para comprobar la
presencia de un inserto normalmente es de 30 ciclos y para clonar fragmentos de ADN es de
30 ciclos, y en el caso de análisis de expresión por RT-PCR de 25.
(2) En general, se ha utilizado una temperatura 2ºC inferior a la Tm del cebador con Tm
más baja.
(3) Depende de longitud del fragmento; la Taq incorpora 1Kb/min.
Para cargar el ADN y el ARN en el gel se añade tampón colorante de carga en el gel. La
migración se realiza, normalmente, a un voltaje constante de 100 Voltios en 1X TAE.
158
Materiales y métodos
Soluciones:
• Tampón de carga 10X: 0,25% azul de bromofenol, 0,25% xileno cianol, 50% glicerol,
10 mM EDTA pH 8.
Para la extracción de fragmentos de ADN desde gel de agarosa, tras la migración de los
mismos, se ha utilizado el kit QIAquick® Gel Extraction Kit (QIAGEN), según las
indicaciones del fabricante. Una vez purificados, los productos de PCR en el caso de los
vectores de clonaje con enzimas de restricción, fueron ligados siguiendo las
instrucciones de la casa comercial. En el caso de los fragmentos de ADN digeridos, las
ligaciones se realizaron en un volumen de 10 µl y una unidad de enzima T4 ligasa
(Roche). Por regla general, la proporción de ADN de inserto y vector empleada fue de
3:1. Las reacciones se incubaron a 4ºC durante 14 horas.
Para los clones que fueron hechos utilizando vectores de tecnología Gateway de
Invitrogen, las reacciones fueron llevadas a cabo con BP en el caso de un vector de
entrada o con LR en caso de un vector de destino, siguiendo el protocolo proporcionado
por Invitrogen.
El material vegetal usado para la extracción de ARN, fueron plántulas de Zea Mays de
la variedad W64+/+ de 6 días de germinación, crecidas en rollo de papel y cámara de
159
Materiales y métodos
Para la elaboración del cDNA se usaron las muestras de ARN obtenidas como se indica
en el apartado anterior y el Kit QuantiTect® Reverse Transcription, siguiendo el
protocolo de QIAGEN (Handbook For cDNA synthesis with integrated removal of
genomic DNA contamination. For use in real-time two-step RT-PCR).
El material conformado por grupos de 12 hojas debe ser cortado cuidadosamente con
cuchillas quirúrgicas y sobre una superficie de vidrio para evitar causar herida ya que
160
Materiales y métodos
reduce la eficiencia de obtención de protoplastos. Las finas capas del material vegetal
cortado, se colocan en un erlenmeyer con la solución enzimática, posteriormente se les
aplica vacío durante 15 minutos. El erlenmeyer con el material vegetal se pone en
agitación a 50 rpm, durante 2.5 horas en oscuridad, luego para liberar los protoplastos se
aumentan las revoluciones por minuto a 90 durante 30 minutos más. Los protoplastos
son filtrados a través de un filtro de 35um de poro y lavados con 10 ml de buffer A. A
continuación se da un spin a 1000 rpm por 2 minutos y se remueve el sobrenadante
cuidadosamente para no tocar el pellet (protoplastos) dejando 1 ml de buffer A. Se lavan
con 10 ml de buffer A, se resuspenden delicadamente, de nuevo se llevan a la centrifuga
a 1000 rpm por 2 minutos y se repite el lavado una vez más. La transformación de los
protoplastos se realiza mediante electroporación de la siguiente forma: se adiciona 20
µg de ADN y buffer A a las cubetas de electroporar de 2mm (150ul en total), se mezcla
el ADN con el buffer A y luego se adiciona 150 µl de protoplastos (1-2x105), se mezcla
con cuidado y posteriormente se electroporan a 0.15V, con dos pulsos a 200 UF. Los
protoplastos electroporados se recuperan de la cubeta con 700 µl de buffer A y se
transfieren a nuevo tubo. Por último, las muestras deben ser guardadas durante 14 horas
a temperatura ambiente, en oscuridad y en posición horizontal.
Reactivos:
161
Materiales y métodos
Para realizar la precipitación del ADN, las partículas de oro preparadas anteriormente
son sonicadas durante 15 segundos antes de ser utilizadas, a continuación se agitan con
vórtex las partículas (20 µl), y se añaden al mismo tiempo (todo en frío y en agitación):
1,5 µg/µl de DNA (en un total de aproximadamente 10 µl), 50 µl CaCl2 2.5 M, 20 µl
espermidina 0,1 M, este paso se realiza durante 10 minutos, posteriormente las muestras
se incuban 15 min en hielo, luego se da un spin de centrifuga, se descarta el
sobrenadante y se añade 250 µl de EtOH HPLC frío. Las muestras se agitan
manualmente de 3-5 minutos. Posteriormente se realiza un spin de centrifuga 15
segundos a 5000 rpm y se descarta el sobrenadante. A continuación se añade 120 µl de
EtOH HPLC frío y se incuban las muestras hasta el momento de bombardear. Sobre la
membrana utilizada para el bombardeo, se colocan 10 µl de las partículas de oro que
contienen el ADN y la membrana se deja secar de 5-10 minutos. Las epidermis de
cebolla son bombardeadas con el PDS1000/He, realizando dos disparos por cada placa
Petri, girando la placa 90º entre cada disparo. Y finalmente la epidermis bombardeada
es incubada en oscuridad a 22-24 ºC durante 16-24 horas.
162
Materiales y métodos
163
Materiales y métodos
producción de las proteínas en la fracción soluble más que en los cuerpos de inclusión)
y se deja crecer de 3-5 horas a 37ºC en agitación a 250 rpm. Se centrifuga el cultivo a
6500 rpm durante 15 min a 4ºC, se recoge el pellet bacteriano y se guarda a -20 ºC para
su posterior purificación.
La proteína de interés se expresa como una proteína de fusión con el marcador His-Tag
en su extremo N-terminal. Este marcador interacciona con el NiSO4 presente en la
resina con la que se purifica la proteína, que se eluye con una solución que contiene
imidazol, el cual disrupciona la interacción anterior. Se utiliza una columna Poly-Prep®
Chromatography (BioRad) equilibrada con la resina comercial Chelating Sepharose
Fast Flow (Amersham Biosciences) cargada con iones Ni2+. Los pasos para equilibrar la
columna son los siguientes: Se añade 500 µl de resina Chelating Sepharose Fast Flow a
la columna, posteriormente se lava la columna con 10 ml de agua destilada y se pasan
20 ml de Charger buffer 1X en dos pasos de 10 ml cada uno, luego se pasan 10 ml de
binding buffer para quitar el exceso de níquel de la columna y finalmente se pasa la
muestra por la columna. Para la elución de la muestra, se lava la columna con 5 ml de
wash buffer a 20 mM, 40 mM, 60 mM, 100 mM, 200 mM, 300 mM, 400 mM y 500
mM de imidazol, se recogen las fracciones y se realiza un gel SDS-PAGE que se tiñe
con Coomassie blue para detectar la fracción que contiene la mayor concentración de
proteína y la mayor pureza. Todos los pasos se realizan a 4ºC.
164
Materiales y métodos
165
Materiales y métodos
166
Materiales y métodos
con 2 ml de 0.1 M glicina-HCl (pH 2.5), para remover las moléculas no unidas
covalentemente. La resina se lava dos veces con 10 ml TBS (50 mM Tris pH 7.5; 150
mM NaCl). Posteriormente, se adiciona el anticuerpo de ZmZIM91 a la resina que tiene
unida la proteína ZmZIM91 fusionada a la GST. Después de 4 horas de mezcla
continua a 4°C, se realiza un spin de la resina (500g, 2 minutos, 4°C), se descarta el
sobrenadante, y se lava la resina cinco veces, durante 5 minutos cada vez, con 10 ml de
TBS frío, seguido por dos lavados con 1 ml de 0.1x TBS. Los anticuerpos específicos se
eluyen incubando la resina durante 5 minutos con 0.5 ml de 0.1 M glicina-HCl (pH 2.5).
El pH del anticuerpo eluído purificado se debe ajustar a 7 con 2 M Tris-HCl.
Para los tratamientos de MeJA y MeJA +MG132, fue usada la base de la hoja 2 de
plantas de 9 días de la línea homocigótica B73 (4 cm a partir de la base de la hoja,
donde según datos de RNA-Seq, habían mayores niveles de expresión de ZmZIM91 (Li
et al., 2010)), crecidas bajo un fotoperiodo de 16 horas de luz a 28°C y 8 horas de
oscuridad a 28°C, con un porcentaje de humedad del 60-70%. En cada caso se hicieron
3 réplicas biológicas usando grupos de 3 plantas para cada una.
Los tratamientos de las plantas de maíz con MeJA fueron realizados como se indica a
continuación: Se esparce sobre las hojas de las plantas de maíz 0,01% de MeJA diluido
en agua destilada (inicialmente el MeJA se diluye en DMSO hasta una concentración
del 10%), con ayuda de un spray, de igual manera se llevan a cabo los tratamientos con
el control con DMSO diluido en agua destilada.
En el caso de los tratamientos de plantas de maíz con MeJA +MG132, se siguieron los
mismos pasos que para los tratamientos con MeJA. Los tratamientos fueron hechos con
0,01% de MeJA mezclado con 100 µM de MG132 y diluidos en agua destilada. Para el
control se usa DMSO diluido en agua destilada.
167
Materiales y métodos
Soluciones:
168
Materiales y métodos
• Poliacrilamida (SDS-PAGE)
Una vez finalizada la electroforesis, el gel se tiñe con una solución de azul de
Coomassie durante 20 minutos a temperatura ambiente y luego se destiñe con
metanol/acetico/agua (30:10:60), hasta poder ver las bandas de proteínas.
Después de la transferencia, las membranas se tiñen con rojo ponceau para comprobar
la correcta transferencia de las proteínas, para ello las membranas se sumergen en
solución de ponceau durante 1 minuto en agitación suave. Posteriormente, se lavan las
membranas con PBS 1X para quitar el exceso de ponceau y se bloquean con leche
diluída en PBS 1X durante 30 minutos a temperatura ambiente. Después de este
procedimiento las membranas se incuban con el anticuerpo como se explica a
continuación o también se pueden dejar secar y guardar para futuras hibridaciones con
el anticuerpo de interés.
169
Materiales y métodos
Soluciones:
170
Materiales y métodos
Para los ensayos de fosforilación con la proteína quinasa CK2 de maíz, se usó 0,4 µg de
proteína purificada ZmZIM91, adicionando 2 ρmol de subunidad catalítica CK2α sola y
también con 2 ρmol de subunidad CK2β (la quinasa se dejó previamente a temperatura
ambiente por 30 minutos para permitir su reconstitución) en un volumen total de 30 µl
de tampón CK2 (8.9 mM de MgCl2, 0.5 mM EGTA, 27 mM de β-glicerolfosfato, 0.5
mM EDTA, 1 mM DTT, 0.08 mM ATP y 3 µCi [γ33P]-ATP).
Para este ensayo fueron usadas raíces de maíz de 6 días de la variedad W64, tratadas
con sequía y 100 µM de MeJA, además de sus respectivos controles que en el caso del
tratamiento con MeJA eran tratadas con DMSO. Los extractos fueron hechos el mismo
día del experimento para ser usados frescos.
171
Materiales y métodos
Los geles deben prepararse con un espesor de 0,75 mm. Además, es necesario utilizar
un marcador de peso molecular visible que permita controlar la posterior identificación
del tamaño de las proteínas de interés. Las muestras utilizadas para realizar este ensayo
fueron extractos de raíces de plantas de maíz de 6 días tratadas y control.
172
Materiales y métodos
Antes de iniciar la reacción, el gel se lava una vez más con 50 ml de tampón C durante
30 min y temperatura ambiente. Se incuba en 10 ml de tampón C que contiene 25 µM
de ATP y 10 µl de [γ33P]-ATP, durante 1 hora a temperatura ambiente. El [γ33P]-ATP
no unido covalentemente a las proteínas se elimina realizando diez lavados de 30 min
con 500 ml (10x50 ml) de tampón D, en agitación y a temperatura ambiente (hasta
detectar una señal de unas 10-20 cpm). Estos lavados también permiten fijar las
proteínas al gel. Por último, el gel debe secarse y exponerse en una pantalla de
Phosphorimager durante 3 días.
Con el fin de identificar la banda correspondiente a la proteína quinasa CK2 en los geles
de fosforilación in vivo, se utilizó el inhibidor específico de CK2 (DRB). Este
compuesto se debe adicionar en el último lavado con el tampón C, antes de la
incubación con el [γ33P]-ATP, durante 30 minutos a temperatura ambiente.
173
Materiales y métodos
La concetración utilizada de DRB para los experimentos realizados en este trabajo fue
de 50 µM y los geles control fueron incubados con DMSO (dimetil sulfoxido) ya que el
DRB fue diluido en DMSO.
En este trabajao, para clonar en el vector pGBKT7 se utilizaron las dianas EcoRI-SalI,
mientras que para clonar en el vector pGADT7 se usaron EcoRI/SalI o XhoI/SalI
dependiendo del inserto.
174
Materiales y métodos
Procedimiento:
Esta reacción se incuba durante 2 horas a 30ºC. Luego, en un eppendorf de 0,5 ml, se
mezcla 1 µg (aprox.) de proteína recombinante inmovilizada en la resina GSH-sefarosa
con el volumen necesario de resina lavada y resuspendida con TST para obtener 40 µl
de ‘slurry’ al 50%. Posteriormente, se añade al ‘slurry’ 200 µl de tampón de unión, 0,24
µl de 1M de DTT, 3 µl de suero pre-inmune y 3 µl de 100 mM de PSMF y se incuba en
rotación durante 1 hora a 4ºC. A continuación se incorpora 20 µl de reacción TnT a la
175
Materiales y métodos
176
Materiales y métodos
Microarreglo de
ADN
Oligos ssDNA
Extensión oligos in situ
Extracto de
E. coli
ds ADN (Cy5)
Incubación
1. Ab
2. Ab-Cy3
Cuantificación
de la imágen
Todos los experimentos de ChIP tanto de hojas como de protoplastos de maíz fueron
realizados en colaboración con el Dr. Kengo Morohashi y la Dra. Antje Feller,
investigadores post-doctorales en el laboratorio del Dr. Erich Grotewold, Department of
Molecular Genetics, Ohio State University, Columbus, Ohio, USA, siguiendo el
protocolo descrito por Morohashi en el 2007, pero con modificaciones.
177
Materiales y métodos
Los protoplastos preaparados, son resuspendidos en 500 µl de lysis buffer para obtener
el extracto de cromatina, luego a la muestra se le realiza vórtex durante 30 segundos y
posteriormente, se lleva a cabo la fragmentación de la cromatina a un rango de 100–
1,000 bp (~500 bp en promedio) mediante sonicación empleando un Biorupter (UCD-
200TM, Diagenode Inc.) con las siguiente condiciones: 30 sec ON y 30 sec OFF al
nivel de poder H por 30 minutos y se centrifuga el material a 10,000 ×g por 5 minutos a
4°C. Posteriormente, el sobrenadante se incuba con 30 µl de esperma de
salmón/proteína agarosa A durante 4 horas con rotación a 4ºC. La muestra es
centrifugada a 3.000 rpm durante 1 minuto a 4°C.
El sobrenadante es transferido a cinco tubos nuevos con 100 µl cada uno, a los que se
les adiciona el respectivo anticuerpo y se incuban durante aproximadamente 14 horas en
rotación a 4°C. Adicionalmente, se guarda una pequeña cantidad de extracto como
fracción de Input.
178
Materiales y métodos
Al siguiente día, a cada uno de los extractos de protoplastos incubados con los
anticuerpos (100 µl) se les adiciona 40 µl de esperma de salmón ADN/Protein A-
agarose beads (Upstate Biotechnology, Charlottesville, VA) y se continúa con la
incubación durante 4 horas más a 4°C. Luego, las muestras son centrífugadas durante 1
minuto a 3.000 rpm y el sobrenadante es descartado.
Después de la incubación, las beads son lavadas dos veces con 0.5 ml de lysis buffer,
dos veces con LNDET y finalmente dos veces con TE. Las beads lavadas y la fracción
de Input son resuspendidas en elution buffer e incubados durante 14 horas a 65°C para
llevar a cabo el reverse-crosslinking del inmunoprecipitado (para que las proteínas se
degraden y queden solo los fragmentos de ADN que han sido inmunoprecipitados).
Finalmente el ADN del ChIP y el ADN del Input es purificado usando el PCR
Purification kit (Qiagen, Valencia, CA).
Soluciones:
179
Materiales y métodos
A continuación, se lava cada tubo que contiene las Dynabeads dos veces con 500 µl de
lysis buffer, poniendo cada vez los tubos en un soporte magnético durante 30 segundos
y descartando el sobrenadante. Antes de retirar el sobrenadante del último lavado, los
tubos con las Dynabeads se mantienen en el soporte magnético, mientras en tubos
nuevos eppendorf de 1.5 ml se prepara una mezcla de 100 µl blocking buffer con 1 µl
(or 1 µg) de cada anticuerpo (en el caso del antiGFP se adicionaron 0,5 µl y para el
anti91 10 µl). Posteriormente, se transfiere la mezcla del blocking buffer con el
anticuerpo en las Dynabeads lavadas y se incuban durante 14 horas en rotación a 4°C.
Por otra parte, se adiciona 300 µl de blocking buffer sin anticuerpo en el tubo que
contiene los 90 µl de Dynabeads y se incuba durante 14 horas en rotación a 4°C (las
Dynabeads sin anticuerpo serán usadas al día siguiente para la preclearation de las
muestras a usar en las inmunoprecipitaciones).
En este caso el material empleado para la realización de los ChIPs fueron protoplastos
de plantas de maíz etioladas de la variedad MO17xB73 de 13 días. Los protoplastos
fueron aislados y transfectados con 35S::ZmZIM91:GFP y 35S::GFP. Posterior a la
obtención de los protoplastos transformados, se procedió a realizar el crosslinking del
material adicionando 100 µl buffer A (es el mismo que se usa para los protoplastos) que
además debe contener 1 mM de PMSF, 1% de formaldehido y 0.25% de BSA. A
continuación se aplica vacío por 10 minutos, y se añade 2 M de glicina y se continúa
con la incubación en vacío por 5 minutos más. Luego se realizan dos lavados con el
buffer A (1ml), se centrifugan las muestras a 2000 rpm por 2.5 minutos, se retira el
sobrenadante y se guardan los protoplastos a -80°C hasta su uso.
180
Materiales y métodos
Las muestras se resuspenden en 500 µl de lysis buffer para realizar la preparación del
extracto de cromatina, luego se les da un vórtex durante 30 segundos y posteriormente,
se realiza la fragmentación de la cromatina a un rango de 100–1,000 bp (~500 bp en
promedio) mediante sonicación empleando un Biorupter (UCD-200TM, Diagenode
Inc.) con las siguiente condiciones: 30 sec ON y 30 sec OFF al nivel de poder H por 30
minutos y se centrifuga el material a 10,000 ×g por 10 minutos a 4°C. A continuación,
se descarta el blocking buffer sin anticuerpo contenido en el eppendorf con los 90 µl de
Dynabeads, se le adiciona los 500 µl de extracto de cromatina generado anteriormente
y se mantiene en incubación a 4 ºC durante cuatro horas más.
Después de las cuatro horas de la incubación del extracto, los eppendorf que tiene el
blocking buffer con los anticuerpos, y el que contiene los 500 µl del extracto de
cromatina, se colocan en el soporte magnético durante 30 segundos, se descarta el
sobrenadante de los tubos que contienen el blocking buffer con los anticuerpos y se le
adiciona a cada uno, 100 µl del extracto de cromatina que fue incubada el eppendorf con
los 90 µl de Dynabeads. Se debe almacenar 100 µl de la cromatina a 4ºC para generar el
Input. Las Dynabeads con los extractos de cromatina se incuban en rotación durante 14
horas a 4ºC.
181
Materiales y métodos
Soluciones:
A continuación, se lava cada tubo que contiene las Dynabeads dos veces con 500 µl de
lysis buffer, poniendo cada vez los tubos en un soporte magnético durante 30 segundos
y descartando el sobrenadante. Antes de retirar el sobrenadante del último lavado, los
tubos con las Dynabeads se mantienen en el soporte magnético, mientras en tubos
nuevos eppendorf de 1.5 ml se prepara una mezcla de 100 µl blocking buffer con 10 µl
(or 1 µg) de cada anticuerpo (en este caso el anti91). Posteriormente, se transfiere la
mezcla del blocking buffer con el anticuerpo en las Dynabeads lavadas y se incuban
durante 14 horas en rotación a 4°C. Por otra parte, se adiciona 300 µl de blocking buffer
sin anticuerpo en el tubo que contiene los 90 µl de Dynabeads y se incuba durante 14
horas en rotación a 4°C (las Dynabeads sin anticuerpo serán usadas al día siguiente para
la preclearation de las muestras a usar en las inmunoprecipitaciones).
182
Materiales y métodos
El material empleado para la realización de los ChIPs fue la base de la segunda hoja de
plantas de maíz de 9 días. Para cada ChIP se usan cuatro hojas provenientes de plantas
distintas (300 mg), a continuación se realiza el crosslinking del material sumergiéndolo
en 10 ml buffer A, se le aplica vacío por 20 minutos, se le añade 2 M de glicina y se
continúa con el vacío por 10 minutos. El material se lava 6 veces con abundante agua
destilada.
Las muestras se resuspenden en 500 µl de lysis buffer para realizar la preparación del
extracto de cromatina, luego se les da un vórtex durante 30 segundos y posteriormente,
se realiza la fragmentación de la cromatina a un rango de 100–1,000 bp (~500 bp en
promedio) mediante sonicación empleando un Biorupter (UCD-200TM, Diagenode
Inc.) con las siguiente condiciones: 30 sec ON y 30 sec OFF al nivel de poder H por 30
minutos y se centrifuga el material a 10,000 ×g por 10 minutos a 4°C. A continuación,
se descarta el blocking buffer sin anticuerpo contenido en el eppendorf con los 90 µl de
Dynabeads, se le adiciona los 500 µl de extracto de cromatina generado anteriormente
y se mantiene en incubación a 4 ºC durante cuatro horas más.
Después de las cuatro horas de la incubación del extracto, los eppendorf que tiene el
blocking buffer con los anticuerpos, y el que contiene los 500 µl del extracto de
cromatina, se colocan en el soporte magnético durante 30 segundos, se descarta el
sobrenadante de los tubos que contienen el blocking buffer con los anticuerpos y se le
adiciona a cada uno, 100 µl del extracto de cromatina que fue incubada el eppendorf con
los 90 µl de Dynabeads. Se debe almacenar 100 µl de la cromatina a 4ºC para generar el
Input. Las Dynabeads con los extractos de cromatina se incuban en rotación durante 14
horas a 4ºC.
183
Materiales y métodos
(30% de la cromatina inicial). Todas las muestras incluyendo los Input, son incubadas
durante 14 horas a 65ºC para llevar a cabo el "reverse-crosslinking". Por último, el
ADN de las muestras se purifica usando el PCR Purification kit (Qiagen, Valencia,
CA).
Soluciones:
184
Materiales y métodos
Template DNA 1 µl -
Condiciones de PCR:
Por otra parte, la PCR cuantitativa de ChIP de protoplastos de maíz (en tiempo real) fue
realizada usando el iQTM SYBR Green supermix (Bio-Rad, Hercules, CA) en una
reacción de PCR de 10 µl de acuerdo con el protocolo recomendado. Los cebadores se
diseñaron usando el software de GenScript específico para el diseño de cebadores para
PCR cuantitativa en tiempo real. Los cebadores pueden amplificar una zona de 100
pares de bases.
185
Materiales y métodos
Seguida por la determinación de curva de melting. Con todos los experimentos, fueron
usados controles sin ADN y muestras con el Input.
La preparación de las librerías de ChIP de protoplastos de maíz versión 1.0 (Figura 6-3),
se llevó a cabo en colaboración con el Dr. Kengo Morohashi, investigador del
laboratorio del Dr. Erich Grotewold, mientras la construcción de las librerías los ChIP
de protoplastos versión 2.0 (Figura 6-3) y las librerías de ChIP de hojas de maíz (Figura
6-4) fue realizada en el Centre de Recerca en Agrigenòmica (CRAG) en colaboración
con Jorge Enrique Salazar Henao del laboratorio del Dr. David Caparrós-Ruíz del
Departamento de Genética Molecular del CRAG, Barcelona.
Para la construcción de las librerías, fue necesario poner la técnica a punto ya que los
reactivos usados en USA no eran los mismos que se podían adquirir en España, sin
embargo, este experimento se realizó basándose en el protocolo elaborado por el Dr.
Kengo Morohashi ([email protected]).
186
Materiales y métodos
Aislamiento y
transformación de
protoplastos de hojas de Sonicación
plantas etioladas de maíz de muestras
de 13 días Input ZmZIM91GFP I
Input GFP I
Réplica
ZmZIM91_
GFP
Biológica 1: Crosslinking ZmZIM91GFP_AntiGFP
Protoplastos ZmZIM91GFP_Anti91 LIBRERIA
de maíz
GFP
ZmZIM91GFP_
GFP_AntiGFP
n:13. AntiGFP
Adición de GFP_Anti91
solución de
lisado
GFP_AntiGFP
n:13. Adición de
GFP_Anti91
solución de LIBRERIA
lisado GFP_AntiGFP
Input ZmZIM91GFP I
Input GFP I
Réplica
ZmZIM91_
GFP
GFP_AntiGFP
n:13.
Adición de GFP_Anti91
solución de
lisado
187
Materiales y métodos
Hojas de Sonicación
maíz de 9 de muestras
días LIBRERIA
Input I INPUT A:
Réplica I+II+III
Biológica Crosslinking
1: Hojas de ZmZIM91.I
diferentes
plantas n:4.
Trituración
Input II
Réplica
Biológica 2: Crosslinking LIBRERIA
Hojas de ZmZIM91. II ZmZIM91:
diferentes I+II+III
plantas n:4.
Trituración
Input III
Réplica
Biológica 3: Crosslinking
Hojas de ZmZIM91. III
diferentes
plantas n:4.
Trituración
188
Materiales y métodos
Para reparar los finales de los fragmentos de ADN, se diluye la polimerasa ADN klenow
1:5 con agua a una concentración final de U/µl y se prepara la siguiente mix de reacción
en tubos de PCR de 0.2 ml:
~30 µl de ChIP enriquecido de ADN, 5 µl de 10x T4 DNA ligase buffer con 10mM
ATP, 2 µl 10mM dNTP mix, 0.5 µl T4 DNA polimerasa (3U/ µl) (NEB), 0.5 µl
Polimerasa ADN Klenow (NEB) (1U/ µl), 0.5 µl T4 PNK (10U/ µl) (NEB) y agua
libre de DNasas hasta 50 µl.
A continuación para adicionar las bases “A” a los extremos finales 3' de los fragmentos
de ADN se llevo a cabo la preparación de la siguiente reacción:
Para la ligación de los adaptadores a los fragmentos de ADN, se diluye el adapter oligo
mix (15µM) a 1:10 (para una concentración final de 1.5µM) en agua libre de DNasas
para ajustarlo a las pequeñas cantidades de ADN. La T4 DNA ligasa Ultrapura
(Enzymatics, 600U/ µl) se diluye 10 veces con 1x T4 ligase buffer de T4 DNA ligasa
Ultrapura y a continuación se prepara la siguiente reacción:
189
Materiales y métodos
a. 30 segundos a 98ºC
b. 18 ciclos
40 segundos a 98ºC
30 segundos a 65ºC
30 segundos a 72ºC
c. 5 minutos a 72ºC
d. 10ºC α
190
Materiales y métodos
Después de la PCR, las muestras se purifican usando mini Elute QIAGEN purification
Kit, con 12 µl de EB y se realiza un Bioanalyzer de las muestras para verificar la
concentración y la calidad (es importante tener en cuenta que la banda de contaminación
por adaptadores autoligados es de 123 pb).
Para los ensayos de expresión transiente de Luciferasa usando los promotores de los
genes de ZmCOMT y ZmA1, fueron transformados por electroporación protoplastos de
maíz de plantas etioladas de 13 días de la variedad MO17xB73. Este experimento se
realizó de acuerdo con Sainz et al., 1997, con algunas modificaciones.
Todos los plasmidos de ADN fueron purificados usando el Maxi-Prep Kit (Qiagen,
Valencia, CA). Los µg de ADN utilizados en el experimento se presentan a
continuación: 1 µg de regulador, 3 µg del plasmido reportero (pCOMT::Luc; pA1::Luc)
y p35S::GFP (el vector vacío del plasmido). Para el ensayo de expresión transiente de
firefly luciferase y Renilla luciferase (Renilla), fue usado el Dual-Luciferase Reporter
Assay System (Promega, Madison, WI). Para normalizar la actividad de luciferasa en
cada muestra se incluye el reportero Renilla luciferase, 10 µg de p35S::Renilla.
191
Materiales y métodos
For FAST/APPROXIMATE:
K-tuple(word) size:1, Window size:5, Gap Penalty: 3, Number of Top Diagonals: 5,
Scoring Method: PERCENT.
192
Materiales y métodos
For SLOW/ACCURATE:
Gap Open Penalty: 10.0, Gap Extension Penalty: 0.1, Select Weight Matrix: BLOSUM
(for PROTEIN).
Gap Open Penalty:10, Gap Extension Penalty: 0.05, Weight Transition: NO,
Hydrophilic Gaps:YES, Select Weight Matrix: BLOSUM (for PROTEIN)
193
Materiales y métodos
194
Materiales y métodos
Donde el Grupo 1 (G1) corresponde a los datos del ChIP control con DMSO y el Grupo
2 (G2) es el grupo experimental en este caso los datos obtenidos del ChIP de MeJA al
0,01%.
Los datos de firefly luciferasa fueron normalizaron empleando los valores obtenidos con
Renilla luciferasa, los datos muestran 3 réplicas biológicas con 3 réplicas técnicas
(n=9). Renilla estaba en un vector que se empleó como control de la transformación
(Dual-luciferase reporter assay system kit, Promega, Madison, WI).
Para la identificación de los motivos de unión a ADN GATA y GATC (Tabla 6-10), se
empleó el software DNA-pattern (http://rsat.ulb.ac.be//) (Thomas-Chollier, 2008).
195
Materiales y métodos
196
Bibliografía
Bibliografía
7. Bibliografía
Aasland, R., Stewart, A.F., Gibson, T. (1996) The SANT domain: a putative DNA-
binding domain in the SWI-SNF and ADA complexes, the transcriptional co-
repressor N-CoR and TFIIIB. Trends in biochemical sciences, 21, 87-8.
Abe, H., Yamaguchi-Shinozaki, K., Urao, T., Iwasaki, T., Hosokawa, D., and
Shinozaki, K. (1997) Role of Arabidopsis MYC and MYB homologs in
drought- and abscisic acidregulated gene expression. Plant Cell, 9, 1859-1868.
Agarwal, M., Hao, Y., Kapoor, A., Dong, C.H., Fujii, H., Zheng, X., and Zhu, J.K.
(2006) A R2R3 type MYB transcription factor is involved in the cold regulation
of CBF genes and in acquired freezing tolerance. J Biol Chem., 281, 37636-
37645.
Achuo, E.A, Prinsen, E., Hofte, M. (2006) Influence of drought, salt stress and
abscisic acid on the resistance of tomato to Botrytis cinerea and Oidium
neolycopersici. Plant Pathology, 55, 178–186.
Ascencio- Ibáñez, J.T., Sozzani, R., Lee, T.J., Chu, T.M., Wolfinger, R.D., Cella, R.
and Hanley-Bowdoin, L. (2008) Global analysis of Arabidopsis gene
expression uncovers a complex array of changes impacting pathogen response
and cell cycle during geminivirus infection. Plant Physiol., 148, 436–454.
Ashby, A.M., Watson, M.D., Loake, G.J., and Shaw, C.H. (1988) Ti plasmid-
specified chemotaxis of Agrobacterium tumefaciens C58C1 toward vir-inducing
phenolic compounds and soluble factors from monocotyledonous and
dicotyledonous plants. J Bacteriol., 170, 4181–4187.
Asselbergh, B., De Vieesschauwer, D., and Hofte, M. (2008) Global switches and
fine-tuning-ABA modulates plant pathogen defense. Molecular Plant-Microbe
Interactions, 21, 709-719.
Atkinson, N.J. and Urwin, P.E. (2012) The interaction of plant biotic and abiotic
stresses: from genes to the field. Journal of Experimental Botany, 63, 3523-
3543.
Austin, M.J., Muskett, P., Kahn, K., Feys, B.J., Jones, J.D.G., and Parker, J.E.
(2002) Regulatory role of SGT1 in early R gene-mediated plant defenses.
Science, 295, 2077-2080.
Ausubel, F.M., Brent, R., Kingston, R.E., Moore, D.D., Seidman, J.G., Smith, J.A.
and Struhl, K. (1989) Current Protocols in Molecular Biology. (Greene and
Wiley-lnterscience, NY, USA).
198
Bibliografía
Azevedo, C., Sadanandom, A., Kitagawa, K., Freialdenhoven, A., Shirasu, K., and
Schulze-Lefert, P. (2002) The RAR1 interactor SGT1, an essential component
of R gene-triggered disease resistance. Science, 295, 2073-2076.
Bai, Y., Meng, Y., Huang, D., Qi, Y., and Chen, M. (2011) Origin and evolutionary
analysis of the plant-specific TIFY transcription factor family. Genomics, 98,
128–136.
Bailey, P.C., Martin, C., Toledo-Ortiz, G., Quail, P.H., Huq, E., Heim, M.A.,
Jakoby, M., Werber, M., and Weisshaar, B. (2003) Update on the basic helix-
loop-helix transcription factor gene family in Arabidopsis thaliana. Plant Cell,
15, 2497-2502.
Balkunde, R., Pesch, M., and Hu¨ lskamp, M. (2010) Trichome patterning in
Arabidopsis thaliana: From genetic to molecular models. In Plant Development,
Current Topics in Developmental Biology, Vol. 91, M.C.P. Timmermans, ed
(Amsterdam: Elsevier), pp. 299–321.
Baldwin, A.L., Baldwin, C.P., and Cole, R. (1990) Stress-resistant families and stress-
resistant children. In: Rolf J, Masten A, Cicchetti D, Nuechterlein K, Weintraub
S, editors. Risk and protective factors in the development of psychopathology.
Cambridge University Press, 257–280.
Ballesteros, M.L., Bolle, C., Lois, L.M., Moore, J.M., Vielle-Calzada, J-P,
Grossniklaus, U., and Chua, N-H. (2001) LAF1, a MYB transcription
activator for phytochrome A signaling. Genes & Dev., 15, 2613-2625.
Bari, R., and Jones, J.D.G. (2009) Role of plant hormones in plant defence responses.
Plant Mol. Biol., 69, 473–488.
Barozzi, I., Termanini, A., Minucci, S., and Natoli, G. (2011) Fish the ChIPs: a
pipeline for automated genomic annotation of ChIP-Seq data. Biology Direct, 6,
1-7.
Bar-Peled, M., and Raikhel, N.V. (1996) A method for isolation and purification of
specific antibodies to a protein fused to the GST. Anal Biochem., 241, 140-142.
Barski, A., Cuddapah, S., Cui, K., Roh, T.Y., Schones, D.E., Wang, Z., Wei, G.,
Chepelev, I., Zhao, K. (2007) High-resolution profiling of histone methylations
in the human genome. Cell, 129, 823-837.
Beattie, G.A. (2011) Water relations in the interaction of foliar bacterial pathogens with
plants. Annual Review of Phytopathology, 49, 533–555.
199
Bibliografía
Benedetti, C.E., Xie, D., and Turner, J.G. (1995) COI1-dependent expression of an
Arabidopsis vegetative storage protein in flowers and siliques and in response to
coronatine or methyl jasmonate. Plant Physiol., 109, 567-572.
Bhuiyan, N.H. et al. (2009) Gene expression profiling and silencing reveal that
monolignol biosynthesis plays a critical role in penetration defence in wheat
against powdery mildew invasion. J. Exp. Bot., 60, 509–521.
Borevitz, J.O., Xia, Y., Blount, J., Dixon, R.A., and Lamb, C. (2000) Activation
tagging identifies a conserved MYB regulator of phenylpropanoid biosynthesis.
Plant Cell, 12, 2383–2394.
Boter, M., Ruiz-Rivero, O., Abdeen, A., and Prat, S. (2004) Conserved MYC
transcription factors play a key role in jasmonate signaling both in tomato and
Arabidopsis. Genes Dev., 18, 1577-1591.
Bout, S., and Vermerris, W. (2003) A candidate-gene approach to clone the sorghum
Brown midrib gene encoding caffeic acid O-methyltransferase. Mol Genet
Genomics, 269, 205-214.
Boyer, J.S. (1982) Plant productivity and the environment. Science, 218, 443–448.
Bradford, M.M. (1976) A rapid and sensitive method for the quantitation of microgram
quantities of protein utilizing the principle of protein-dye binding. Analytical
Biochemistry, 72, 248-254.
Braun, E.L., and Grotewold, E. (1999) Newly discovered plant c-myb-like genes
rewrite the evolution of the plant myb gene family. Plant Physiol., 121, 21-24.
Brown, R.L., Kazan, K., McGrath, K.C., Maclean, D.J., and Manners, J.M. (2003)
A role for the GCCboxin jasmonate-mediated activation of the PDF1.2 gene of
Arabidopsis. Plant Physiol., 132, 1020-1032.
200
Bibliografía
Browse, J. (2009) Jasmonate passes muster: A receptor and targets for the defense
hormone. Annu. Rev. Plant Biol., 60, 183–205.
Browse, J. (2009) The power of mutants for investigating jasmonate biosynthesis and
signaling. Phytochemistry, 70, 1539–1546.
Buck, M.J., and Lieb, J.D. (2004) ChIP-chip: considerations for the design, analysis,
and application of genome-wide chromatin immunoprecipitation experiments.
Genomics Mar, 83(3), 349-60.
Burr, F.A., Burr, B., Scheffler, B.E., Blewitt, M., Wienand, U., and Matz, E.C.
(1996) The maize repressor-like gene intensifier1 shares homology with the
r1/b1 multigene family of transcription factors and exhibits missplicing. Plant
Cell, 8, 1249-1259.
Buxton D.R., Martin G.C. (1989) Forage quality of plant parts of perennial grasses
and relationship to phenology. Crop Sci., 29, 429–435.
Buxton D.R., Russell J.R. (1988) Lignin constituents and cell-wall digestability of
grass and legume stems. Crop Sci., 28, 553–558.
Chang, C-J, Chen, T-T, Lei, H-Y, Chen, D-S, Lee, S-C. (1990) Molecular cloning of
a transcription factor, AGP/EBP, that belongs to members of the C/EBP family.
Mol Cell Biol., 10, 6642-6653.
Chen, M., Chory, J. and Fankhauser, C. (2004) Light signal transduction in higher
plants. Annu. Rev. Genet., 38, 87–117.
Cheong, Y.H., Chang, H.-S., Gupta, R., Wang, X., Zhu, T., and Luan, S. (2002)
Transcriptional profiling reveals novel interactions between wounding,
pathogen, abiotic stress, and hormonal responses in Arabidopsis. Plant Physiol.,
129, 661-677.
Chesson, A., Stewart, C.S., Dalgarno, K., King, T.P. (1986) Degradation of isolated
grass mesophyll, epidermis and fibre cell walls in the rumen and by cellulolytic
rumen bacteria in axenic culture. J. Appl. Bacteriol., 60, 327–336.
Chini, A., Fonseca, S., Fernández, G., Adie, B., Chico, J.M., Lorenzo, O., García-
Casado, G., López-Vidriero, I., Lozano, F.M., Ponce, M.R., Micol, J.L., and
Solano, R. (2007) The JAZ family of repressors is the missing link in jasmonate
signalling. Nature, 448, 666-671.
Chini, A., Fonseca, S., Chico, J.M., Fernández-Calvo, P., and Solano, R. (2009) The
ZIM domain mediates homo- and heteromeric interactions between Arabidopsis
JAZ proteins. Plant J., 59, 77–87.
Chini, A., Boter, M., and Solano, R. (2009) Plant oxylipins: COI1/JAZs/MYC2 as the
core jasmonic acid-signalling module. FEBS J., 276, 4682–4692.
201
Bibliografía
Chinnusamy, V., Schumaker, K., Zhu, J.K. (2004) Molecular genetic perspectives on
cross-talk and specificity in abiotic stress signalling in plants. J Exp Bot., 55,
225–236
Chung, H.S., Koo, A.J.K., Gao, X., Jayanty, S., Thines, B., Jones, A.D., and Howe,
G.A. (2008) Regulation and Function of Arabidopsis JASMONATE ZIM-
Domain Genes in Response to Wounding and Herbivory. Plant Physiology, 146,
952–964.
Chung, H.S., Niu, Y., Browse, J., and Howe, G.A. (2009) Top hits in contemporary
JAZ: an update on jasmonate signaling. Phytochemistry, 70, 1547–1559.
Chung, H.S., and Howe, G.A. (2009) A critical role for the TIFY motif in repression
of jasmonate signaling by a stabilized splice variant of the JASMONATE ZIM-
domain protein JAZ10 in Arabidopsis. Plant Cell, 21, 131–145.
Chung, H.S., Cooke, T.F., Depew, C.L., Patel, L.C., Ogawa, N., Kobayashi, Y., and
Howe, G.A. (2010) Alternative splicing expands the repertoire of dominant JAZ
repressors of jasmonate signaling. Plant J., 63, 613–622.
Chung, H.S., Niu, Y., Browse, J., and Howe, G.A. (2009) Top hits in contemporary
JAZ: An update on jasmonate signaling. Phytochemistry, 70, 1547–1559.
Cramer, G.R., Urano, K., Delrot, S., Pezzotti, M. and Shinozaki, K. (2011) Effects
of abiotic stress on plants: a systems biology perspective. BMC Plant Biology,
11:163.
Creelman, R.A. and Mullet, J.E. (1997) Biosynthesis and action of jasmonates in
plants. Annu. Rev. Plant Physiol. Plant Mol. Biol., 48, 355-381.
Creelman, R.A., and Mulpuri, R. (2002) The oxylipin pathway in Arabidopsis. The
Arabidopsis Book, eds., C.R. Somerville and E.M. Meyerowitz, American
Society of Plant Biologists, Rockville, MD, pp 1-24, doi/10.1199/tab.0012,
http://www.aspb.org/publications/Arabidopsis/
Cressman, D.E, O’Connor, W.J., Greer, S.F., Zhu, X-S, and Ting, J.P-Y. (2001)
Mechanisms of Nuclear Import and Export That Control the Subcellular
Localization of Class II Transactivator. The Journal of Immunology, 167, 3626-
3634.
Crossley, M., Merika, M., and Orkin, S.H. (1995) Self-Association of the Erythroid
Transcription Factor GATA-1 Mediated by Its Zinc Finger Domains. Molecular
and Cellular Biology, 2448–2456.
Davuluri, R.V., Sun, H., Palaniswamy, S.K., Matthews, N., Molina, C., Kurtz, M.,
and Grotewold, E. (2003) AGRIS: Arabidopsis gene regulatory information
server, an information resource of Arabidopsis cis-regulatory elements and
transcription factors. BMC Bioinformatics, 4, 25.
202
Bibliografía
De Sutter, V., Vanderhaeghen, R., Tilleman, S., Lammertyn, F., Vanhoutte, I.,
Karimi, M., Inze, D.,Goossens, A ., and Hilson, P. (2005) Exploration of
jasmonate signalling via automated and standardized transient expression assays
in tobacco cells. Plant J., 44, 1065-1076.
Deeks, M.J., and Hussey, P.J. (2009) Plant Actin Biology. eLS. DOI:
10.1002/9780470015902.a0021255.
del Pozo, J.C., Dharmasiri, S., Hellmann, H., Walker, L., Gray, W.M., and Estelle,
M. (2002) AXR1-ECR1-dependent conjugation of RUB1 to the Arabidopsis
cullin AtCUL1 is required for auxin response. Plant Cell, 14, 421-433.
Deluc, L., Barrieu, F., Marchive, C., Lauvergeat, V., Decendit, A., Richard, T.,
Carde, J.P., Merillon, J.M., and Hamdi, S. (2006) Characterization of a
grapevine R2R3-MYB transcription factor that regulates the phenylpropanoid
pathway. Plant Physiol., 140, 499-511.
Demianski, A.J., Chung, K.M., and Kunkel, B.N. (2011) Analysis of Arabidopsis
JAZ gene expression during Pseudomonas syringae pathogenesis. Mol. Plant
Pathol., 13, 46-57.
Devoto, A., Nieto-Rostro, M., Xie, D., Ellis, C., Harmston, R., Patrick, E., Davis, J.,
Sherratt, L., Coleman, M., and Turner, J.G. (2002) COI1 links jasmonate
signalling and fertility to the SCF ubiquitin-ligase complex in Arabidopsis. Plant
J., 32, 457-466.
Dias, A.P., Braun, E.L., McMullen, M.D., and Grotewold, E. (2003) Recently
duplicated maize R2R3 Myb genes provide evidence for distinct mechanisms of
evolutionary divergence after duplication. Plant Physiol., 131, 610-620.
203
Bibliografía
Dievart, A. and Clark, S.E. (2003) Using mutant alleles to determine the structure and
function of leucine-rich repeat receptor-like kinases. Curr. Opin. Plant Biol., 6,
507–516.
Ding, J., Hu, H., and Li, X. (2011) Thousands of cis-regulatory sequence combinations
are shared by Arabidopsis and Poplar. Plant Physiology,
DOI:10.1104/pp.111.186080.
Doi, K., Hosaka, A., Nagata, T., Satoh, K., Suzuki, K., Mauleon, R., Mendoza,
M.J., Bruskiewich, R., and Kikuchi, S. (2008) Development of a novel data
mining tool to find cis-elements in rice gene promoter regions. BMC Plant Biol.,
8, 20.
Dombrecht, B., Xue, G.P., Sprague, S.J., Kirkegaard, J.A., Ross, J.J., Reid, J.B.,
Fitt, G.P., Sewelam, N., Schenk, P.M., Manners, J.M., and Kazan, K. (2007)
MYC2 differentially modulates diverse jasmonate-dependent functions in
Arabidopsis. Plant Cell, 19, 2225–2245.
Dubos, C., Stracke, R., Grotewold, E., Weisshaar, B., Martin, C., and Lepiniec, L.
(2010) MYB transcription factors in Arabidopsis. Trends Plant Sci., 15, 573–
581.
Ehlting, J., Mattheus, N., Aeschliman, D.S., Li, E., Hamberger, B., Cullis, I.F.,
Zhuang, J., Kaneda, M., Mansfield, S.D., Samuels, L., et al. (2005) Global
transcript profiling of primary stems from Arabidopsis thaliana identifies
candidate genes for missing links in lignin biosynthesis and transcriptional
regulators of fiber differentiation. Plant J., 42, 618-640.
Ellis, C., Karafyllidis, I., and Turner, J.G. (2002) Constitutive activation of
jasmonate signaling in an Arabidopsis mutant correlates with enhanced
resistance to Erysiphe cichoracearum, Pseudomonas syringae, and Myzus
persicae. Mol. Plant Microbe Interact., 15, 1025-1030.
EscamillaTreviño L.L., Shen H., Uppalapati S.R., Ray T., Tang Y., Hernandez T.,
Yin Y., Xu Y., Dixon R.A. (2010) Switchgrass (Panicum virgatum) possesses a
divergent family of cinnamoyl CoA reductases with distinct biochemical
properties. New Phytol., 185, 143–155.
Etheridge, N., Chen, Y.F. and Schaller, G.E. (2005) Dissecting the ethylene pathway
of Arabidopsis. Brief Funct. Genomic. Proteomic., 3, 372–381.
Fan, L.M., Zhao, Z. and Assmann, S.M. (2004) Guard cells: a dynamic signaling
model. Curr. Opin. Plant Biol., 7, 537–546.
204
Bibliografía
Feller, A., Machemer, K., Braun, E.L., and Grotewold, E. (2011) Evolutionary and
comparative analysis of MYB and bHLH plant transcription factors, Plant J., 66,
94–116.
Feng, S., Ma,L., Wang, X., Xie, D., Dinesh-Kumar, S.P., Wei, N., and Deng, X.W.
(2003) The COP9 signalosome interacts physically with SCFCOI1 and
modulates jasmonate responses. Plant Cell, 15, 1083-1094.
Feys, B., Benedetti, C.E., Penfold, C.N., and Turner, J.G. (1994) Arabidopsis
mutants selected for resistance to the phytotoxin coronatine are male sterile,
insensitive to methyl jasmonate, and resistant to a bacterial pathogen. Plant Cell,
6, 751–759.
Filhol, O., Martiel, J.L., Cochet, C. (2004) Protein Kinase CK2: a new view of an old
molecular complex. EMBO reports, 5, 351-355.
Fonseca, S., Chico, J.M., and Solano, R. (2009). The jasmonate pathway: The ligand,
the receptor and the core signalling module. Curr. Opin. Plant Biol., 12, 539–
547.
Fonseca, S., Chini, A., Hamberg, M., Adie, B., Porzel, A., Kramell, R., Miersch, O.,
Wasternack, C., and Solano, R. (2009) (+)-7-iso- Jasmonoyl-L-isoleucine is
the endogenous bioactive jasmonate. Nat. Chem. Biol., 5, 344–350.
Fornalé, S., Sonbol, F.M., Maes, T., Capellades, M., Puigdomenech, P., Rigau, J.,
and Caparros-Ruiz, D. (2006) Down-regulation of the maize and Arabidopsis
thaliana caffeic acid O-methyl-transferase genes by two new maize R2R3-MYB
transcription factors. Plant Mol Biol., 62, 809-823.
Fornalé, S., Shi, X., Chai, C., Encina, A., Irar, S., Capellades, M., Fuguet, E.,
Torres, J.L., Rovira, P., Puigdomenech, P., et al. (2010) ZmMYB31 directly
represses maize lignin genes and redirects the phenylpropanoid metabolic flux.
Plant J., 64, 633-644.
Franken, P., Schrell, S., Peterson, P.A., Saedler, H., and Wienand, U. (1994)
Molecular analysis of protein domain function encoded by the myb-homologous
maize genes C1, Zm 1 and Zm 38. Plant J., 6, 21-30.
205
Bibliografía
Fu, C., Mielenz, J.R., Xiao, X., Ge, Y., Hamilton, C.Y., Rodriguez, M., Jr., Chen,
F., Foston, M., Ragauskas, A., Bouton, J., et al. (2011) Genetic manipulation
of lignin reduces recalcitrance and improves ethanol production from
switchgrass. Proc Natl Acad Sci U S A.
Fujimoto, S.Y., Ohta, M., Usui, A., Shinshi, H., and Ohme-Takagi, M. (2000)
Arabidopsis ethyleneresponsive element binding factors act as transcriptional
activators or repressors of GCC boxmediated gene expression. Plant Cell, 12,
393-404.
Galaxy. [http://main.g2.bx.psu.edu/].
Gao, F., Foat, B.C., and Bussemaker, H.J. (2004) Defining transcriptional networks
through integrative modeling of mRNA expression and transcription factor
binding data. BMC Bioinformatics, 5, 31.
Geerinck, J., Pauwels, L., De Jaeger, G., and Goossens, A. (2010) Dissection of the
one-MegaDalton JAZ1 protein complex. Plant Signal. Behav., 5, 1039–1041.
Gfeller, A., Liechti, R., and Farmer, E.E. (2010) Arabidopsis jasmonate signaling
pathway. Sci. Signal., 3: cm4.
Giri AP, Wunsche H, Mitra S, Zavala JA, Muck A, et al. (2006) Molecular
interactions between the specialist herbivore Manduca sexta (Lepidoptera,
Sphingidae) and its natural host Nicotiana attenuata. VII. Changes in the plant’s
proteome. Plant Physiol. 142,1621–41.
Godoy, M., Franco-Zorrilla, J.M., Pérez-Pérez, J., Liveros, J.C., Lorenzo, O., and
Solano, R. (2011) Improved protein-binding microarrays for the identification
of DNA-binding specificities of transcription factors. The Plant Journal, 66,
700–711.
Goecks, J., Nekrutenko, A., and Taylor, J. (2010) Galaxy: a comprehensive approach
for supporting accessible, reproducible, and transparent computational research
in the life sciences. Genome Biol., 11, R86.
Goel, A.K, Lundberg, D., Torres, M.A., Matthews, R., Akimoto-Tomiyama, C.,
Farmer, L., Dangl, J.L., Grant, S.R. (2008) The Pseudomonas syringae type
III effector HopAM1 enhances virulenceon water-stressed plants. Molecular
Plant-Microbe Interactions, 21, 361–370.
Goff, S.A., Cone, K.C., and Fromm, M.E. (1991) Identification of functional domains
in the maize transcriptional activator C1: comparison of wild-type and dominant
inhibitor proteins. Genes Dev., 5, 298-309.
Goff, S.A., Cone, K.C., and Chandler, V.L. (1992) Functional analysis of the
transcriptional activator encoded by the maize B gene: evidence for a direct
206
Bibliografía
Gonzalez, A., Zhao, M., Leavitt, J.M., and Lloyd, A.M. (2008) Regulation of the
anthocyanin biosynthetic pathway by the TTG1/bHLH/ Myb transcriptional
complex in Arabidopsis seedlings. Plant J., 53, 814–827.
Grabber J.H., Jung G.A., Abrams S.M., Howard D.B. (1992) Digestion kinetics of
parenchyma and sclerenchyma cell walls isolated from orchardgrass and
switchgrass. Crop Sci., 32, 806–810.
Grand C., Parmentier P., Boudet A., Boudet A.M. (1985) Comparison of lignins and
of enzymes involved in lignification in normal and brown midrib (bm3) mutant
maize seedlings. Physiol. Veg., 23, 905–911.
Grant, M.R., and Jones, J.D.G. (2009) Hormone (dis)harmony moulds plant health
and disease. Science, 324, 750–752.
Gray, W.M., Muskett, P.R., Chuang, H.W., and Parker, J.E. (2003) Arabidopsis
SGT1b is required for SCFTIR1-mediated auxin response. Plant Cell, 15, 1310-
1319.
Grotewold, E., Drummond, B.J., Bowen, B., and Peterson, T. (1994) The
mybhomologous P gene controls phlobaphene pigmentation in maize floral
organs by directly activating a flavonoid biosynthetic gene subset. Cell, 76, 543-
553.
Grotewold, E., Chamberlin, M., Snook, M., Siame, B., Butler, L., Swenson, J.,
Maddock, S., St Clair, G., and Bowen, B. (1998) Engineering secondary
metabolism in maize cells by ectopic expression of transcription factors. Plant
Cell, 10, 721-740.
Grunewald, W., Vanholme, B., Pauwels, L., Plovie, E., Inze´, D., Gheysen, G., and
Goossens, A. (2009) Expression of the Arabidopsis jasmonate signalling
repressor JAZ1/TIFY10A is stimulated by auxin. EMBO Rep., 10, 923–928.
Guerineau, F., Benjdia, M., and Zhou, D.X. (2003) A jasmonate-responsive element
within the A. thaliana vsp1 promoter. J. Exp. Bot., 54, 1153-1162.
Guillaumie, S., Pichon, M., Martinant, J.-P., Bosio, M., Goffner, D., and Barriere,
Y. (2007a) Differential expression of phenylpropanoid and related genes in
207
Bibliografía
brown-midrib bm1, bm2, bm3, and bm4 young near-isogenic maize plants.
Planta, 226, 235-250.
Guillaumie, S., Pichon, M., Martinant, J.P., Bosio, M., Goffner, D., and Barriere,
Y. (2007b) Differential expression of phenylpropanoid and related genes in
brown-midrib bm1, bm2, bm3, and bm4 young near-isogenic maize plants.
Planta, 226, 235-250.
Guillaumie, S., Goffner, D., Barbier, O., Martinant, J.P., Pichon, M., and Barriere,
Y. (2008) Expression of cell wall related genes in basal and ear internodes of
silking brownmidrib- 3, caffeic acid O-methyltransferase (COMT) down-
regulated, and normal maize plants. BMC Plant Biol., 8, 71.
He, A., Kong, S.W., Ma, Q., and Pu, W.T. (2011) Co-occupancy by multiple cardiac
transcription factors identifies transcriptional enhancers active in heart. Proc
Natl Acad Sci., 108, 5632–5637.
He, Q., Bardet, A.F., Patton, B., Purvis, J., Johnston, J., Paulson, A., Gogol, M.,
Stark, A., and Zeitlinger, J. (2011) High conservation of transcription factor
binding and evidence for combinatorial regulation across six Drosophila species.
Nat Genet., 43, 414–420.
Heinz, S., Benner, C., Spann, N., Bertolino, E., Lin, Y.C., Laslo, P., Cheng, J.X.,
Murre, C., Singh, H., and Glass, C.K. (2010) Simple combinations of lineage-
determining transcription factors prime cis-regulatory elements required for
macrophage and B cell identities. Mol Cell., 38, 576–589.
Henke W, Herdel K, Jung K, Schnorr D and Loening S.A. (1997) Betaine improves
the PCR amplification of GC-rich DNA sequences. Nucleic Acids Research, 25,
3957–3958.
Herms DA, Mattson WJ. (1992) The dilemma of plants: to grow or defend. Q. Rev.
Biol. 67, 283–335.
Hidalgo, P., Garreton, V., Berrios, C.G., Ojeda, H., Jordana, X., Holuigue, L.
(2001) A Nuclear Casein Kinase 2 Activity Is Involved in Early Events of
Transcriptional Activation Induced by Salicylic Acid in Tobacco. Plant Physiol,
125, 396–405.
Howe, G.A., and Jander, G. (2008) Plant immunity to insect herbivores. Annu Rev
Plant Biol, 59,41–66.
208
Bibliografía
Ishida, T., Kurata, T., Okada, K., and Wada, T. (2008) A genetic regulatory network
in the development of trichomes and root hairs. Annu. Rev. Plant Biol., 59, 365–
386.
Jiang, C. and Pugh, B.F. (2009) Nucleosome positioning and gene regulation:
advances through genomics. Nat Genet, 10, 161-172.
Johnson, D.S., Mortazavi, A., Myers, R.M., and Wold, B. (2007) Genome-wide
mapping of in vivo protein-DNA interactions. Science, 316, 1497-1502.
Jothi, R., Cuddapah, S., Barski, A., Cui, K., and Zhao, K. (2008) Genome-wide
identification of in vivo protein-DNA binding sites from ChIP-Seq data. Nucleic
Acids Res., 36, 5221-5231.
Jung H.G. (1989) Forage lignins and their effects on fiber digestibility. Agron.
J., 81, 33–38.
Jung H.G., Vogel , K.P. (1986) Influence of Lignin on Digestibility of Forage Cell
Wall Material. J. Anim. Sci., 62, 1703–1712.
Kagale, S., Rozwadowski, K. (2010) Small yet effective: The Ethylene responsive
element binding factor-associated Amphiphilic Repression (EAR) motif. Plant
Signal Behav., 5, 691-4.
Kanhonou, R., Serrano, R., Ros Palau, R. (2001) A catalytic subunit of the sugar beet
protein kinase CK2 is induced by salt stress and increases NaCl tolerance in
Saccharomyces cerevisiae. Plant Mol Biol, 47, 571–579.
Katou, S., Yoshioka, H., Kawakita, K., Rowland, O., Jones, J.D.G., Mori, H., and
Doke, N. (2005) Involvement of PPS3 phosphorylated by elicitor-responsive
mitogen-activated protein kinases in the regulation of plant cell death. Plant
Physiol., 139, 1914–1926.
Katsir, L., Chung, H.S., Koo, A.J.K., and Howe, G.A. (2008) Jasmonate signaling: A
conserved mechanism of hormone sensing. Curr. Opin. Plant Biol., 11, 428–
435.
Katsir, L., Schilmiller, A.L., Staswick, P.E., He, S.Y., and Howe, G.A. (2008) COI1
is a critical component of a receptor for jasmonate and the bacterial virulence
factor coronatine. Proc. Natl. Acad. Sci. USA, 105, 7100–7105.
Kaufmann, K., Muino, J.M., Jauregui, R., Airoldi, C.A., Smaczniak, C.,
Krajewski, P., and Angenent, G.C. (2009) Target genes of the MADS
209
Bibliografía
Kazan, K., and Manners, J.M. (2008) Jasmonate signaling: Toward an integrated
view. Plant Physiol., 146, 1459–1468.
Kepinski, S. and Leyser, O. (2005) The Arabidopsis F-box protein TIR1 is an auxin
receptor. Nature, 435, 446-451.
Kharchenko, P.V., Tolstorukov, M.Y., and Park, P.J. (2008) Design and analysis of
ChIP-seq experiments for DNA-binding proteins. Nat Biotech., 26, 1351-1359.
Kidder, B.L., Hu, G., and Zhao, K. (2011) ChIP-Seq: technical considerations for
obtaining high-quality data. Nature Immunology, 12, 918-922.
Kim, S.R., Choi, J.L., Costa, M.A., and An, G. (1992) Identification of G-box
sequence as an essential element for methyl jasmonate response of potato
proteinase inhibitor II promoter. Plant Physiol., 99, 627-631.
Kim, S.R., Kim, Y., and An, G. (1993) Identification of methyl jasmonate and
salicylic acid response elements from the nopaline synthase (nos) promoter.
Plant Physiol., 103, 97-103.
Koo, A.J.K., Howe, G.A. (2009) The wound hormone jasmonate. Phytochemistry, 70,
1571-1580.
Koroleva, O.A., Tomlinson, M., Parinyapong, P., Sakvarelidze, L., Leader, D.,
Shaw, P. and Doonan, J.H. (2004) CycD1, a putative G1 cyclin from
Antirrhinum majus, accelerates the cell cycle in cultured tobacco BY-2 cells by
enhancing both G1/S entry and progression through S and G2 phases. Plant
Cell, 16, 2364–2379.
Kunkel, B.N. and Brooks, D.M. (2002) Cross talk between signaling pathways in
pathogen defense. Curr. Opin. Plant Biol., 5, 325-331.
Lackman, P., González-Guzmán, M., Tilleman, S., Carqueijeiro, I., Cuéllar Pérez,
A., Moses, T., Seoh, M., Kannoh, Y., Häkkinen, S.T., Van Montagud,
M.C.E., Theveleinf, J.M., Maaheimoa, H., Oksman-Caldenteya, K-M.,
Rodriguez, P.L., Rischer, H. and Goossens, A. (2011) Jasmonate signaling
involves the abscisic acid receptor PYL4 to regulate metabolic reprogramming
in Arabidopsis and tobacco. Proc. Natl. Acad. Sci. USA, 108, 5891-5896.
210
Bibliografía
Lamond, A.I., Spector, D.L. (2003) Nuclear speckles: A model for nuclear organelles.
Nat Rev Mol Cell Biol., 4, 605–612.
Landt, S.G., Marinov, G.K., Kundaje, A., Kheradpour, P., Pauli, F., Batzoglou, S.,
Bernstein, B.E., Bickel, P., Brown, J.B., Cayting, P., Chen, Y., DeSalvo, G.,
Epstein, C. et. al. (2012) ChIP-seq guidelines and practices of the ENCODE
and modENCODE consortia. Cold Spring Harbor Laboratory Press, 22, 1813–
1831.
Langmead, B., Trapnell, C., Pop, M., and Salzberg, S.L. (2009) Ultrafast and
memoryefficient alignment of short DNA sequences to the human genome.
Genome Biol., 10, R25.
Lee, T.I., Rinaldi, N.J., Robert, F., Odom, D.T., Bar-Joseph, Z., Gerber, G.K.,
Hannett, N.M., Harbison, C.T., Thompson, C.M., Simon, I., et al. (2002)
Transcriptional regulatory networks in Saccharomyces cerevisiae. Science, 298,
799-804.
Lehnert, S., Götz, C., Kartarius, S., Schäfer, B., Montenarh, M. (2008) "Protein
kinase CK2 interacts with the splicing factor hPrp3p." Oncogene, 27(17), 2390-
2400.
Li, P., Ponnala, L., Gandotra, N., Wang, L., Si, Y., Tausta, S.L., Kebrom, T.H.,
Provart, N., Patel, R., Myers, C.R., et al. (2010) The developmental dynamics
of the maize leaf transcriptome. Nat Genet., 42, 1060-1067.
Lin, W-J, and Sheu, G-T. (1994) Traugh JA: Effects of autophosphorylation on casein
kinase II activity: Evidence from mutations in the β subunit. Biochemistry, 33,
6998–7004.
Litchfield DW (2003) Protein kinase CK2: structure, regulation and role in cellular
decisions of life and death. Biochem J., 369, 1–15.
Liu, Y., Schiff, M., Serino, G., Deng, X.W., and Dinesh-Kumar, S.P. (2002) Role of
SCF ubiquitinligase and the COP9 signalosome in the N gene-mediated
resistance response to tobacco mosaic virus. Plant Cell, 14, 1483-1496.
Liu, T., Ortiz, J.A., Taing, L., Meyer, C.A., Lee, B., Zhang, Y., Shin, H., Wong,
S.S., Ma, J., Lei, Y., Pape, U.J., Poidinger, M., Chen, Y., Yeung, K., Brown,
M., Turpaz, Y., and Liu, X.S. (2011) Cistrome: an integrative platform for
transcriptional regulation studies. Genome Biology, 12:R83.
Lobell, D.B., Schlenker, W., Costa-Roberts, J. (2011) Climate Trends and Global
Crop Production Since 1980. Science, 333, 616-620.
211
Bibliografía
Lowry, J.A., and Atchley, W.R. (2000) Molecular evolution of the GATA family of
transcription factors: conservation within the DNA-binding domain. J Mol Evol.,
50,103–115.
Iyer VR, Horak CE, Scafe CS, Botstein D, Snyder M, Brown PO. (2001) Genomic
binding sites of the yeast cell-cycle transcription factors SBF and MBF. Nature,
409, 533-538.
Mahalingam, R., Gomez-Buitrago, A., Eckardt, N., Shah, N., Guevara-Garcia, A.,
Day, P., Raina, R., and Fedoroff, N.V. (2003) Characterizing the
stress/defense transcriptome of Arabidopsis. Genome Biol., 4, R20.
Malone, B.M., Tan, F., Bridges, S.M., and Peng, Z. (2011) Comparison of Four
ChIP-Seq Analytical Algorithms Using Rice Endosperm H3K27 Trimethylation
Profiling Data. PLoS ONE, 6, 1-12.
Mandaokar, A., Thines, B., Shin, B., Lange, B.M., Choi, G., Koo, Y.J., Yoo, Y.J.,
Choi, Y.D., Choi, G., and Browse, J. (2006) Transcriptional regulators of
stamen development in Arabidopsis identified by transcriptional profiling. Plant
J., 46, 984–1008.
Mannervik, M., Nibu, Y., Zhang, H., Levine, M. (1999) Transcriptional coregulators
in development. Science, 284(5414), 606-609.
Matys, V., Kel-Margoulis, O.V., Fricke, E., Liebich, I., Land, S., Barre-Dirrie, A.,
Reuter, I., Chekmenev, D., Krull, M., Hornischer, K., Voss, N., Stegmaier,
P., Lewicki- Potapov, B., Saxel, H., Kel, A.E., and Wingender, E. (2006)
TRANSFAC and its module TRANSCompel: transcriptional gene regulation in
eukaryotes. Nucleic Acids Res., 34, 108-110.
212
Bibliografía
McConn, M., Browse, J. (1996) The critical requirement for linolenic acid is pollen
development, not photosynthesis, in an Arabidopsis mutant. Plant Cell, 8, 403–
416
McConn, M., Creelman, R.A., Bell, E., Mullet, J.E., and Browse, J. (1997)
Jasmonate is essential for insect defense in Arabidopsis. Proc. Natl. Acad. Sci.
USA, 94, 5473-5477.
McGrath, K.C., Dombrecht, B., Manners, J.M., Schenk, P.M., Edgar, C.I.,
Maclean, D.J., Scheible, W.R., Udvardi, M.K., and Kazan, K. (2005)
Repressor- and activator-type ethylene response factors functioning in jasmonate
signaling and disease resistance identified via a genome-wide screen of
Arabidopsis transcription factor gene expression. Plant Physiol., 139, 949-959.
Melotto, M., Mecey, C., Niu, Y., Chung, H.S., Katsir, L., et al. (2008) A critical role
of two positively charged amino acids in the Jas motif of Arabidopsis JAZ
proteins in mediating coronatine- and jasmonoyl isoleucine-dependent
interactions with the COI1 F-box protein. Plant J., 55, 979–988.
Menke, F.L.H., Champion, A., Kijne, J.W., and Memelink, J. (1999) A novel
jasmonate- and elicitorresponsive element in the periwinkle secondary
metabolite biosynthetic gene Str interacts with a jasmonate- and elicitor-
inducible AP2-domain transcription factor, ORCA2. EMBO J., 18, 4455-4463.
Mohr, P.G. and Cahill, D.M. (2003) Abscisic acid influences the susceptibility of
Arabidopsis thaliana to Pseudomonas syringae pv. tomato and Peronospora
parasitica. Functional Plant Biology, 30, 461–469.
Mulekar, J.J., Bu, Q., Chen, F., Huq, E. (2012) Casein kinase II alpha subunits affect
multiple developmental and stress-responsive pathways in Arabidopsis. Plant J,
69, 343–354.
Mussig, C., Biesgen, C., Lisso, J., Uwer, U., Weiler, E.W., and Altmann, T. (2000)
A novel stressinducible 12-oxophytodienoate reductase from Arabidopsis
thaliana provides a potential link between brassinosteroid action and jasmonic
acid synthesis. J. Plant Physiol., 157, 143-152.
Myers, R.M., Stamatoyannopoulos, J., Snyder, M., Dunham, I., Hardison, R.C.,
Bernstein, B.E., Gingeras, T.R., Kent, W.J., Birney, E., Wold, B., et al.
(2011) A user’s guide to the encyclopedia of DNA elements (ENCODE). PLoS
Biol., 9: e1001046. doi: 10.1371/journal.pbio.1001046.
Newton, M.A., Kendziorski, C.M., Richmond, C.S., Blattner, F.R., and Tsui, K.W.
(2001) On differential variability of expression ratios: improving stadistical
213
Bibliografía
inference about gene expression changes from microarray data. J. Comput. Biol.,
8, 37-52.
Nieva, C., Busk, P.K., Dominguez-Puigjaner, E., Lumbreras, V., Testillano, P.S.,
Risueno, M.C., Pages, M. (2005) Isolation and functional characterisation of
two new bZIP maize regulators of the ABA responsive gene rab28. Plant Mol
Biol, 58, 899–914.
Nishii, A., Takemura, M., Fujita, H., Shikata, M., Yokota, A., and kohchi, T.
(2000) Characterization of a novel gene encoding a putative single zinc-finger
protein, ZIM, expressed during the reproductive phase in Arabidopsis thaliana.
Biosci. Biotechnol. Biochem., 64, 1402-1409.
Niu, Y., Figueroa, P., and Browse, J. (2011) Characterization of JAZinteracting bHLH
transcription factors that regulate jasmonate responses in Arabidopsis. J. Exp.
Bot., 62, 2143–2154.
Norman-Setterblad, C., Vidal, S., and Palva, E.T. (2000) Interacting signal pathways
control defense gene expression in Arabidopsis in response to cell wall-
degrading enzymes from Erwinia carotovora. Mol.Plant Microbe Interact., 13,
430-438.
Nurnberger, T., Brunner, F., Kemmerling, B. and Piater, L. (2004) Innate immunity
in plants and animals: striking similarities and obvious differences. Immunol.
Rev., 198, 249–266.
Pauwels, L., and Goossens, A. (2008) Fine-tuning of early events in the jasmonate
response. Plant Signal. Behav., 3, 846–847.
Pauwels, L., Inzé, D., Goossens, A. (2009) Jasmonate-inducible gene: What does it
mean?. Trends Plant Sci., 14,87–91.
Pauwels, L. and Goossens, A. (2011) The JAZ proteins: a crucial interface in the
jasmonate signaling cascade. Plant Cell, 23, 3089–3100.
Penning, B.W., Hunter, C.T., 3rd, Tayengwa, R., Eveland, A.L., Dugard, C.K.,
Olek, A.T., Vermerris, W., Koch, K.E., McCarty, D.R., Davis, M.F., et al.
(2009) Genetic resources for maize cell wall biology. Plant Physiol, 151, 1703-
1728.
214
Bibliografía
Pieterse, C. M. J., van Wees, S. C. M., van Pelt, J. A., Knoester, M., Laan, R.,
Gerrits, H., Weisbeek, P. J., and van Loon, L. C. (1998) A novel signaling
pathway controlling induced systemic resistance in Arabidopsis. Plant Cell, 10,
1571-1580.
Piquemal J., Lapierre C., Myton K., O'Connell A., Schuch W., GrimaPettenati J.,
Boudet A.M. (1998) Down-regulation of cinnamoyl-CoA reductase induces
significant changes of lignin profiles in transgenic tobacco plants. Plant J., 13,
71–83.
Plana, M., Itarte, E., Eritja, R., Goday, A., Pages, M., Martinez, M.C. (1991)
Phosphorylation of maize RAB-17 protein by casein kinase 2. J Biol Chem, 266,
22510–22514.
Pooma, W., Gersos, C., and Grotewold, E. (2002) Transposon insertions in the
promoter of the Zea mays a1 gene differentially affect transcription by the Myb
factors P and C1. GENETICS, 161, 793-801.
Priest, H.D., Filichkin, S.A., and Mockler, T.C. (2009) Cis-regulatory elements in
plant cell signaling. Curr Opin Plant Biol., 12, 643-649.
Ptashne, M. (1988) How eukaryotic transcriptional activators work. Nature, 335, 683-
689.
Qi, T. et al. (2011) The jasmonate-ZIM-domain proteins interact with the WD-
repeat/bHLH/MYB complexes to regulate jasmonate-mediated anthocyanin
accumulation and trichome initiation in Arabidopsis thaliana. Plant Cell, 23,
1795–1814.
Quail, M.A., Kozarewa, I., Smith, F., Scally, A., Stephens, P.J., Durbin, R.,
Swerdlow, H., Turner, D.J. (2008) A large genome center's improvements to
the Illumina sequencing system. Nat Methods., 5, 1005-10.
215
Bibliografía
Rabinowicz, P.D., Braun, E.L., Wolfe, A.D., Bowen, B., and Grotewold, E. (1999)
Maize R2R3 Myb genes: Sequence analysis reveals amplification in the higher
plants. GENETICS, 153, 427-444.
Raes, J., Rohde, A., Christensen, J.H., Van de Peer, Y., and Boerjan, W. (2003)
Genome-wide characterization of the lignification toolbox in Arabidopsis. Plant
Physiol, 133, 1051-1071.
Ramsay, N.A., and Glover, B.J. (2005) MYB-bHLH-WD40 protein complex and the
evolution of cellular diversity. Trends Plant Sci, 10, 63-70.
Reguera, M., Peleg, Z., Blumwald, E. (2011) Targeting metabolic pathways for
genetic engineering abiotic stress-tolerance in crops. Biochimica et Biophysica
Acta, 1819, 186-194.
Reyes, R., Haendel, M., Grant, D., Melançon, E., and Eisen, J.S. (2004) Slow
degeneration of zebrafish Rohon-Beard neurons during programmed cell death.
Dev. Dyn., 229, 30-41.
Reymond, P., Weber, H., Damond, M., and Farmer, E.E. (2000) Differential gene
expression in response to mechanical wounding and insect feeding in
Arabidopsis. Plant Cell, 12, 707–719.
Riera, M., Figueras, M., López, C., Goday, A., and Pagès, M. (2004) Protein kinase
CK2 modulates developmental functions of the abscisic acid responsive protein
Rab17 from maize. Proc. Natl. Acad. Sci. USA, 101, 9879-9884.
Riera, M., Irar, S., Vélez-Bermúdez, I.C., Carretero-Paulet, L., Lumbreras, V.,
Pagès, M. (2011) Role of Plant-Specific N-Terminal Domain of Maize CK2β1
Subunit in CK2β Functions and Holoenzyme Regulation. PLoS ONE, 6, 1-7.
Rivas-Astroza, M., Xie, D., Cao, X., and Zhong, S. (2011) Mapping personal
functional data to personal genomes. Oxford University Press.
216
Bibliografía
Rizhsky, L., Liang, H.J., Shuman, J., Shulaev, V., Davletova, S., Mittler, R. (2004)
When defense pathways collide. The response of Arabidopsis to a combination
of drought and heat stress. Plant Physiology, 134, 1683–1696.
Robert-Seilaniantz, A., Grant, M., and Jones, J.D.G. (2011) Hormone crosstalk in
plant disease and defense: More than just JASMONATESALICYLATE
antagonism. Annu. Rev. Phytopathol., 49, 317–343.
Robertson, G., Hirst, M., Bainbridge, M., Bilenky, M., Zhao, Y., Zeng, T.,
Euskirchen, G., Bernier, B., Varhol, R., Delaney, A., et al. (2007) Genome-
wide profiles of STAT1 DNA association using chromatin immunoprecipitation
and massively parallel sequencing. Nat Methods, 4, 651-657.
Rojo, E., Leon, J., and Sanchez-Serrano, J.J. (1999) Cross-talk between wound
signalling pathways determines local versus systemic gene expression in
Arabidopsis thaliana. Plant J., 20, 135-142.
Rolland, F. and Sheen, J. (2005) Sugar sensing and signalling networks in plants.
Biochem. Soc. Trans., 33, 269–271.
Romero, I., Fuertes, A., Benito, M.J., Malpica, J.M., Leyva, A., and Paz-Ares, J.
(1998) More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis
thaliana. Plant J., 14, 273-284.
Roth, B.A., Goff, S.A., Klein, T.M., and Fromm, M.E. (1991) C1- and R-dependent
expression of the maize Bz1 gene requires sequences with homology to
mammalian myb and myc binding sites. Plant Cell, 3, 317-325.
Rouster, J., Leah, R., Mundy, J., and Cameron-Mills, V. (1997) Identification of a
methyl jasmonateresponsive region in the promoter of a lipoxygenase 1 gene
expressed in barley grain. Plant J., 11, 513-523.
Rowland, O., Ludwig, A.A., Merrick, C.J. et al. (2005) Functional analysis of
Avr9/Cf-9 rapidly elicited genes identifies a protein kinase, ACIK1, that is
essential for full Cf-9-dependent disease resistance in tomato. Plant Cell, 17,
295–310.
Sainz, M.B., Grotewold, E., and Chandler, V.L. (1997) Evidence for direct activation
of an anthocyanin promoter by the maize C1 protein and comparison of DNA
binding by related Myb domain proteins. Plant Cell, 9, 611-625.
Sambrook, J., and Russel, D.W. (2001) Molecular cloning: a laboratory manual. (Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA).
217
Bibliografía
Sasaki, Y., Asamizu, E., Shibata, D., Nakamura, Y., Kaneko, T., Awai, K., Amagai,
M., Kuwata, C., Tsugane, T., Masuda, T., Shimada, H., Takamiya, K.-I.,
Ohta, H., and Tabata, S. (2001) Monitoring of methyl jasmonate-responsive
genes in Arabidopsis by cDNA macroarray: self activation of jasmonic acid
biosynthesis and crosstalk with other phytohormone signaling pathways. DNA
Res., 8, 153-161.
Schaller, F., Schaller, A., and Stintzi, A. (2005) Biosynthesis and metabolism of
jasmonates. J. Plant Growth Regul., 23, 179-199.
Schnable, P.S., Ware, D., Fulton, R.S., Stein, J.C., Wei, F., Pasternak, S., Liang, C.,
Zhang, J., Fulton, L., Graves, T.A., et al. (2009) The B73 maize genome:
complexity, diversity, and dynamics. Science, 326, 1112-1115.
Schwechheimer, C., Serino, G., and Deng, X.W. (2002) Multiple ubiquitin ligase-
mediated processes require COP9 signalosome and AXR1 function. Plant Cell,
14, 2553-2563.
Sekhon, R.S., Lin, H., Childs, K.L., Hansey, C.N., Buell, C.R., de Leon, N., and
Kaeppler, S.M. (2011) Genome-wide atlas of transcription during maize
development. Plant J., 66, 553-63.
Seo, H.S., Song, J.T., Cheong, J.J., Lee, Y.H., Lee, Y.W., Hwang, I., Lee, J.S., and
Choi, Y.D. (2001) Jasmonic acid carboxyl methyltransferase: a key enzyme for
jasmonate-regulated plant responses. Proc. Natl. Acad. Sci. USA, 98, 4788-4793.
Serna, L., and Martin, C. (2006) Trichomes: Different regulatory networks lead to
convergent structures. Trends Plant Sci., 11, 274–280.
Shah, J. (2003) The salicylic acid loop in plant defense. Curr. Opin. Plant Biol., 6, 365-
371.
Shan, X., Zhang, Y., Peng, W., Wang, Z., Xie, D. (2009) Molecular mechanism for
jasmonate-induction of anthocyanin accumulation in Arabidopsis. Journal of
experimental botany, 60, 3849-60.
Shikata, M., Takemura, M., Yokota, A., and kohchi, T. (2003) Arabidopsis ZIM, a
plan-specific GATA factor, can function as a transcripcional activator. Biosci.
Biotechnol. Biochem., 67, 2495-2497.
Shikata, M., Matsuda, Y., Ando, K., Nishii, A., Takemura, M., Yokota, A., and
Kohchi, T. (2004) Characterization of Arabidopsis ZIM, a member of a novel
218
Bibliografía
Smale, S.T., Kadonaga, J.T. (2003) The RNA polymerase II core promoter. Annu.
Rev. Biochem.,72, 449–479.
Smith, Z.R., and Long, J.A. (2010) Control of Arabidopsis apical-basal embryo
polarity by antagonistic transcription factors. Nature, 464, 423-426.
Solano, R., Nieto, C., Avila, J., Canas, L., Diaz, I., and Paz-Ares, J. (1995) Dual
DNA binding specificity of a petal epidermis-specific MYB transcription factor
(MYB.Ph3) from Petunia hybrida. EMBO J., 14, 1773-1784.
Solano, R., Stepanova, A., Chao, Q., and Ecker, J.R. (1998) Nuclear events in
ethylene signaling: a transcriptional cascade mediated by ETHYLENE-
INSENSITIVE3 and ETHYLENE-RESPONSEFACTOR1. Genes Dev., 12,
3703-3714.
Solano, R. and Ecker, J.R. (1998) Ethylene gas: perception, signaling and response.
Curr. Opin. Plant Biol., 1, 393-398.
Sonbol, F.M., Fornale, S., Capellades, M., Encina, A., Tourino, S., Torres, J.L.,
Rovira, P., Ruel, K., Puigdomenech, P., Rigau, J., et al. (2009) The maize
ZmMYB42 represses the phenylpropanoid pathway and affects the cell wall
structure, composition and degradability in Arabidopsis thaliana. Plant Mol
Biol., 70, 283-296.
Song, S., Qi, T., Huang, H., Ren, Q., Wu, D., Chang, C., Peng, W., Liu, Y., Peng, J.,
and Xie, D. (2011) The Jasmonate-ZIM domain proteins interact with the
R2R3-MYB transcription factors MYB21 and MYB24 to affect jasmonate-
regulated stamen development in Arabidopsis. Plant Cell, 23, 1000–1013.
Spector, D.L., and Lamond, A.I. (2011) Nuclear Speckles. Cold Spring Harb Perspect
Biol., 3:a000646.
Spitzer-Rimon, B., Marhevka, E., Barkai, O., Marton, I., Edelbaum, O., Masci, T.,
Prathapani, N-K., Shklarman, E., Ovadis, M. and Vainstein, A. (2010)
EOBII, a gene encoding a flower-specific regulator of phenylpropanoid
volatiles’ biosynthesis in petunia. Plant Cell, 22, 1961–1976.
Staswick, P.E., Su, W., and Howell, S.H. (1992) Methyl jasmonate inhibition of root
growth and induction of a leaf protein are decreased in an Arabidopsis thaliana
mutant. Proc. Natl. Acad. Sci. USA, 89, 6837–6840.
219
Bibliografía
Staswick, P.E., Yuen, G.Y., and Lehman, C.C. (1998). Jasmonate signaling mutants
of Arabidopsis are susceptible to the soil fungus Pythium irregulare. Plant
J., 16, 747–754.
Staswick, P.E., Tiryaki, I. (2004) The oxylipin signal jasmonic acid is activated by an
enzyme that conjugates it to isoleucine in Arabidopsis. Plant Cell, 16, 2117–27
Staswick, P.E. (2008) JAZing up jasmonate signaling. Trends in Plant Science, 13,
No.2.
Stracke, R., Ishihara, H., Huep, G., Barsch, A., Mehrtens, F., Niehaus, K., and
Weisshaar, B. (2007) Differential regulation of closely related R2R3-MYB
transcription factors controls flavonol accumulation in different parts of the
Arabidopsis thaliana seedling. Plant J., 50, 660-677.
Stracke, R., Werber, M., and Weisshaar, B. (2001) The R2R3-MYB gene family in
Arabidopsis thaliana. Curr Opin Plant Biol., 4, 447-456.
Tan, X., Calderon-Villalobos, L.I., Sharon, M., Zheng, C., Robinson, C.V., Estelle,
M., and Zheng, N. (2007) Mechanism of auxin perception by the TIR1
ubiquitin ligase. Nature, 446, 640-645.
Tchieu, J.H., Fana, F., Fink, J.L., Harper, J., Nair, T.M., Niedner, R.H., Smith,
D.W., Steube, K., Tam, T.M., Veretnik, S., et al (2003) The PlantsP and
PlantsT functional genomics databases. Nucleic Acids Res., 31, 342–344.
Teige, M., Scheikl, E., Eulgem, T., Doczi, R., Ichimura, K., Shinozaki, K., Dangl,
J.L., Hirt, H. (2004) The MKK2 pathway mediates cold and salt stress
signaling in Arabidopsis. Mol Cell, 15, 141–152.
Thines, B., Katsir, L., Melotto, M., Niu, Y., Mandaokar, A., Liu, G., Nomura, K.,
He, S.Y., Howe, G.A., and Browse, J. (2007) JAZ repressor proteins are targets
of the SCFCOI1 complex during jasmonate signalling. Nature, 448, 661-665.
220
Bibliografía
Ton, J., Flors, V., and Mauch-Mani, B. (2009) The multifaceted role of ABA in
disease resistance. Trends in Plant Science, 14, 310–317.
Tosoni, K., Costa, A., Sarno, S., D’Alessandro, S., Sparla, F., Pinna, L.A., Zottini,
M., Ruzzene, M. (2011) The p23 co-chaperone protein is a novel substrate of
CK2 in Arabidopsis. Mol Cell Biochem, 356, 245–254.
Traw, M.B., and Bergelson, J. (2003) Interactive effects of jasmonic acid, salicylic
acid, and gibberellin on induction of trichomes in Arabidopsis. Plant Physiol.,
133, 1367–1375.
Turner, J.G., Ellis, C., and Devoto, A. (2002) The jasmonate signal pathway. Plant
Cell, 14 Suppl, S153-S164.
Ucar, D., Beyer, A., Parthasarathy, S., and Workman, C.T. (2009) Predicting
functionality of protein-DNA interactions by integrating diverse evidence.
Bioinformatics, 25, i137-144.
Valouev, A., Johnson, D.S., Sundquist, A., Medina, C., Anton, E., Batzoglou, S.,
Myers, R.M., Sidow, A. (2008) Genome-wide analysis of transcription factor
binding sites based on ChIP-Seq data. Nat Methods, 5, 829-834.
Van der Ent, S., Van Wees, S.C.M., and Pieterse, C.M.J. (2009) Jasmonate signaling
in plant interactions with resistance-inducing beneficial microbes.
Phytochemistry, 70, 1581–1588.
Vanholme, B., Grunewald, W., Bateman, A., Kohchi, T., and Gheysen, G. (2007)
The tify family previously known as ZIM. Trends Plant Sci., 12, 239-244.
Vélez-Bermúdez, I., Irar, S., Carretero-Paulet, L., Pagès, M., Riera, M. (2011)
Specific characteristics of CK2B regulatory subunits in plants. Mol Cel
Biochem, 356, 255–260.
Vick, B., and Zimmerman, D.C. (1984) Biosynthesis of jasmonic acid by several plant
species. Plant Physiol., 75, 458-461.
221
Bibliografía
Vignols, F., Rigau, J., Torres, M.A., Capellades, M., and Puigdomenech, P. (1995)
The brown midrib3 (bm3) mutation in maize occurs in the gene encoding caffeic
acid Omethyltransferase. Plant Cell, 7, 407–416.
Vijayan, P., Shockey, J., Lévesque, C.A., Cook, R.J., and Browse, J. (1998) A role
for jasmonate in pathogen defense of Arabidopsis. Proc. Natl. Acad. Sci. USA,
95, 7209-7214.
Wang, C., Xu, J., Zhang, D., Wilson, Z.A., and Zhang, D. (2011) An effective
approach for identification of in vivo protein-DNA binding sites from paired-end
ChIP-Seq data. BMC Bioinformatics, 11:81.
Wang, H.C., Wu, J.S., Chia, J.C., Yang, C.C., Wu, Y.J., Juang, R.H. (2009)
Phytochelatin Synthase Is Regulated by Protein Phosphorylation at a Threonine
Residue Near Its Catalytic Site. J Agric Food Chem, 57, 7348–7355.
Wang, X., Elling, A.A., Li, X., Li, N., Peng, Z., He, G., Sun, H., Qi, Y., Liu, X.S.,
and Deng, X.W. (2009) Genome-wide and organ-specific landscapes of
epigenetic modifications and their relationships to mRNA and small RNA
transcriptomes in maize. Plant Cell, 21, 1053-1069.
Wasternack, C., and Hause, B. (2002) Jasmonates and octadecanoids: Signals in plant
stress responses and development. Prog. Nucleic Acid Res. Mol. Biol., 72, 165-
221.
White, D.W.R. (2006) PEAPOD regulates lamina size and curvature in Arabidopsis.
Proc. Natl. Acad. Sci. USA, 103, 13238–13243.
Wiese, J., Kranz, T., Schubert, S. (2004) Induction of pathogen resistance in barley by
abiotic stress. Plant Biology, 6, 529–536.
Wu, S., Wang, J., Zhao, W., Pounds, S., and Cheng, C. (2010) ChIP-PaM: aRnes
eaarlcghorithm to identify protein-DNA interaction using ChIP-Seq data.
Theoretical Biology and Medical Modelling, 7, 18.
Xie, D.X., Feys, B.F., James, S., Nieto-Rostro, M., and Turner, J.G. (1998) COI1: an
Arabidopsis gene required for jasmonate-regulated defense and fertility. Science,
280, 1091-1094.
Xu, L., Liu, F., Lechner, E., Genschik, P., Crosby, W.L., Ma, H., Peng, W., Huang,
D., and Xie, D. (2002) The SCFCOI1 ubiquitin-ligase complexes are required
for jasmonate response in Arabidopsis. Plant Cell, 14, 1919-1935.
222
Bibliografía
Yan, J., Zhang, C., Gu, M., Bai, Z., Zhang, W., Qi, T., Cheng, Z., Peng, W., Luo,
H., Nan, F., Wang, Z., and Xie, D. (2009) The Arabidopsis CORONATINE
INSENSITIVE1 protein is a jasmonate receptor. Plant Cell, 21, 2220–2236.
Yan, Y., Stolz, S., Chételat, A., Reymond, P., Pagni, M., Dubugnon, L., and
Farmer, E.E. (2007) A downstream mediator in the growth repression limb of
the jasmonate pathway. Plant Cell, 19, 2470–2483.
Yoshida, Y., Sano, R., Wada, T., Takabayashi, J., and Okada, K. (2009) Jasmonic
acid control of GLABRA3 links inducible defense and trichome patterning in
Arabidopsis. Development, 136, 1039–1048.
Zhang, F., Gonzalez, A., Zhao, M., Payne, C.T., and Lloyd, A. (2003) A network of
redundant bHLH proteins functions in all TTG1-dependent pathways of
Arabidopsis. Development, 130, 4859–4869.
Zhang, H-B. et al. (2012) Tobacco transcription factors NtMYC2a and NtMYC2b form
nuclear complexes with the NtJAZ1 repressor and regulate multiple jasmonate-
inducible steps in nicotine biosynthesis.Mol. Plant., 5, 73–84.
Zhang, J.Z., Creelman, R.A. and Zhu, J.K. (2004) From laboratory to field. Using
information from Arabidopsis to engineer salt, cold, and drought tolerance in
crops. Plant Physiol., 135, 615–621.
Zhang, Y., Liu, T., Meyer, C.A., Eeckhoute, J., Johnson, D.S., Bernstein, B.E.,
Nusbaum, C., Myers, R.M., Brown, M., Li, W., et al. (2008) Model-based
analysis of ChIP-Seq (MACS). Genome Biol., 9, R137.
Zhang, Y., Turner, J.G. (2008) Wound-Induced Endogenous Jasmonates Stunt Plant
Growth by Inhibiting Mitosis. PLoS ONE, 3, 11.
Zhang,Y., Gao, M., Singer, S.D., Fei, Z., Wang, H., and Wang, X. (2012) Genome-
Wide Identification and Analysis of the TIFY Gene Family in Grape. PLoS
ONE, 7, 1-9.
Zhao, J., Davis, L.C., Verpoorte, R. (2005) Elicitor signal transduction leading to
production of plant secondary metabolites. Biotechnol. Adv., 23, 283–333.
Zhao, Q., Wang, H., Yin, Y., Xu, Y., Chen, F. And Dixon, R.A. (2010) Syringyl
lignin biosynthesis is directly regu- lated by a secondary cell wall master switch.
Proc. Natl. Acad. Sci. U.S.A., 107, 14496–14501.
Zhu, C., Byers, K.J., McCord, R.P., Shi, Z., Berger, M.F., Newburger, D.E.,
Saulrieta, K., Smith, Z., Shah, M.V., Radhakrishnan, M., Philippakis, A.A.,
Hu, Y., De Masi, F., Pacek, M., Rolfs, A., Murthy, T., Labaer, J., and Bulyk,
M.L. (2009) High-resolution DNAbinding specificity analysis of yeast
transcription factors. Genome Res., 19, 556-566.
223
Bibliografía
Zimmermann, I.M., Heim, M.A., Weisshaar, B., and Uhrig, J.F. (2004)
Comprehensive identification of Arabidopsis thaliana MYB transcription factors
interacting with R/B-like BHLH proteins. Plant J., 40, 22–34.
224
ANEXO I
ChIP-Seq de ZmZIM91
proveniente de
protoplastos de maíz
Picos seleccionados para la validación del ChIP-Seq de ZmZIM91 proveniente de
protoplastos de maíz
Identificador
Oligos
Pico Anticuerpo
Anticuerpo Pico
en MACS
GenesGenes
en laenzona flanqueante
la zona 5´y
flanqueante 5´ Función
y función putativa
putativa
GFP 437
1 GRMZM2G436038 (Ribosomal protein)
91,1 119
GFP 808 GRMZM2G070899 (GTPasa activ/GTP binding, defense, response to cadmium
2
91,1 184 ion, vesicle mediated transport)
GFP 824
3 GRMZM2G057466 (Hidroxilase modif hist/Jumonji: response to chitin)
91,1 188
GFP 849 GRMZM2G009655 (Ubiquitin depen/metabolic process, UBIQUITIN-SPECIFIC
4
91,1 200 PROTEASE 10)
GFP 1000 GRMZM2G058402 (Negative regulator of metabolic process/ ATPase inhibitor
5
91,1 258 activity)
GFP 1278
6 GRMZM2G031138 (Metabolic process/UDP-glycosyltransferase activity)
91,1 316
GFP 1312 GRMZM2G463726 (C2 calcium/lipid-binding plant phosphoribosyltransferase
7
91,1 319 family protein)
GFP 1521 GRMZM2G176225 (WAK53a-OsWAK receptor-like protein kinase/calcium
8 binding/cytoplasmic serine/threonine protein kinase induced by salicylic
91,1 340
1555 acid)
GFP GRMZM2G050234 (Metabolic process/2-oxoglutarate (2OG) and Fe(II)-
9
91,1 345 dependent oxygenase superfamily protein, oxidoreductase activity)
GFP 2386 GRMZM2G135722 (Metabolic process/UDP-Glycosyltransferase superfamily
10
91,1 605 protein, transferase activity/Anthocyanidin 3-O-glucosyltransferase)
GFP 2453
11 GRMZM2G155321 (GRMZM2G155285/F-box)
91,1 617
GFP 2639 GRMZM2G114444 (basic Helix-Loop-Helix 121 (bHLH121)/DNA binding,
12
91,1 642 sequence-specific DNA binding transcription factor activity)
GFP 2764
13 GRMZM2G147726 (GTPasa activ/GTP binding/ response to cadmium ion)
91,1 674
GFP 3813
20 GRMZM2G320786 (Lignin catabolic process/flavonoides)
91,1 956
GFP 3884
21 GRMZM5G862817 (F-box)
91,1 967
GFP 4634
22 GRMZM2G071147 (Uncharacterized)
91,1 1184
GFP 4654 GRMZM2G096709 (Regulation of transcription/ATP binding/Growth-
23
91,1 1186 regulating factor)
GFP 4761
24 GRMZM2G010702 (Uncharacterized)
91,1 1205
GFP 4762
25 GRMZM2G010702 (Uncharacterized)
91,1 1206
Identificador
Pico
Oligos Anticuerpo
Anticuerpo GenesGenes
en laenzona
la zona flanqueante 5´5´y
y función putativa
en Pico
MACS flanqueante Función putativa
40 91,1 849 FUNCTIONS IN: protein binding; INVOLVED IN: apoptosis, defense response
43 91,1 1070 Helicase activity, binding, DNA binding, nucleic acid binding, ATP binding
44 91,1 1345 Rac GTPase activator activity; INVOLVED IN: signal transduction
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 4
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 7
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 11
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 19
35S::GFP
35S:: ZmZIM91:GFP
del pico 34
35S::GFP
35S:: ZmZIM91:GFP
del pico 39
35S::GFP
INPUT Anti_GFP Anti_ZmZIM91
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 40
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 42
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
del pico 43
35S::GFP
PCR semi-cuantitativa
35S:: ZmZIM91:GFP
A
Gen Función putativa Homólogo en Arabidopsis
Marta Riera
Abstract In all eukaryotes, the typical CK2 holoenzyme structure for Zea mays CK2b1 by homology modeling and
is an heterotetramer composed of two catalytic (CK2a and we discuss about possible structural changes in the acidic
CK2a0 ) and two regulatory (CK2b) subunits. One of the loop region that could affect the enzyme regulation.
distinctive traits of plant CK2 is that they present a greater
number of genes encoding for CK2a/b subunits than ani- Keywords Protein kinase CK2 CK2b regulatory
mals or yeasts, for instance, in Arabidopsis and maize both subunit Multigenic family Acidic loop
CK2a/b subunits belong to multigenic families composed Homology modeling
by up to four genes. Here, we conducted a genome-wide
survey examining 34 different plant genomes in order to
investigate if the multigenic property of CK2b genes is a Introduction
common feature through the entire plant kingdom. Also, at
the level of structure, the plant CK2b regulatory subunits In plants, protein kinase CK2 is a key enzyme involved
present distinctive features as (i) they lack about 20 ami- in relevant processes such as plant growth and light-
noacids in the C-terminal domain, (ii) they present a spe- regulated gene expression; circadian rhythm; cell-cycle
cific N-terminal extension of about 90 aminoacids that regulation and development; and biotic and abiotic stress
shares no homology with any previously characterized responses [1–7]. As in the case of mammals, the typical
functional domain, and (iii) the acidic loop region is poorly CK2 holoenzyme is a heterotetrameric complex com-
conserved at the aminoacid level. Since there is no data posed of two catalytic (CK2a and CK2a0 ) and two reg-
about CK2b or holoenzyme structure in plants, in this ulatory (CK2b) subunits. CK2b regulatory subunits are
study, we use human CK2b as a template to predict a inactive and present no homology to regulatory subunits
or domains of other protein kinases. The CK2b regula-
tory subunits are involved in the assembly of CK2 tet-
Electronic supplementary material The online version of this rameric complexes, in enhancing catalytic activity and
article (doi:10.1007/s11010-011-0971-6) contains supplementary stability of CK2a and in modulation of the substrate
material, which is available to authorized users.
specificity of CK2 [8]. In addition, CK2b can interact
I. C. Velez-Bermudez S. Irar L. Carretero-Paulet and regulate other proteins in the absence of CK2a
M. Pagès M. Riera (&) subunits [9, 10].
Molecular Genetics Department, Centre for Research In contrast to animals, plants present a high number of
on Agricultural Genomics CRAG (CSIC-IRTA-UAB-UB),
genes encoding for CK2a/b subunits: in humans there are
Campus UAB 08193 Bellaterra, Cerdanyola del Vallès,
Barcelona, Spain two genes encoding for catalytic subunits (CK2a/a0 ) and
e-mail: [email protected] only one for CK2b regulatory subunits [11, 12], whereas in
Arabidopsis and maize, both CK2a/b subunits belong to
L. Carretero-Paulet
multigenic families composed by up to four genes [2,
Institute for Plant Molecular and Cell Biology – IBMCP
(CSIC-UPV) Integrative Systems Biology Group, 13–18]. However, the presence of multiple CK2a/b iso-
C/Ingeniero Fausto Elio s/n., 46022 Valencia, Spain forms in plants is unlikely to be redundant, since specific
123
Mol Cell Biochem
functions have been associated to each isoform [19]. For (http://www.cgl.ucsf.edu/chimera/) was used for viewing
instance, in maize, we previously described differential the sequences and structures.
subcellular localization and expression levels for each
CK2b isoform [7, 15]. In Arabidopsis, only CK2B3 and
CK2B4 isoforms play a role in circadian-clock regulation
[2, 17] and specific CK2 holoenzymes present differential Results and discussion
substrate specificity [20]. Also in tobacco differential
expression of genes encoding protein kinase CK2 subunits The CK2b regulatory subunits families in plants
in the plant cell cycle has been described [21]. Here, we
conducted a genome-wide survey examining 34 different In order to identify and classify all CK2b homologue genes
plant genomes in order to investigate if the multigenic in plant species, searches were performed throughout the
property of CK2b genes is a common trait of plant kingdom. proteomes of thirty-four plant species with whole
The CK2a catalytic subunits are highly conserved among sequenced genomes Zea mays CK2b1 as a query [14]. As a
eukaryotic organisms, but the level of identity between result, 90 sequences, corresponding to the CK2b gene
plant, yeast and human CK2b subunits is not so high. families of red and green algae, moss, lycophytes, gym-
Despite the elucidation of the human CK2a/b subunits and nosperms, and angiosperms, representing the main plant
holoenzyme and maize CK2a structure [22–24], there is no evolutionary lineages were found (Table 1 and Supple-
data about CK2b or holoenzyme structure in plants. All mental Table 1). Unicellular algae species showed a single
plant CK2b subunits preserve in their central core the CK2b gene, while land plants commonly showed three-to-
characteristic CK2b feature, the zinc finger region that five CK2b genes. It could be argued that evolutionary
contains four conserved cysteine residues involved in CK2b expansion of the CK2b gene family is related to the
dimerization. However, there are distinctive features in acquisition of multicellulalirity. However, it is not very
plant CK2b: (i) they are about twenty aminoacids shorter in likely since only one gene was found in the multicellular
the C-terminal domain, (ii) they present a specific N-ter- algae Volvox carteri as well as in all the animal species
minal extension of about ninety aminoacids that shares no examined, except Drosphila melanogaster that present two
homology with any previously characterized functional genes. In addition, the fungal species (including unicellular
domain, and (iii) the acidic loop region present in animal yeasts) and protist (as Plasmodiun falciparum) also showed
CK2 is poorly conserved in plant sequences. Here, using two genes copies (Supplemental Table 2). Additional gene
human CK2b as template we predict a hypothetical struc- family expansion would have occurred in specific plant
ture for Zea mays CK2b1 and describe its structural features lineages, as reflected the higher number of CK2b genes
to give clues to understanding its molecular functions. found in the genomes of the dicots Malus domestica (ele-
ven) or Glycine max (six). In these specific cases, redun-
dancy could be also considered, even if the main
Materials and methods hypothesis links the presence of multiple isoforms in plants
to specific functions [2, 15, 17, 20, 21]. Similarly, lineage-
Plant CK2b regulatory subunits sequence analysis specific contraction of this family could be observed in
Medicago truncatula, bearing one CK2b gene. In monocots
Searches were performed throughout the proteomes of there is also heterogeneity between the different CK2b
thirty plant species with whole sequenced genomes (Sup- families, since three to four genes are found in Zea mays,
plemental Table 1). For the not fully sequenced genomes, Sorghum bicolor, and Brachypodium distachyon but only
sequences were retrieved from UNIPROT. We have used one or two genes are found in Hordeum vulgare and Oryza
BLASTP [25] and Zea mays CK2b1 as a query [15]. Hits sativa. It is possible that the sizes of the CK2b gene fam-
returning E values \10E-5 were considered as significant. ilies differ mainly because of differential rates of gene
Sequences were aligned using CLUSTAL [26] and the duplication and retention and may reflect species-specific
resulting alignments examined individually. Finally, adaptations. This observation is in agreement with the
redundant sequences and alternatively spliced isoforms proposed ancient origin of the basic genetic toolkit of land
were discarded. plants [29]; much of plant diversity may have arisen largely
Homology modeling for Zea mays CK2b1 was per- following the duplication and adaptive specialization of
formed by comparative modeling approach using three pre-existing genes [30]. Differential evolutionary expan-
automated homology modeling programs, MODELLER sion of this family reflects the prevalence of gene dupli-
9v9 (http://www.salilab.org/modeller/), SWISS-MODEL cation in land plant genome evolution [31–34] as well as
[27], and GENO3D [28]. Human CK2b structure (PDB ID: the major role of polyploidization in speciation of vascular
1JWH) was used as as template [23]. CHIMERA program plants [35, 36].
123
Mol Cell Biochem
Homology modeling of maize CK2b1 prediction programs were unable to determine tertiary
regulatory subunit structure for this domain.
The human CK2b subunit (1–215) is a compact globular
Homology modeling is based on the fact that protein ter- homodimer organized in seven a-helices and three b-sheets
tiary structure is better conserved than amino acid sequence [24]. The tertiary structure predicted for the central core of
[37]. Thus, we have used human CK2b sequence and maize CK2b1 (82–276) overlaps with the human CK2b
structure as a template to predict a possible tertiary struc- structure in almost all the structure (1–197) (Fig. 1b). Since
ture of maize CK2b1. As shown in the alignment in maize CK2b1 is eighteen aminoacids shorter than human
Fig. 1a, the sequence identity between the central core of CK2b in the C-terminal domain, the a7 helix of human
maize CK2b1 (82–276) and human CK2b is 51%. Unfor- CK2b (196–202) is not present in the maize structure. The
tunately, since the plant specific N-terminal domain of other six a-helices and three b-strands overlap in both
maize CK2b1 (1–81) presents no homology with other structures. It is noteworthy that the most diverging region
protein or domains either in sequence or in structure, the between both structures corresponds to the acidic loop
123
Mol Cell Biochem
domain. In human CK2b the acidic loop region (residues shown in Fig. 1c, within and close to the human CK2b
55–64) has been described as a regulatory region since acidic loop there are two Pro residues (position 58 and 66).
contains the binding domain for polyamines [38]. The Proline presents an exceptional conformational rigidity
crystal structure of human CK2b demonstrates that the compared to other amino acids, therefore, it is remarkable
acidic loop is probably a very flexible region since the that these two residues are not conserved in any of the plant
electron density in this region is not well defined and CK2b sequence analyzed whereas they are present in the
adapts more than one conformation [25]. The aminoacid animal sequences examined (data not shown). In animals it
composition of maize CK2b1 acidic loop differs from that has been shown that mutation in residues in the acidic loop
of human CK2b. Whereas in human CK2b in eight of the region affects the CK2 activity [39], therefore, it is likely to
ten aminoacids are acidic (55 DLEPDEELED 64), in think that the differences found in this region could also
maize, CK2b1 there are only three acidic of ten, two of affect to plant enzyme regulation. In agreement with that
them conserved in the same position (136 DVESSHGDML hypothesis, we have previously demonstrated that the in
145). The maize acidic loop presents high heterogeneity vitro properties of the maize holoenzyme are different from
since contains different types of residues: basic (as His), those of the human CK2, since human CK2 holoenzyme
non-polar (as Val, Gly, Leu, and Met) and polar (Ser). As present higher stability and specific activity than its maize
123
Mol Cell Biochem
counterpart [40]. Work is in progress to confirm if the plant 15. Riera M, Peracchia G, De Nadal E, Ariño J, Pagès M (2001)
specific N-terminal domain and the low-conserved acidic Maize protein kinase CK2: regulation and functionality of three b
regulatory subunits. Plant J 25:365–374
loop have a role in modulation of the enzyme in plants. 16. Collinge MA, Walker JC (1994) Isolation of an Arabidopsis
thaliana casein kinase II b subunit by complementation in Sac-
Acknowledgments M.R. was financed by I3P-CSIC2006 and charomyces cerevisiae. Plant Mol Biol 25:649–658
CONSOLIDER (CSD2007-00057) from MICINN (Spain), I.C. V–B. 17. Perales M, Portolés S, Más P (2006) The proteasome-dependent
by predoctoral fellowship FPI2007 from MICINN (Spain) and L. degradation of CKB4 is regulated by the Arabidopsis biological
C–P. by Juan de la Cierva Programme, MICINN (Spain). This work was clock. Plant J 46:849–860
supported by grant BIO2009-13044-CO2-01 from MICINN (Spain). 18. Mizoguchi T, Yamaguchi-Shinozaki K, Hayashida N, Kamada H,
Shinozaki K (1993) Cloning and characterization of two cDNAs
encoding casein kinase II catalytic subunits in Arabidopsis tha-
liana. Plant Mol Biol 21:279–289
19. Riera M, Peracchia G, Pagès M (2001) Distinctive features of
References plant protein kinase CK2. Mol Cell Biochem 227:119–127
20. Dennis MD, Browning KS (2009) Differential phosphorylation of
1. Lee Y, Lloyd AM, Roux SJ (1999) Antisense expression of the plant translation initiation factors by Arabidopsis thaliana CK2
CK2 alpha-subunit gene in Arabidopsis. Effects on light-regulated holoenzymes. J Biol Chem 284:20602–20614
gene expression and plant growth. Plant Physiol 119:989–1000 21. Espunya MC, Lopez-Giraldez T, Hernan I, Carballo M, Martinez
2. Sugano S, Andronis C, Ong MS, Green RM, Tobin EM (1999) The MC (2005) Differential expression of genes encoding protein
protein kinase CK2 is involved in regulation of circadian rhythms kinase CK2 subunits in the plant cell cycle. J Exp Bot 56:3183–
in Arabidopsis. Proc Natl Acad Sci USA 96:12362–12366 3192
3. Espunya MC, Combettes B, Dot J, Chaubet-Gigot N, Martı́nez 22. Niefind K, Guerra B, Pinna LA, Issinger O-G, Schomburg D
MC (1999) Cell-cycle modulation of CK2 activity in tobacco (1998) Crystal structure of the catalytic subunit of protein
BY-2 cells. Plant J 19:655–666 kinase CK2 from Zea mays at 2.1 Å resolution. EMBO J 17:
4. Hidalgo P, Garreton V, Berrios CG, Ojeda H, Jordana X, Ho- 2451–2462
luigue L (2001) A nuclear casein kinase 2 activity is involved in 23. Niefind K, Guerra B, Ermakowa I, Issinger O-G (2001) Crystal
early events of transcriptional activation induced by salicylic acid structure of human protein kinase CK2: insights into basic
in tobacco. Plant Physiol 125:396–405 properties of the CK2 holoenzyme. EMBO J 20:5320–5331
5. Moreno-Romero J, Espunya M, Platara M, Ariño J, Martı́nez M 24. Chantalat L, Leroy D, Filhol O, Nueda A, Benitez MJ, Chambaz
(2008) A role for protein kinase CK2 in plant development: EM, Cochet C, Dideberg O (1999) Crystal structure of the human
evidence obtained using a dominant-negative mutant. Plant J protein kinase CK2 regulatory subunit reveals its zinc finger-
55:118–130 mediated dimerization. EMBO J 18:2930–2940
6. Portolés S, Más P (2007) Altered oscillator function affects clock 25. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller
resonance and is responsible for the reduced day-length sensi- W, Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new
tivity of CKB4 overexpressing plants. Plant J 51:966–977 generation of protein database search programs. Nucleic Acids
7. Riera M, Figueras M, López C, Goday A, Pagès M (2004) Protein Res 25:3389–3402
kinase CK2 modulates developmental functions of the abscisic 26. Thompson JD, Higgins DG, Gibson TJ (1994) CLUSTAL W:
acid responsive protein Rab17 from maize. Proc Natl Acad Sci improving the sensitivity of progressive multiple sequence
USA 101:9879–9884 alignment through sequence weighting, position-specific gap
8. Meggio F, Boldyreff B, Marin O, Marchiori F, Perich JW, Is- penalties and weight matrix choice. Nucleic Acids Res
singer O-G, Pinna LA (1992) The effect of polylysine on casein- 22:4673–4680
kinase-2 activity is influenced by both the structure of the protein/ 27. Arnold K, Bordoli L, Kopp J, Schwede T (2006) The SWISS-
peptide substrates and the subunit composition of the enzyme. MODEL workspace: a web-based environment for protein
Eur J Biochem 205:939–945 structure homology modelling. Bioinformatics 22:195–201
9. Bibby A, Litchfield DW (2005) The multiple personalities of the 28. Combet C, Jambon M, Deleage G, Geourjon C (2002) Geno3D:
regulatory subunit of protein kinase CK2: CK2 dependent and automatic comparative molecular modelling of protein. Bioin-
CK2 independent roles reveal a secret identity for CK2beta. Int J formatics 18:213–214
Biol Sci 1:67–79 29. Rensing S, Lang D, Zimmer AD, Terry A, Salamov A et al
10. Bolanos-Garcia VM, Fernandez-Recio J, Allende JE, Blundell TL (2008) The physcomitrella genome reveals evolutionary insights
(2006) Identifying interaction motifs in CK2[beta]—a ubiquitous into the conquest of land by plants. Science 319:64–69
kinase regulatory subunit. Trends Biochem Sci 31:654–661 30. Flagel LE, Wendel JF (2009) Gene duplication and evolutionary
11. Allende J, Allende C (1995) Protein kinases. 4. Protein kinase novelty in plants. New Phytol 183:557–564
CK2: an enzyme with multiple substrates and a puzzling regu- 31. Blanc G, Wolfe KH (2004) Widespread paleopolyploidy in
lation. FASEB J 9:313–323 model plant species inferred from age distributions of duplicate
12. Lozeman F, Litchfield D, Piening C, Takio K, Walsh K, Krebs E genes. Plant Cell 16:1667–1678
(1990) Isolation and characterization of human cDNA clones 32. Bowers JE, Chapman BA, Rong J, Paterson AH (2003) Unrav-
encoding the alpha and the alpha0 subunits of casein kinase II. elling angiosperm genome evolution by phylogenetic analysis of
Biochemistry 29:8436–8447 chromosomal duplication events. Nature 422:433–438
13. Dobrowolska G, Boldyreff B, Issinger O-G (1991) Cloning and 33. Lespinet O, Wolf YI, Koonin EV, Aravind L (2002) The role of
sequencing of the casein kinase 2 [alpha] subunit from Zea mays. lineage-specific gene family expansion in the evolution of
Biochim Biophys Acta 1129:139–140 eukaryotes. Genome Res 12:1048–1059
14. Peracchia G, Jensen AB, Culiáñez-Macià FA, Grosset J, Goday 34. Moore RC, Purugganan MD (2005) The evolutionary dynamics
A, Issinger O-G, Pagès M (1999) Characterization, subcellular of plant duplicate genes. Curr Opin Plant Biol 8:122–128
localization and nuclear targeting of casein kinase 2 from Zea 35. Otto SP, Whitton J (2000) Polyploid incidence and evolution.
mays. Plant Mol Biol 40:199–211 Annu Rev Genet 34:401–437
123
Mol Cell Biochem
36. Wood TE, Takebayashi N, Barker MS, Mayrose I, Greenspoon subunit. A study with calmodulin as phosphorylatable substrate.
PB, Rieseberg LH (2009) The frequency of polyploid speciation Biochemistry 33:4336–4342
in vascular plants. Proc Natl Acad Sci USA 106:13875–13879 39. Leroy D, Heriché J-K, Filhol O, Chambaz EM, Cochet C (1997)
37. Marti-Renom MA, Stuart AC, Fiser As, Sanchez R, Melo F, Sali Binding of polyamines to an autonomous domain of the regula-
A (2000) Comparative protein structure modeling of genes and tory subunit of protein kinase CK2 induces a conformational
genomes. Annu Rev Biophys Biomol Struct 29:291–325 change in the holoenzyme. J Biol Chem 272:20820–20827
38. Meggio F, Boldyreff B, Issinger O-G, Pinna LA (1994) Casein 40. Riera M, Pages M, Issinger O-G, Guerra B (2003) Purification
kinase 2 down-regulation and activation by polybasic peptides are and characterization of recombinant protein kinase CK2 from Zea
mediated by acidic residues in the 55–64 region of the.beta- mays expressed in Escherichia coli. Protein Expr Purif 29:24–32
123
Role of Plant-Specific N-Terminal Domain of Maize CK2b1
Subunit in CK2b Functions and Holoenzyme Regulation
Marta Riera1., Sami Irar1., Isabel C. Vélez-Bermúdez1, Lorenzo Carretero-Paulet1,2¤, Victoria
Lumbreras1, Montserrat Pagès1*
1 Department of Molecular Genetics, Centre for Research on Agricultural Genomics CRAG (CSIC-IRTA-UAB), Barcelona, Spain, 2 Department of Applied Biology (Area of
Genetics). University of Almerı́a, Spain
Abstract
Protein kinase CK2 is a highly pleiotropic Ser/Thr kinase ubiquituous in eukaryotic organisms. CK2 is organized as a
heterotetrameric enzyme composed of two types of subunits: the catalytic (CK2a) and the regulatory (CK2b). The CK2b
subunits enhance the stability, activity and specificity of the holoenzyme, but they can also perform functions
independently of the CK2 tetramer. CK2b regulatory subunits in plants differ from their animal or yeast counterparts, since
they present an additional specific N-terminal extension of about 90 aminoacids that shares no homology with any
previously characterized functional domain. Sequence analysis of the N-terminal domain of land plant CK2b subunit
sequences reveals its arrangement through short, conserved motifs, some of them including CK2 autophosphorylation sites.
By using maize CK2b1 and a deleted version (DNCK2b1) lacking the N-terminal domain, we have demonstrated that CK2b1
is autophosphorylated within the N-terminal domain. Moreover, the holoenzyme composed with CK2a1/DNCK2b1 is able to
phosphorylate different substrates more efficiently than CK2a1/CK2b1 or CK2a alone. Transient overexpression of CK2b1
and DNCK2b1 fused to GFP in different plant systems show that the presence of N-terminal domain enhances aggregation
in nuclear speckles and stabilizes the protein against proteasome degradation. Finally, bimolecular fluorescence
complementation (BiFC) assays show the nuclear and cytoplasmic location of the plant CK2 holoenzyme, in contrast to
the individual CK2a/b subunits mainly observed in the nucleus. All together, our results support the hypothesis that the
plant-specific N-terminal domain of CK2b subunits is involved in the down-regulation of the CK2 holoenzyme activity and in
the stabilization of CK2b1 protein. In summary, the whole amount of data shown in this work suggests that this domain was
acquired by plants for regulatory purposes.
Citation: Riera M, Irar S, Vélez-Bermúdez IC, Carretero-Paulet L, Lumbreras V, et al. (2011) Role of Plant-Specific N-Terminal Domain of Maize CK2b1 Subunit in
CK2b Functions and Holoenzyme Regulation. PLoS ONE 6(7): e21909. doi:10.1371/journal.pone.0021909
Editor: Arthur J. Lustig, Tulane University Health Sciences Center, United States of America
Received December 23, 2010; Accepted June 14, 2011; Published July 15, 2011
Copyright: ß 2011 Riera et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits
unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Funding: MR was financed by I3P-CSIC2006, ICV-B by predoctoral fellowship FPI2007 from MICINN (Spain) and LC-P by Juan de la Cierva Programme, MICINN
(Spain). This work was also supported by grant BIO2009-13044-CO2-01 from MICINN (Spain) and CONSOLIDER-INGENIO 2010 MEC (CSD2007-00057). The funders
had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Competing Interests: The authors have declared that no competing interests exist.
* E-mail: [email protected]
. These authors contributed equally to this work.
¤ Current address: Integrative Systems Biology Group, Institute for Plant Molecular and Cell Biology - IBMCP (CSIC-UPV), Valencia, Spain
been found in the Maize Genomic Database (MaizeGD) and is (averaging ca. 10%), Thr and Tyr. Using the N-terminal domain
included in this paper. Since it was crystallized [21], maize CK2a1 of maize CK2b1 as a query, BLAST searches were performed in
subunit has been widely studied as a model of CK2 structure and it different protein databases, including the whole proteome of
has been used successfully to design inhibitors of the holoenzyme selected plant species (Table S1). As a result, 34 sequences
[22]. This is due to the biochemical characteristics of maize corresponding to CK2b from 13 species representative of the main
CK2a, which is highly stable and has more specific activity than land plant evolutionary lineages were identified (Table S2).
the human holoenzyme. Comparative studies demonstrate that the Additional searches of the protein databases were performed
maize holoenzyme is less stable than the human counterpart [23]. through HMMer using as a query a hidden Markov models
However, despite copious data on CK2a, little is known about (HMM) profile constructed on the basis of the alignment of 33 N-
CK2b regulatory subunits and CK2 holoenzyme in maize. Plants terminal domains. Despite HMM profiles perform better in
have a greater diversity of CK2b subunits than animals or yeasts detecting remote homologies [25], only land-plant species CK2b
[24]. Although plant CK2bs preserve in their central core the sequences were detected. The architecture of conserved motifs
characteristic CK2b features, they lacked 20 aminoacids from the throughout the N-terminal domains was examined and represent-
C-terminal domain and contain a specific N-terminal extension of ed over the corresponding alignment (Figure 1). Despite the high
about 90 aminoacids. This N-terminal region shares no homology degree of divergence within the N-terminal domain, 15 short
with any previously characterized functional domain. The absence conserved motifs were found, some of them matching the
of functional data about this domain prompted us to investigate its consensus phosphorylation sites for specific protein kinases (Table
putative role in: (i) CK2b functions and (ii) CK2 holoenzyme S4), including putative CK2 autophosphorylation sites (motifs 1
regulation. Using maize CK2b1 and a deleted version lacking N- and 5). Some motifs were highly conserved across almost every
terminal domain (DNCK2b1) we demonstrate that this plant- sequence examined (e.g. motif 1, particularly rich in acidic amino
specific N-terminal extension affects both CK2b and CK2 acids and including at least six Ser and/or Thr residues consensus
holoenzyme properties. In addition, we postulate a new role for of CK2 phosphorylation) while many others were apparently
CK2b subunits in plants, since CK2b1 releases CK2a1 subunits specific to certain evolutionary lineages (e.g. motif 5).
from the nucleolus and the CK2 holoenzyme can be found all over Genomic structure provides an independent criterion to assess
the cell. These findings show that in vivo localization of the plant the evolutionary relatedness among genes and functional domains.
CK2 holoenzyme is different from that of the independent CK2a/ Exon/intron organization of plant CK2b for which the genomic
b subunits alone. Even though the N-terminal domain of CK2b is sequences were available was determined. In all land-plant CK2b
not involved in this export mechanism, the data reported here genes, location of the first intron was conserved at the same
indicates a role of this domain in regulation of both CK2b subunits relative position of the N-terminal domain, just before motif 1.
and CK2 holoenzyme in plants. The first intron always showed phase 0 at the junction with exon 1
and phase 1 at the junction with exon 2 (Figure 1), supporting the
Results acquisition of the N-terminal domain by land plants as encoded by
a single exon.
Sequence and evolutionary analysis of the N-terminal To gain further insights into the evolutionary history of the land
domain of plant CK2b subunits plant CK2b N-terminal domain, we performed a phylogenetic
All plant CK2b subunits display an extra domain located N- analysis of CK2b proteins from different eukaryotic kingdoms. For
terminal to the highly conserved CK2b central region. These N- this purpose, we constructed a sequence dataset of 69 CK2b
terminal CK2b domains are poorly conserved both in length and protein sequences, including sequences from animals and from
in primary sequence. At the amino acid composition level, they are several non-land plant species (algae, fungi, and protists) also
significantly enriched in phosphorylable residues such as Ser displaying N-terminal extensions (Tables S2 and S3). Phylogenetic
Figure 1. Multiple Sequence Alignment of N-terminal domains of land plant CK2b regulatory subunits. Conserved not-overlapping
motifs identified in the MEME analysis are background-coloured. Positions in bold correspond to Serine and Threonine (S, T) residues predicted as
CK2 phosphorylation sites. Location of the first intron is underlined.
doi:10.1371/journal.pone.0021909.g001
analyses were conducted using two independent methods: confirm this hypothesis, we added increasing amounts of CK2b1
Neighbor Joining (NJ) and Maximum Likelihood (ML) [26–29]. N-terminal domain (1–80) to the in vitro phosphorylation assays
A clade clustering all land-plant CK2b subunits could be with the holoenzyme composed by CK2a1/DNCK2b1. The
unambiguously retrieved in both NJ and ML trees (Figure S1 addition of exogenous CK2b1 N-terminal domain to the CK2a1/
and S2) and is clearly separated from other clades grouping CK2b DNCK2b1 holoenzyme decreases its phosphorylation efficiency
from other organisms and also containing N-terminal extensions. towards the substrates tested, ZIM-like (Figure 2D), b-casein and
Rab17 (Figure S3). In conclusion, these results suggest that the N-
The N-terminal domain of maize CK2b1 affects the CK2 terminal domain of CK2b subunits competes with the substrate for
holoenzyme activity phosphorylation and down-regulate CK2a activity.
To ascertain whether the plant specific N-terminal domain of
maize CK2b1 affects CK2 holoenzyme regulation, we first The N-terminal domain of CK2b1 enhances stability of
analyzed if the domain is needed for CK2 holoenzyme assembly, CK2b1 against proteasome degradation
CK2b/CK2b dimerization or interaction with CK2 substrates. To determine whether the N-terminal domain of CK2b
We prepared constructs harbouring different deletions of the subunits is involved in regulation of their subcellular localization,
CK2b1 protein (Figure 2A) to perform two-hybrid assays. No the deleted version of CK2b1 (del1 DNCK2b1 (80–276)) was fused
significant interaction was detected between empty AD/BD-clone to GFP and examined by confocal microscopy in different plant
combinations (data not shown). Deletion del1 DNCK2b1 (80–276) systems: immature maize embryos (10 DAP) transformed by
strongly interacts with other CK2a catalytic subunits (CK2a2) as particle bombardment, agroinfiltrated tobacco leaves and onion
well as with full-length CK2b1. However, deletions del2 (180– epidermal cells (Figure 3 and Figure S4).
276), corresponding to CK2b without N-terminal domain and In all plant systems examined the results obtained show that
acidic region and del3 (1–80), which corresponds to the N- both CK2b1 and DNCK2b1 are mainly located in the nucleus,
terminal domain alone, do not interact neither with CK2a2 nor but whereas in the transformation with CK2b1 most of cells
with CK2b1 subunits (Figure 2A). Therefore, these results presented nuclear speckles, in cells transformed with DNCK2b1
demonstrate that CK2b N-terminal domain is not essential for we found two different patterns: cells presenting a diffuse nuclear
intra-holoenzyme interactions. pattern as well as cells showing nuclear speckles. Any nuclear
We have previously demonstrated that recombinant maize speckle structures were observed in cells transformed with GFP
CK2a and CK2b subunits can assemble in a functional tetrameric alone. Since the total number of transformed cells after maize
complex, and autophosphorylation of CK2b subunits demon- bombardment is much lower than in tobacco cells, we counted the
strates the functionality of the holoenzyme [20]. As previously percentage of DNCK2b1 cells presenting speckles vs. a diffuse
observed in animals, dimerization of CK2b subunits seems to be a pattern in agroinfiltrated tobacco leaves (Figure 3B). Only 29% of
pre-requisite for holoenzyme formation [30]. Here we have cells transformed with DNCK2b1 presented speckles vs. 71% with
reconstituted the active holoenzyme using the CK2a1 catalytic diffuse pattern, whereas for cells transformed with full-lenght
subunit and the deleted version of CK2b1 subunit (del1 CK2b1 96% of the cells presented speckles. Therefore, the
DNCK2b1 (80–276)) and we found that in absence of the N- absence of nuclear aggregates in the DNCK2b1 cells could be
terminal domain of CK2b1, the CK2a1/DNCK2b1 holoenzyme linked to the deletion of the N-terminal domain.
is also functional and autophosphorylable (Figure 2B). Compar- To test if the better ability of CK2b1 vs. DNCK2b1 to form
ative CK2 autophosphorylation assays using holoenzymes nuclear aggregates affects the protein stability, we performed cell-
CK2a1/CK2b1 and CK2a1/DNCK2b1 have been done and free degradation assays. Total protein extracts from tobacco leaves
quantification of the autophosphorylation of both holoenzymes transformed with CK2b1 and DNCK2b1 fused to GFP were
shows that CK2a1/CK2b1 was about 25% more phosphorylated maintained for 10, 30, 60 min at 30uC without protein inhibitors,
than CK2a1/DNCK2b1 (Figure 2B, right). It is noteworthy that and aliquots were analyzed by Western blot using anti-GFP
when GST-CK2b1 is overexpressed in E coli, a lower band (L) of antibody (Figure 4A, left). Results obtained suggest that the
about 30 kDa appears in addition to a higher band (H) amount of both CK2b1 and DNCK2b1 decreased over time.
corresponding to the fusion protein (56 kDa). Both bands are Subsequently, we added proteasome inhibitor MG132 to test
highly phosphorylated by CK2a in vitro. Purification and whether the degradation observed was due to the proteasome
subsequent protein sequencing of this lower band demonstrate pathway. In samples treated with MG132 the fusion protein
that it corresponds to intermediate products containing the N- remained stable, indicating that MG132 protects CK2b1 and
terminal region of CK2b1. Moreover, the region corresponding to DNCK2b1 against proteasome degradation. The relative amount
the CK2b1 N-terminal alone (1–80) fused to GST (fusion protein of remaining proteins was estimated from these data and plotted,
of 31 kDa) and overexpressed in E coli was also highly and the rates of protein degradation for DNCK2b1 was
phosphorylated by CK2a1 in vitro (Figure 2B). Taken together, considerably higher than the rates for CK2b1 (Figure 4A, right).
all these results suggest that autophosphorylation of CK2b1 occurs These results suggest that the protein lacking the N-terminal
in high proportion at the residues located in the N-terminal domain is more susceptible to degradation by proteasome than the
domain. full-length CK2b1. To examine the effect of the N-terminal
To test whether CK2 activity was affected by the N-terminal domain on CK2b1 degradation by the proteasome pathway, we
domain of CK2b subunits, we compared the ability of both CK2 treated transformed tobacco leaves with cycloheximide (CHX) to
holoenzymes (CK2a1/CK2b1 and CK2a1/DNCK2b1) to phos- inhibit de novo protein synthesis and we observed samples by
phorylate in vitro substrates as b-casein, in vivo substrates as Rab17 confocal microscopy for up to 24 h (Figure 4B). After 4 h of
or interacting partners as maize transcription factor ZIM-like. treatment with CHX, the immunofluorescent signal was visible in
Interestingly, the holoenzyme composed by CK2a1/DNCK2b1 is both CK2b1 and DNCK2b1 samples. In parallel, we have taken
able to phosphorylate b-casein, Rab17 and ZIM-like in greater samples of treated cells at different times and analyzed them by
amount than CK2a1 alone or CK2a1/CK2b1 (Figure 2C). These Western blot. In agreement with the results obtained by confocal
results points towards a possible role of the N-terminal domain of analysis, the in vivo stability at short times is similar for both
CK2b subunits as a negative regulator of CK2 activity. To proteins (Figure S5). However, after 24 h, we detected the
Figure 2. Intra-holoenzyme interactions using yeast two-hybrid system and in vitro CK2 phosphorylation assays using CK2
holoenzymes reconstituted with CK2a1 and regulatory subunits CK2b1 and DNCK2b1. (A) Left, Schematic representation of truncated
versions of maize CK2b1 regulatory subunit used in the assay. Deletion 1, del1 DNCK2b1 (80–276): CK2b1 without N-terminal region, deletion 2 (del2)
(180–276): CK2b1 without N-terminal region and acidic region and deletion 3 (del3) (1–80): N-terminal region alone. Right, Interactions between
truncated versions of CK2b1 subunit and CK2a2/CK2b1 subunits with the two-hybrid system. The indicated transformants were selected in Leu-Trp
plates and replated in selective plates lacking Leu-Trp-His-Ade. (B) Left panel, Gel stained with Coomassie Brillant Blue (CBB) containing the fusion
proteins GST-CK2b1, GST-DNCK2b1 and GST-N-terminal domain (1–80) used in the autophosphorylation and CK2 phosphorylation assays. Middle
panel, Autophosphorylation of reconstituted holoenzymes CK2a1/CK2b1, CK2a1/DNCK2b1 and in vitro phosphorylation of N-terminal domain (1–80)
protein by CK2a1. In the first lane H, high molecular weight protein corresponding to fusion protein GST-CK2b1 (56 kDa) and L, low molecular weight
protein, corresponding to intermediate products of about 30 kDa from fusion protein GST-CK2b1. Right panel, Coomassie Brillant Blue (CBB) and CK2
phosphorylation of GST protein alone (control). Right, Quantification of phosphorylated bands corresponding to CK2a1/CK2b1 and CK2a1/DNCK2b1
holoenzymes. 100% intensity corresponds to autophosphorylation of CK2b1. The data shown are calculated average values 6 SD of three
independent experiments. (C) Quantification of in vitro phosphorylation of b-casein, Rab17 protein and ZIM-like transcription factor by CK2a1/CK2b1
and CK2a1/DNCK2b1 reconstituted holoenzymes. 100% intensity corresponds to the phosphorylation of each protein by CK2a1 alone. The data
shown are calculated average values 6 SD of three independent experiments. (D), Left, In vitro phosphorylation of ZIM-like protein with CK2a1/
DNCK2b1 (lane 1). In lanes 2 to 4 increasing amounts of CK2b1 N-terminal domain (1–80) has been added: 0.2 mg (lane 2), 0.4 mg (lane 3) and 0.8 mg
(lane 4). Right, Relative phosphorylation of ZIM-like with the holoenzyme composed by CK2a1/DNCK2b1 with increasing amounts of CK2a1
N-terminal domain (1–80) (lanes 2–4) compared to phosphorylation of ZIM-like with CK2a1/DNCK2b1 holoenzyme (lane 1, assigned a value of 1). The
data plotted (mean 6SD) represent three independent experiments.
doi:10.1371/journal.pone.0021909.g002
immunofluorescent signal only in cells transformed with CK2b1, CK2a1 subunit was mainly detected in nuclear soluble fraction (N)
indicating the requirement of ongoing protein synthesis to whereas in plants co-transfected with CK2a1-GFP/CK2b1-Myc,
maintain steady-state levels of DNCK2b1 protein. When samples CK2a1 is increased in the insoluble fraction (I), which includes all
were treated with MG132 and CHX+MG132, we are able to insoluble particles from nucleus and cytoplasm. These results
detect cells transformed with DNCK2b1 after 24 h of treatment, suggest that CK2b1-Myc is able to shift CK2a1-GFP from nuclear
indicating that proteasome inhibition protects DNCK2b1 from fraction to insoluble aggregates in both nucleus and cytoplasm.
degradation.
Discussion
Localization of CK2a1/CK2b1 holoenzyme is different
Land plant CK2b subunits show distinctive features from their
from its CK2 individual subunits
eukaryotic counterparts, including the formation of expanded
Different localization of plant CK2 subunits have been
families, shorter C-terminal domains and longer N-terminal
previously demonstrated [16]. In maize all CK2a subunits
domains. Preliminary in-silico analysis of the plant specific N-
described to date (CK2a1 to CK2a3) present nuclear localization
terminal domain indicates that it presents no homology with other
with high accumulation in nucleolus; whereas CK2b1 and CK2b2
protein or domains either in sequence or in structure. In addition,
are mainly located in nuclear speckles and CK2b3 can be found in
both nucleus and cytoplasm [15]. However, nothing is known prediction programs were unable to determine a secondary
about plant CK2 holoenzyme localization. To investigate that, we structure for this domain. In an attempt to understand the role
conducted Bimolecular Fluorescence Complementation (BiFC) and functionality of this domain in plants, we performed a
assays in agroinfiltrated tobacco leaves [31,32]. In that system, complete sequence analysis. The domain is arranged through
CK2a1 and CK2b1 split YFP tagged proteins must interact in vivo short, conserved motifs, many of them putatively corresponding to
to reconstitute YFP fluorescence. In CK2 heterotetramer the two specific kinase phosphorylation sites, including CK2 autophos-
CK2b subunits associate as a stable dimer in the core of the phorylation sites. The domain may have evolved through the gain
holoenzyme whereas the two CK2a are located in the external and loss of short conserved motifs, resulting in a mosaic pattern.
part without interacting among themselves [29]. Using BiFC we The occurrence of N-terminal extensions is not exclusive of land
show that CK2b1 subunits dimerize and present the same nuclear plants, having been also found in fungi, intracellular protozoan
speckled localization described for CK2b1 fused to GFP parasites and algae. However, we did not found any protein or
(Figure 5A). Interestingly, the CK2 holoenzyme CK2a1/CK2b1 domain outside land plant CK2bs showing significant identity at
is located not only in nucleus but also in cytoplasmic aggregates the sequence level with the N-terminal domain. Moreover,
(Figure 5B). Next, we performed BiFC reconstituting the phylogenetic analysis shows a separated clade clustering all land
holoenzyme with CK2a1 and DNCK2b1. As expected, plant CK2b subunits. As expected, green and red algae CK2b
DNCK2b1 interacted with split CK2a1, being also found in sequences clustered at the base of the land plant clade. However,
nucleus and cytoplasm, as in the case of CK2a1/CK2b1 branching of the single representative from the red algae
holoenzyme (Figure 5B). To confirm the presence of the CK2 Cyanidioschyzon merolae, which diverged from other photosynthetic
holoenzyme in the cytoplasm, we perform an alternative approach eukaryotes 1.5 billion years ago, was less bootstrap supported [33].
by co-transfecting tobacco leaves with CK2a1-GFP and CK2b1 Also protists and fungi are separated from land plants in both
fused to a non-fluorescence tag (Myc). This method allows to verify phylogenetic trees, in accordance to previously reported data that
that the fluorescence signal detected in the cytoplasm is due to the demonstrate the early diverging evolution of CK2b from plants
presence of CK2a1-GFP in this compartment. Since CK2a1- [34]. Furthermore, the exon/intron structure of genomic sequenc-
GFP/CK2b1-Myc holoenzyme is also located in nucleus and es encoding for the CK2b N-terminal domain was absolutely
cytoplasm, we confirmed that CK2b1-Myc is able to modify conserved in all land plant CK2b genes analyzed. All together,
CK2a1-GFP localization from nucleus/nucleolus to nucleus and these results support the independent acquisition of the N-terminal
cytoplasm aggregates. In addition, we have used plants co- domain by land plants as a single exon. Further evolutionary
transfected with CK2a1-GFP/CK2b1-Myc to perform subcellular diversification of land plant CK2b would have involved differen-
fractionation and Western blot analysis using anti-GFP antibody tial gene family expansion, which may have promoted the
(Figure 5C). In control plants overexpressing CK2a1-GFP alone, acquisition of additional functional specificities by multiplying
Figure 3. Subcellular localization of CK2b1-GFP and DNCK2b1-GFP in maize immature embryos (10 DAP) and Agrobacterium-
infiltrated tobacco leaves. (A) Epifluorescence and bright-field images (merged with epiflourescence) (606) of 10 DAP embryos cells transformed
by particle bombardment with the indicated constructs (CK2b1–GFP, DNCK2b1-GFP and GFP alone). (B) Upper, General views (406) of Nicotiana
benthamiana leaves infiltrated with a mixture of Agrobacterium suspensions harbouring the indicated constructs (CK2b1–GFP, DNCK2b1-GFP and
GFP alone) and the gene silencing suppressor HcPro. Bottom, Quantification of cells presenting speckled pattern in cells transformed with CK2b1 and
DNCK2b1. The graphic representation correspond to average for data corresponding to 3 independent experiments 6SD (n = 100).
doi:10.1371/journal.pone.0021909.g003
Figure 4. Protein degradation of CK2b1 and DNCK2b1. (A) Immunodetection of CK2b1-GFP protein and DNCK2b1-GFP protein in transformed
N. benthamiana leaves using anti-GFP antibody. Protein extracts were incubated at 30uC in an in vitro degradation buffer (see Experimental
procedures) with or without proteasome inhibitor (MG132) for the indicated time (min). 30 mg of total protein was loaded onto gels. 60+I indicates
extracts treated with 100 mM MG132. Each signal strength was measured by Quantity One and plotted in the right panel as the relative amount of
remaining protein. Quantitative data (mean 6SD) represent three independent experiments. (B) General views (406) of Nicotiana benthamiana
leaves infiltrated with CK2b1-GFP and DNCK2b1-GFP with different treatments: control, cycloheximide treatment (CHX, 50 mM), and CHX (50 mM)+
proteasome inhibitor MG132 (100 mM) combination treatment after 4 and 24 hours. The images shown are representative of more than 5
independent experiments.
doi:10.1371/journal.pone.0021909.g004
Figure 5. Subcellular localization of CK2 individual subunits and CK2 holoenzyme in leaf epidemis of N. benthamiana plants.
(A) General views (406) of Nicotiana benthamiana leaves co-infiltrated with a mixture of Agrobacterium suspensions harbouring the indicated
constructs: CK2a1-GFP (left), YFPN-CK2b1/YFPC-CK2b1 (right) together with gene silencing suppressor HcPro. (B) General views (406) of Nicotiana
benthamiana leaves co-infiltrated with Agrobacterium containing the gene silencing suppressor HcPro and the following pair constructs: YFPN-
CK2a1/YFPC-CK2b1 (left), YFPN-CK2a1/YFPC-DNCK2b1 (middle), and CK2a1-GFP/CK2b1-Myc (right). In panel A and B upper correspond to
epifluorescence images and bottom to bright-field images (merged with epiflourescence). (C) Immunodetection of CK2a1-GFP and CK2b1-GFP
proteins using anti-GFP antibody in N. benthamiana leaves transformed with CK2a1-GFP, CK2a1-GFP/CK2b1-Myc and CK2b1-GFP. C corresponds to
cytosolic fraction, N to nuclear fraction and I to insoluble fraction (including nuclear and cytosolic aggregates).
doi:10.1371/journal.pone.0021909.g005
the number of putative regulatory networks in which they could be domain in enhancing CK2b1 aggregation in nuclear speckles,
involved. where the protein is assumed to be tightly complexed and less
Despite of the elucidation of maize CK2a catalytic structure, no accessible to degradation machinery. Nevertheless, although the N-
structure for the plant CK2b regulatory subunit has been reported terminal domain can be considered as an ‘‘enhancer’’ of CK2b1
to date. Here, by using a two-hybrid approach we show that the protein aggregation, it is not essential since DNCK2b1 can also
CK2b N-terminal domain did not affect intra-molecular (CK2a/b aggregate. Thus, we can consider that aggregation in nuclear
or CK2b/b) holoenzyme interactions. These results indicate that speckles protects CK2b1 against fast degradation by proteasome
the N-terminal domain is located in the external part of the even though the protein is eventually degraded.
holoenzyme, although structural studies such as the crystallization In human cells, CK2b is normally expressed at a higher level
of the CK2b regulatory subunit would be needed to localize it with than CK2a catalytic subunits, allowing part of CK2b to be
greater precision. incorporated and stabilized into CK2 tetramers, whereas the
Most animal CK2b subunits are autophosphorylated only at excess CK2b is rapidly degraded with a half-life of less than 1 h
two highly conserved residues, Ser2 and Ser3 [35]. This consensus [41]. Our results indicate that maize CK2b1 regulatory subunits
is only partially conserved in plants: in all plant species Ser2 is are more stable than their animal counterparts probably due to
conserved as Ser residue (Ser83 in maize CK2b1), but Ser3 is their aggregation in nuclear speckles. Since the nature of these
replaced in all plant sequences analyzed by acidic residues (Asp or aggregates remains unclear, further experiments should be done to
Glu). In contrast to animals, land plant CK2b subunits present elucidate their composition and functional role.
additional putative autophosphorylation sites (motifs 1 and 5). For We have previously demonstrated that different localization of
instance, maize CK2b1 has five additional Ser residues at the the individual maize CK2a and CK2b isoforms [15] but nothing
motif 1 of the N-terminal domain that might be targets for CK2 was known about holoenzyme localization in plants. Here by using
autophosphorylation. Motif 1 is rich in Asp and Glu residues and BiFC we show the in vivo localization of CK2 holoenzyme in plant
is one of the most conserved in all plant N-terminal sequences cells. Whereas individual subunits CK2a1 and CK2b1 present a
(Figure 1). In addition, CK2b1 subunits present additional Ser nuclear localization, the holoenzyme CK2a1/CK2b1 is assembled
residues located in the central core of the protein not present in in nucleus and is exported to the cytoplasm, where is complexed in
animal CK2b proteins. Our in vitro phosphorylation assays show aggregates. After analyzing the localization of the holoenzyme
that the holoenzyme reconstituted with CK2a1 and CK2b1 is reconstituted with DNCK2b1, we conclude that the N-terminal
higher autophosphorylated than the holoenzyme with CK2a1 and domain is not involved in this export to the cytoplasm. In
DNCK2b1 (Figure 2B). Moreover, the N-terminal domain alone is mammals it has recently been reported that CK2b regulatory
highly phosphorylated by CK2a1 in vitro. Taken together, these subunits are required for the export of the holoenzyme as an
results suggests that the putative CK2 consensus sites located in the ectokinase bound to the external surface of the cell membrane
N-terminal domain are functional and might be involved in [42]. The same authors postulate a role of CK2b exporting not
regulating CK2 activity. In vitro phosphorylation assays showed only CK2a but other CK2 interacting proteins. Our results
that when the holoenzyme is reconstituted with CK2a1 and implicate CK2b in the shift from nucleus/nucleolus to cytoplasm
DNCK2b1 the phosphorylation of several substrates is enhanced. of CK2a subunits in plants. Further experiments may elucidate
These results point towards a possible role of the N-terminal whether this export mechanism also involves other proteins.
domain of CK2b down-regulating CK2a subunit activity. The In conclusion, our research shed new light on the regulation of
competition assays using the N-terminal fragment support this protein kinase CK2 in plants. The whole amount of data shown in
hypothesis. The N-terminal extension of the protist Plasmodium this work suggests that the plant-specific N-terminal domain of
falciparum has also been postulated to act as a down-regulator of CK2b subunits was acquired in plants, as a single exon, for
CK2a subunits [36], even though our analysis supports the regulatory purposes, particularly in terms of regulation of
independent origin of the N-terminal domain of land plant CK2b. holoenzyme activity and stabilization.
The greater efficiency of the maize holoenzyme without the N-
terminal domain is also consistent with the results of our previous Materials and Methods
studies comparing human vs. maize holoenzyme, which demon-
strated a high stability and high specific activity of human CK2 Plant CK2b regulatory subunits sequence analysis
holoenzyme (without N-terminal domain) compared to its maize Search for CK2b protein sequences was performed through
counterpart [23]. It has been recently reported that a splicing BLAST and HMMER [43,44]. Protein sequences were aligned
variant of maize CK2a1 (named CK2a-4) could act as a specific using CLUSTALW and MUSCLE and the resulting alignments
negative regulator of CK2 activity [37]. Taken together, all these further edited through the MEGA 4.0 Alignment Explorer tool
results suggest that maize CK2 activity could be regulated by [45–47]. The MEME v. 3.5.7 tool was used to search for repeated
different mechanisms involving both CK2a/b subunits. sequence patterns (motifs) conserved across proteins [48]. Settings
Functional studies were performed in order to assess whether the were changed to search for short motifs (3–20 aminoacids)
presence of the N-terminal domain has a role in regulation of CK2b showing any number of repetitions per sequence and position
subcellular localization. Our results show that maize CK2b1 is (p-values,1e-4). Search for functional domain and motifs was
highly prone to aggregation in nuclear speckles and the deletion of performed through the PROSITE and INTERPRO databases
N-terminal domain decreases this accumulation of CK2b1 in stable [49]. NetPhosK v1.0 server was used to predict kinase specific
nuclear aggregates. It has been reported for other proteins such as phosphorylation sites [50]. The location, distribution and phases of
mammalian PGC-1a and transcription factor ATF4 that aggrega- introns at the genomic sequences encoding for the N-terminal
tion in nuclear bodies protects against proteasome degradation CK2b domain were determined using GENEWISE [50,51].
[38,39]. Here we show that maize CK2b1 is also degraded by the Phylogenetic analyses performed are detailed in Text S1.
ubiquitin-dependent proteasome pathway as described for Arabi-
dopsis CK2b4 [40]. Interestingly, cell-free degradation assays show Yeast two-hybrid assays
that deletion of the N-terminal domain increases the rate of CK2b1 The Matchmaker two-hybrid system (Clontech) was used to
protein degradation. Our findings indicate a role for the N-terminal perform yeast two-hybrid assays. For the two-hybrid assays,
truncated versions of CK2b1 (del1 DNCK2b1 (80–276) del2 (180– lon-P membranes (Millipore) and incubated with purchased
276), and del3 N-terminal domain (1–80)) were generated by PCR antibodies against GFP (Invitrogen). The immunocomplexes were
and cloned into pGBT9 or pGBTK7 vectors into EcoRI/SalI revealed using the ECL detection kit system (Super Signal West
sites. The specific primers used were detailed in Table S5. The Femto, Pierce). Subcellular fractionation was done according to
other two-hybrid constructs used in the assays (pGBT9-CK2b1, [38]. Briefly, transformed tobacco leaves were excised, ground in
pGAD424-CK2b1 and pGAD424-CK2a2) were previously de- liquid nitrogen and resuspended in hypotonic buffer (10 mM
scribed in [20]. Yeast (AH109 strain) transformation was HEPES, pH 7.9, 10 mM KCl, 0.1 mM EDTA, 0.1 mM EGTA,
performed according to the manufacturer’s instructions. Yeast 1 mM dithiothreitol, and a protease inhibitor cocktail (1.6 mM
cells were cotransformed with the different pairs of BD-AD aprotinin, 50 mM leupeptin, 1 mM pepstatin, 10 mM E-64 and
constructs and transformants were selected on minimal synthetic 1 mM PMSF)). The extracts were homogenized and centrifuged at
dropout medium (SD) -Leu-Trp (SD-LT). To test for protein- 10,000 rpm for 1 min. The supernatant was collected as the
protein positive interaction, independent colonies were transferred cytosolic fraction (C). The pellet was extracted in a high salt buffer
to SD- -Leu-Trp-His-Ade (SD-LTHA). (20 mM HEPES, pH 7.9, 400 mM NaCl, 1 mM EDTA, 1 mM
EGTA, 1 mM dithiothreitol, and a protease inhibitor cocktail), and
Recombinant protein expression and purification and in the soluble fraction was collected as nuclear extracts following
another centrifugation (N). The remaining insoluble pellet was
vitro autophosphorylation and CK2 activity assays
resuspended in SDS lysis buffer (I).
For expression and purification of recombinant CK2b proteins,
the cDNAs of full-length CK2b1, del1 DNCK2b1 (80–276) and
del3 N-terminal domain (1–80) were digested from pGBT9/ Transient expression of GFP fusions in maize, Nicotiana
pGBTK7 vectors using EcoRI/SalI sites and cloned in expression benthamiana leaves and onion cells
vector pGEX-4T-1 in frame to GST protein. The constructs were For transient expression of GFP fusions in maize, tobacco and
transformed into E.coli BL21(DE), and the proteins were expressed onion cells CK2b1 and del1 DNCK2b1 cDNAs were amplified by
and purified as GST (Glutathione-S-Transferase) fusions as PCR using specific primers (Table S5) and cloned into binary vector
previously described [20] and according manufacturer’s manual. pCAMBIA1302 under the control of a CamV 35S promoter and
Protein concentration of purified proteins (GST-CK2b1, GST- fused in the 39 region with the GFP using BglII-SpeI sites for CK2b1
DNCK2b1 and GST-N-terminal domain) was determined by and BglII site for DNCK2b1. Additionally, the cDNA CK2b1 was
Bioanalyzer methods (Agilent technology) according to the amplified by PCR using specific primers (Table S5) and cloned in
manufacturer’s instructions. pLOLA vector [52] into BglII site in frame with Myc tag. The
For the in vitro autophosphorylation assay, the holoenzymes fusion CK2b1-Myc was transferred to pCAMBIA2300 using KpnI
CK2a1/CK2b1 and CK2a1/DNCK2b1 were reconstituted using restriction site. For maize transformation immature maize embryos
about 1 mm long were aseptically dissected from ears of field-grown
100 ng CK2a1 (Kinase Detect, Denmark) and 400 ng of GST-
maize plants (AxBxB73) after 10 days of pollination (10 DAP).
CK2b1 or GST-DNCK2b1 in a total volume of 30 ml CK2 buffer
Isolated embryos were placed o/n at 24uC in plates containing MS
(8.9 mM MgCl2, 0.5 mM EGTA, 27 mM b-glycerol phosphate,
medium supplemented with 2.2 mg/L of 2,4D. 4 h before
0.5 mM EDTA, 1 mM DTT, 0.08 mM ATP, 3 mCi of
transformation embryos were moved to MS plates with 16 g/L of
[c-33P]ATP (3000 Ci/mmol). In the case of the CK2 activity
mannitol and were transiently transfected with GFP constructs by
assays, the holoenzymes CK2a1/CK2b1 and CK2a1/DNCK2b1
particle bombardment using the Biolistic PDS-1000/He Particle
were reconstituted as described for the autophosphorylation assays
Delivery System (Bio-Rad). Plasmid DNA containing the different
and 0.6 mg of the different substrates tested (b-casein, GST-N-
constructs was precipitated onto gold particles using CaCl2 and
terminal domain, Rab17 or ZIM-like)were added to the reaction.
spermidine, and 1.5 mg DNA was delivered into intact maize tissue.
In the competition assays, increasing amounts of N-terminal
After 24 h, the fluorescence of the bombarded cells were viewed
domain (1–80) (from 0.2 to 0.8 mg) were added to the reaction
using a FV 1000 confocal microscope (Olympus, http://www.
containing CK2a1/DNCK2b1 holoenzyme and 0.6 mg of b- olympus.com/).The same methodology was used to visualize the
casein, Rab17 or ZIM-like as substrates. In all cases, the samples GFP fusion protein in epidermal onion cells. Young, fully expanded
were incubated for 30 min at 30uC. Reactions were stopped by leaves from 5 week old tobacco plants were transiently transfected
addition of electrophoresis sample buffer, and the phosphorylated with Agrobacterium tumefaciens GV3101/pMP90 transformed with the
proteins were separated by 12% SDS–PAGE, visualized by GFP construct together with the silencing suppressor HcPro as has
PhosphoImager analysis and the intensity of the phosphorylated been described in [30,31]. After 3–4 days, infiltrated areas from
bands obtained was quantified by Quantity One (Bio-Rad) leaves were excised and examined by FV 1000 confocal microscopy
software according the manufacturer’s suggestions. (Olympus). For treatment with cycloheximide (CHX) and protease
inhibitor MG132 leaves were excised and placed in sealed Petri
Cell-free degradation assays, western blot analysis and dishes submerged into the solutions containing CHX 50 mM and
subcellular fractionation MG132 100 mM in 2 ml of phosphate buffer. Treated and control
The in vitro cell-free degradation assays was modified from [40]. samples were ground in liquid nitrogen and resuspended in buffer A
0.2 g transformed N. benthamiana leaves with CK2b1-GFP and (50 mM Tris-HCl pH 7.5, 100 mM NaCl, 10 mM MgCl2, 5 mM
DNCK2b1-GFP were ground in liquid nitrogen and resuspended DTT, 5 mM ATP, and protease inhibitor cocktail) and analyzed by
in buffer A (50 mM Tris-HCl pH 7.5, 100 mM NaCl, 10 mM Western blot analysis as described above.
MgCl2, 5 mM DTT and 5 mM ATP). Equal amounts of extracts
were transferred to individual tubes and incubated at 30uC and Bimolecular fluorescence complementation (BiFC) assays
aliquots were taken at 20, 40 and 60 min. One aliquot was For BiFC assays, the cDNAs corresponding to the CK2a1, CK2b1
incubated with 100 mM of protein inhibitor MG132 (Enzo, Life and DNCK2b1 were cloned in the GATEWAY-compatible vector
Sciences, Inc.) for 1 h at 30uC. Reactions were stopped by adding pENTRY3C (Invitrogen). The cDNA CK21 was amplified by PCR
protein gel-loading buffer. For Western blot analysis, proteins were using the specific primers detailed in Table S5 and the PCR fragment
electrophoresed on 12% SDS-PAGE gels, transferred to immobi- was cloned into BamHI-XhoI sites The cDNAs of full-length CK2b1,
and del1 DNCK2b1 (80–276) were digested from pGBT9 vector displayed next to the corresponding nodes. The tree is drawn to
using EcoRI/SalI sites and transferred to pENTRY3C. The three scale, with branch lengths proportional to evolutionary distances.
pENTRY3C plasmids were recombined by Gateway reaction into The scale bar indicates the estimated number of amino acid
pYFPN43 and pYFPC43 vectors (kindly provided by A. Ferrando, substitutions per site.
University of Valencia, Spain, http://www.ibmcp.upv.es/Ferrando (PDF)
LabVectors.php.) to produce YFPN-CK2b1, YFPC-CK2b1, YFPN-
Figure S2 Unrooted Neighbor Joining phylogenetic tree of
CK2a1 and YFPC-DNCK2b1. Transformation of N.benthamiana
CK2b regulatory subunits. The tree is based on the CLUSTAL
leaves and visualization was performed as described above for
alignment of 69 CK2b protein sequences. The clade clustering land
transient expression of GFP fusions.
plant CK2b is indicated. Non-land plant CK2b showing N-terminal
extensions are in bold. Bootstrap values are displayed next to the
Supporting Information corresponding nodes. The tree is drawn to scale, with branch lengths
Text S1 Phylogenetic analysis of CK2b regulatory proportional to evolutionary distances. The scale bar indicates the
subunits. Phylogenetic analyses were performed on the basis of estimated number of amino acid substitutions per site.
amino acid sequence alignments using two independent methods: (PDF)
Neighbor Joining (NJ) and Maximum Likelihood (ML). NJ Figure S3 Quantification of Rab17 and b-casein phos-
analyses were implemented in MEGA 4.0 using the default phorylation with CK2a1/DNCK2b1 holoenzyme and in-
settings [47] Prior to ML analysis; the best-fitting amino acid creasing amounts of CK2b1 N-terminal domain (1–80).
substitution model was selected using the Akaike information Relative phosphorylation of Rab17 and b-casein with the
criterion as implemented in ProtTest v1.4 [26]. The resulting holoenzyme composed by CK2a1/DNCK2b1 with increasing
model: JTT with (i) an estimated proportion of invariable sites and amounts of CK2b1 N-terminal domain (1–80) compared to
(ii) a heterogeneous distribution of substitution rates across phosphorylation of both substrates with CK2a1/DNCK2b1
proteins with eight categories and an estimated shape parameter, holoenzyme alone (assigned a value of 1). The data plotted (mean
was implemented in PHYML v3.0 to infer ML trees, using the 6SD) represent three independent experiments.
subtree pruning and regrafting option to optimize tree topology (PDF)
searching [27–29]. To provide confidence on the resulting tree
topology, a bootstrap analysis with 1,000 and 100 replicates in NJ Figure S4 Subcellular localization of CK2b1-GFP and
and ML analyses, respectively, was performed. DNCK2b1-GFP in Agrobacterium-infiltrated tobacco
(DOC) leaves and onion cells. (A) Upper and middle panels show
detail of fluorescent nucleus (606) of cells from tobacco leaves
Table S1 Summary of genome databases searched for infiltrated with a mixture of Agrobacterium suspensions harbouring
CK2b protein kinases. the indicated constructs (CK2b1–GFP, DNCK2b1-GFP) and the
(DOC) gene silencing suppressor HcPro. In upper panel right, a confocal
Table S2 Summary of 34 land plant CK2b sequences. image of nuclear DAPI staining of cells transformed with CK2b1–
Sequence identifier refers to the UNIPROT database, excepting GFP is shown (606). General views (406) of control cells
for species examined independently, in which case the accession infiltrated with GFP alone and HcPro are shown in the bottom
from the corresponding database was indicated (Table S1). The * of the panels. (B) Detail of fluorescent nucleus (606) of onion cells
designs sequence incomplete at its N-terminal end. Some genes transformed with CK2b1–GFP and DNCK2b1-GFP by particle
have been identified to encode for alternatively spliced variants. In bombardment. General views of onion cells (406) transformed
such cases, only a single representative protein sequence is shown. with GFP alone are shown on the right. In all cases epifluorescence
(DOC) and bright-field images (merged with epiflourescence) are shown.
(TIF)
Table S3 Summary of 7 algae, 14 animal, 12 fungal and
2 protists CK2b sequences from representative species. Figure S5 Immunodetection of CK2b1-GFP protein and
Sequence identifier refers to the UNIPROT database, excepting DNCK2b1-GFP protein in transformed N. benthamiana
for species examined independently, in which case the accession leaves using anti-GFP antibody. (A) Control and Cyclohex-
from the corresponding database was used (Table S1). The * imide treatment (CHX, 50 mM). Aliquots have taken at different
indicates sequences incomplete at its N-terminal end. times (309, 1 h, 2 h and 4 h) (B) Control, Cycloheximide treatment
(DOC) (CHX, 50 mM) and proteasome inhibitor MG132 (100 mM).
Aliquots have taken at different times (4 h and 8 h). In all analysis,
Table S4 Summary of conserved motifs identified by
30 mg of total extracts has been loaded. The hybridation against
MEME in plant CK2b subunits. Matches of motifs with
Rubisco protein is shown as loading control.
specific kinase phosphorylation sites, predicted by NetPhos K v1.0
(TIF)
and PROSITE searches are shown. DNAPK: DNA activated
protein kinase, CDC2: Cell division cycle 2, RSK: 90 kDa
ribosomal S6 kinase, TK: Tyrosine kinase, ATM: Ataxia Acknowledgments
Telangiectasia-Mutated. We thank Dr A. Ferrando for kindly providing the BiFC GATEWAY-
(DOC) modified vectors before publication, Dr. J. López-Moya for p35S::HcPro,
M.Capellades for help in maize embryo bombardment and Imma Perez-
Table S5 List of primers used in this study. Salamó for help in two-hybrid experiments.
(PDF)
Figure S1 Unrooted Maximum Likelihood phylogenetic Author Contributions
tree of CK2b regulatory subunits. The tree is based on the Conceived and designed the experiments: MR MP. Performed the
CLUSTAL alignment of 69 CK2b protein sequences. The clade experiments: MR SI ICV-B LC-P. Analyzed the data: MR SI ICV-B
clustering land plant CK2b is indicated. Non-land plant CK2b LC-P. Contributed reagents/materials/analysis tools: MR SI ICV-B LC-P.
showing N-terminal extensions are in bold. Bootstrap values are Wrote the paper: MR VL LC-P MP.
References
1. Meggio F, Pinna LA (2003) One-thousand-and-one substrates of protein kinase 27. Jones DT, Taylor WR, Thornton JM (1992) The rapid generation of mutation
CK2? FASEB J 17: 349–368. data matrices from protein sequences. Comput Appl Biosci 8: 275–282.
2. Litchfield DW (2003) Protein kinase CK2: structure, regulation and role in 28. Guindon S, Gascuel O (2003) A simple, fast, and accurate algorithm to estimate
cellular decisions of life and death. Biochem J 369: 1–15. large phylogenies by maximum likelihood. Syst Biol 52: 696–704.
3. Meggio F, Boldyreff B, Marin O, Pinna LA, Issinger OG (1992) Role of b 29. Guindon S, Dufayard JF, Lefort V, Anisimova M, Hordijk W, et al. (2010) New
subunit of casein kinase-2 on the stability and specifity of the recombinant algorithms and methods to estimate maximum-likelihood phylogenies: assessing
reconstituted holoenzyme. Eur J Biochem 204: 293–297. the performance of PhyML 3.0. Syst Biol 59: 307–321.
4. Bibby AC, Litchfield DW (2005) The multiple personalities of the regulatory 30. Graham KC, Litchfield DW (2000) The regulatory beta subunit of protein
subunit of protein kinase CK2: CK2 dependent and CK2 independent roles kinase CK2 mediates formation of tetrameric CK2 complexes. J Biol Chem 275:
reveal a secret identity for CK2b. Int J Biol Sci 1: 67–79. 5003–5010.
5. Bolanos-Garcia VM, Fernandez-Recio J, Allende JE, Blundell TL (2006) 31. Bracha-Drori K, Shichrur K, Katz A, Oliva M, Angelovici R, et al. (2004)
Identifying interaction motifs in CK2b-a ubiquitous kinase regulatory subunit. Detection of protein–protein interactions in plants using bimolecular fluores-
Trends Biochem Sci 31: 654–661. cence complementation. Plant J 40: 419–427.
6. Niefind K, Guerra B, Ermakova I, Issinger OG (2001) Crystal structure of 32. Walter M, Chaban C, Schütze K, Batistic O, Weckermann K, et al. (2004)
human protein kinase CK2: insights into basic properties of the CK2 Visualization of protein interactions in living plant cells using bimolecular
holoenzyme. EMBO J 20: 5320–5331. fluorescence complementation. Plant J 40: 428–438.
7. Faust M, Montenarh M (2000) Subcellular localization of protein kinase CK2. 33. Yoon HS, Hackett JD, Ciniglia C, Pinto G, Bhattacharya D (2004) A molecular
Cell Tissue Res 301: 329–340. timeline for the origin of photosynthetic eukaryotes. Mol Biol Evol 21: 809–818.
8. Filhol O, Nueda A, Martel V, Gerber-Scokaert D, Benitez MJ, et al. (2003) Live- 34. Pyerin W, Ackermann K (2003) The genes encoding human protein kinase CK2
cell fluorescence imaging reveals the dynamics of protein kinase CK2 individual and their functional links. Progr Nuclear Acid Res Mol Biol 74: 239–273.
subunits. Mol Cell Biol 23: 975–987. 35. Litchfield DW, Lozeman FJ, Cicirelli MF, Harrylock M, Ericsson LH, et al.
9. Lee Y, Lloyd AM, Roux SJ (1999) Antisense expression of the CK2 alpha- (1991) Phosphorylation of the beta subunit of casein kinase II in human A431
subunit gene in Arabidopsis. Effects on light-regulated gene expression and plant cells. Identification of the autophosphorylation site and a site phosphorylated by
growth. Plant Physiol 119: 989–1000. p34cdc2. J Biol Chem 266: 20380–20389.
10. Sugano S, Andronis C, Ong MS, Green RM, Tobin EM (1999) The protein 36. Holland Z, Prudent R, Reiser J-B, Cochet C, Doerig C (2009) Functional
kinase CK2 is involved in regulation of circadian rhythms in Arabidopsis. Proc analysis of protein kinase CK2 of the human malaria parasite Plasmodium
Natl Acad Sci USA 96: 12362–123626. falciparum. Eukaryotic Cell 8: 388–397.
11. Portolés S, Más P (2007) Altered oscillator function affects clock resonance and is 37. Lebska M, Szczegielniak J, Dobrowolska G, Cozza G, Moro S, et al. (2009)
responsible for the reduced day-length sensitivity of CKB4. Plant J 51: 966–977. A novel splicing variant encoding putative catalytic alpha subunit encoding
putative catalytic alpha subunit of maize protein kinase CK2. Physiol Plant 136:
12. Espunya MC, Combettes B, Dot J, Chaubet-Gigot N, Martinez MC (1999) Cell-
251–263.
cycle modulation of CK2 activity in tobacco BY-2 cells. Plant J 19: 655–666.
38. Sano M, Tokudome S, Shimizu N, Yoshikawa N, Ogawa C, et al. (2007)
13. Moreno-Romero J, Espunya MC, Platara M, Ariño J, Martı́nez MC (2008)
Intramolecular control of protein stability, subnuclear compartmentalization,
A role for protein kinase CK2 in plant development: evidence obtained using a
and coactivator function of peroxisome proliferator-activated receptor gamma
dominant-negative mutant. Plant J 55: 118–130.
coactivator 1alpha. J Biol Chem 282: 25970–25980.
14. Hidalgo P, Carretón V, Berrı́os CG, Ojeda H, Jordana X, et al. (2001) Nuclear
39. Lassot I, Estrabaud E, Emiliani S, Benkirane M, Benarous R, et al. (2005) p300
Casein Kinase 2 Activity Is Involved in Early Events of Transcriptional
modulates ATF4 stability and transcriptional activity independently of its
Activation Induced by Salicylic Acid in Tobacco. Plant Physiol 125: 396–405.
acetyltransferase domain. J Biol Chem 280: 41537–41545.
15. Riera M, Figueras M, López C, Goday A, Pagès M (2004) Protein kinase CK2 40. Perales M, Portolés S, Más P (2006) The proteasome-dependent degradation of
modulates developmental functions of the abscisic acid responsive protein Rab17 CKB4 is regulated by the Arabidopsis biological clock. Plant J 46: 849–860.
from maize. Proc Natl Acad Sci USA 101: 9879–9884. 41. Lüscher B, Litchfield DW (1994) Biosynthesis of casein kinase II in lymphoid cell
16. Salinas P, Fuentes D, Vidal E, Jordana X, Echeverria M, et al. (2006) An lines. Eur J Biochem 220: 21–26.
extensive survey of CK2 alpha and beta subunits in Arabidopsis: multiple isoforms 42. Rodrı́guez FA, Contreras C, Bolanos-Garcia V, Allende JE (2008) Protein kinase
exhibit differential subcellular localization. Plant Cell Physiol 47: 1295–1308. CK2 as an ectokinase: the role of the regulatory CK2b subunit. Proc Natl Acad
17. Dennis MD, Browning KS (2009) Differential Phosphorylation of Plant Sci USA 105: 5693–5698.
Translation Initiation Factors by Arabidopsis thaliana CK2 Holoenzymes. 43. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, et al. (1997) Gapped
J Biol Chem 284: 20602–20614. BLAST and PSI-BLAST: a new generation of protein database search
18. Dobrowolska G, Boldyreff B, Issinger OG (1991) Cloning and sequencing of the programs. Nucleic Acids Res 25: 3389–3402.
casein kinase 2 a subunit from Zea mays. Biochem Biophys Acta 1129: 139–140. 44. Durbin R, Eddy SR, Krogh A, Mitchison G (1998) Biological Sequence
19. Peracchia G, Jensen AB, Culiáñez-Macià FA, Grosset J, Goday A, et al. (1999) Analysis: Probabilistic Models of Proteins and Nucleic Acids Cambridge
Characterization, subcellular localization and nuclear targeting of casein kinase University Press, Cambridge, UK.
II from Zea mays. Plant Mol Biol 40: 199–211. 45. Thompson JD, Gibson TJ, Plewniak F, Jeanmougin F, Higgins DG (1997) The
20. Riera M, Peracchia G, de Nadal E, Ariño J, Pagès M (2001) Maize protein CLUSTAL_X windows interface: flexible strategies for multiple sequence
kinase CK2: Regulation and functionality of three b regulatory subunits. Plant J alignment aided by quality analysis tools. Nucleic Acids Res 25: 4876–4882.
25: 365–374. 46. Edgar RC (2004) MUSCLE: multiple sequence alignment with high accuracy
21. Niefind K, Guerra B, Pinna LA, Issinger OG, Schomburg D (1998) : Crystal and high throughput. Nucleic Acids Res 32: 1792–1797.
structure of the catalytic subunit of protein kinase CK2 from Zea mays at 2.1 Å 47. Tamura K, Dudley J, Nei M, Kumar S (2007) MEGA4: Molecular Evolutionary
resolution. EMBO J 17: 2451–2462. Genetics Analysis (MEGA) Software Version 4.0. Mol Biol Evol 24: 1596–1599.
22. Niefind K, Raaf J, Issinger OG (2009) Protein kinase CK2 in health and disease: 48. Bailey TL, Williams N, Misleh C, Li WW (2006) MEME: discovering and
Protein kinase CK2: from structures to insights. Cell Mol Life Sci 66: analyzing DNA and protein sequence motifs. Nucleic Acids Res 34: 369–373.
1800–1816. 49. Apweiler R, Attwood TK, Bairoch A, Bateman A, Birney E, et al. (2001) The
23. Riera M, Pagès M, Issinger OG, Guerra B (2003) Purification and InterPro database, an integrated documentation resource for protein families,
characterization of recombinant protein kinase CK2 from Zea mays expressed domains and functional sites. Nucleic Acids Res 29: 37–40.
in Escherichia coli. Protein Expr Purif 29: 24–32. 50. Blom N, Sicheritz-Ponten T, Gupta R, Gammeltoft S, Brunak S (2004)
24. Riera M, Peracchia G, Pagès M (2001) Distinctive features of plant protein Prediction of post-translational glycosylation and phosphorylation of proteins
kinase CK2. Mol Cell Biochem 227: 119–127. from the amino acid sequence. Proteomics 4: 1633–1649.
25. Krogh A, Brown M, Mian IS, Sjölander K, Haussler D (1994) Hidden Markov 51. Birney E, Clamp M, Durbin R (2004) GeneWise and Genomewise. Genome Res
models in computational biology. Applications to protein modeling. J Mol Biol 14: 988–995.
235: 1501–1531. 52. Ferrando A, Farràs R, Jásik J, Schell J, Koncz C (2000) Intron-tagged epitope: a
26. Abascal F, Zardoya R, Posada Dv (2005) ProtTest: selection of best-fit models of tool for facile detection and purification of proteins expressed in Agrobacterium-
protein evolution. Bioinformatics 21: 2104–2105. transformed plant cells. Plant J 22: 553–560.
Abstract
Introduction
267
stress, among others (Riera et al., 2001b). However, plant CK2 presents specific
features that will be discussed in this chapter.
The CK2α catalytic subunits are highly conserved among eukaryotic organisms. In
Figure 9.1, the alignment between the four maize CK2α catalytic subunits and
human CK2α/α′ shows a high degree of identity. The following are present in plant
CK2α: characteristic CK2α domains as the Glycine loop, responsible for ATP
binding; the Lysine-rich cluster, involved in downregulation of the enzyme and
nuclear targeting; and the catalytic loop and the activation segment.
Striking differences between animal and plant CK2α are located in N-terminal
and C-terminal domains. In the N-terminal region of some plant CK2α sequences,
it has been described as the presence of chloroplast transit peptide (cTP). Chloro-
plastic CK2α (cpCK2α) isoforms were first described in mustard and Arabidopsis
(Ogrzewalla et al., 2002; Loschelder et al., 2004; Salinas et al., 2006). Using predic-
tion programs such as ChloroP or PSORT (http://www.cbs.dtu.dk/services/ChloroP/,
www.psort.org) these types of isoforms (containing the transit peptide cTP) have
been found in most higher plants (Turkeri et al., 2012). As summarized in Table 9.1,
no chloroplast CK2α isoforms have been found in genomes of lower plants (moss
and algae) that have been analyzed. Recent phylogenetic analysis suggests that regu-
lation through cpCK2 isoforms in plants appeared later in evolution (Turkeri et al.,
2012). The chloroplast phosphoproteome recently published reveals that cpCK2 is
a central regulator of different chloroplast functions, such as the control of the cross
talk between chloroplast gene expression and general metabolism and the mainte-
nance of chloroplast transcription apparatus (Reiland et al., 2009). As shown in Table
9.2, several chloroplastic proteins involved in transcriptional and post-transcriptional
regulation have been described as cpCK2 substrates, such as sigma factors AtSIG1,6
(Schweer et al., 2010a; Schweer et al., 2010b); preprotein receptor Toc159 (Agne
et al., 2010); transcriptionally active chromosome subunits (TAC) TAC16, TAC10,
and TAC5 (Reiland et al., 2009) as well as RNA-binding proteins RNP29 and
RNP33, 28RNP or p34, which phosphorylation has been implicated in the stabiliza-
tion of plastid mRNAs (Kanekatsu et al., 1993; Kanekatsu et al., 1995; Lisitsky and
Schuster 1995; Reiland et al., 2009). Furthermore, chloroplastic metabolic enzymes
such as carbonic anhydrase and ATP synthase or maize photosystem II subunit CP29
are also in vitro phosphorylated by CK2 (Testi et al., 1996; Kanekatsu et al., 1998;
Figure 9.1. Protein sequence alignment of catalytic CK2α subunits from Zea Mays. Maize
CK2α subunits ZmCK2α2 (GRMZM2G047855); ZmCK2α4 (GRMZM2G141903);
ZmCK2α1 (GRMZM2G143602) and ZmCK2α3 (GRMZM5G845755) were aligned
with CK2α (4503095) CK2α′ (4503097) subunits from Homo sapiens. ZmCK2α2
(GRMZM2G047855); ZmCK2α4 (GRMZM2G141903) present a chloroplast transit peptide
(cTP) in their N-terminal domain. The N-terminal region and functional domains conserved
K2 in these proteins are underlined. Invariant residues are indicated by *, similar residues by :,
and semi-conservative changes by ·.
269
K2
270
Pinna_3036_c09_main.indd 271
Name Type Specie Role Reference
Light-signal transduction pathway and circadian clock
AT-1 DNA binding factor Pea Binds to AT1-box elements in light Datta and Cashmore, 1989
regulated promoters
ATBP-1 DNA binding factor Pea Binds to AT1-box elements in light Tjaden and Coruzzi, 1994
regulated promoters
GBF1 bZIP TF Arabidopsis Binds to G-box elements in light Klimczak et al., 1995
regulated promoters
Opaque2 bZIP TF Maize Circadian clock regulated Ciceri et al., 1997
CCA1 Myb-related TF Arabidopsis Circadian clock regulator Sugano et al., 1998
LHY, OsLHY Myb-related TF Arabidopsis, Rice Circadian clock regulator Sugano et al., 1998; Ogiso
et al., 2010
HY5 bZIP TF Arabidopsis Promotes photomorphogenesis Hardtke et al., 2000
HFR1 bHLH TF Arabidopsis Promotes photomorphogenesis Park et al., 2008
271
8/28/2012 6:40:58 PM
K2
K2
272
Pinna_3036_c09_main.indd 272
Table 9.2. (Continued)
Name Type Specie Role Reference
Chromatin associated and nuclear proteins
lamin-like protein lamina matrix protein Pea Nuclear stability, chromatin Li and Roux, 1992
organization
MFP1 coil-coil protein Tomato Structural roles in nuclear matix and Meier et al., 1996; Samaniego
Allium cepa chloroplast et al., 2006
NopA64/nopA61 nucleolin-like phosphoproteins Allium cepa Located in nucleolus de Carcer et al., 1997
P-proteins Ribosomal proteins Maize Complex with 60S ribosomal Bailey-Serres, et al., 1997
subunits
DNA helicase I DNA helicase I Pea DNA transcription Tuteja et al., 2003
DNA topoisomerase I DNA topoisomerase I Pea DNA transcription Tuteja et al., 2003
HMGB proteins High mobility group B proteins Maize, Arabidopsis Chromatin associated proteins Stemmer et al., 2002
SSRP1 structure-specific recognition Maize Chromatin associated proteins Krohn et al., 2003
8/28/2012 6:40:58 PM
Name Type Specie Role Reference
Pinna_3036_c09_main.indd 273
Chloroplast machinery
Chloroplast Ribonucleoproteins Spinach Arabidopsis RNA binding proteins involved in Kanekatsu et al., 1993;
RNPs/28RNP/p34/ chloroplast RNA processing and Kanekatsu et al., 1995;
RNP29,33 stabilization Lisitsky et al., 1995; Reiland
et al., 2009
CP29 photosystem II subunit Maize Light harvesting complex Testi et al., 1996
TOC159 preprotein receptor Arabidopsis Import Agne et al., 2010
Nuclear-encoded chloroplast
preproteins from the cytosol
SIG1/SIG6 plastid sigma factors Arabidopsis Gene-regulatory proteins for Schweer et al., 2010
promoter binding and transcription
initiation
Others
273
8/28/2012 6:40:58 PM
K2
274 Specific Features of Plant CK2
Reiland et al., 2009). The cpCK2α isoforms present biochemical properties similar
to nuclear CK2 (Salinas et al., 2006; Schweer et al., 2010b; Turkeri et al., 2012).
Until now, the presence of CK2β subunits has not been described in chloroplast;
however, the catalytic activity of Arabidopsis cpCK2α is enhanced in the presence
of exogenous CK2β suggesting that cpCK2α could be somehow modulated by
CK2β regulatory subunits (Salinas et al., 2006).
As the case of human CK2α′, which is 40 amino acids shorter that human CK2α,
plant CK2α present a C-terminal region shorter that mammalian CK2 (Figure 9.1).
This specific characteristic of plant CK2α subunits gives them higher stability and
more specific activity than animal CK2α subunits and was one of the main reasons
why maize CK2α1 was the first CK2α catalytic subunit crystallized (Niefind et al.,
1998). Since then, most of the CK2α structures are based on the enzyme from Zea
mays, and the structure of maize CK2α (zmCK2α) in complex with the ATP-
analogue adenosine 5′-(β, γ-imido)-triphosphate (AMPPNP) and two magnesium
ions has been described as a functional reference structure (Niefind et al., 2009).
However, it has to be noticed that even though there is a degree of identity of more
that 77% between maize and human CK2, significant differences have been found
between both structures suggesting that plant enzymes can behave differently in
terms of regulation (Battistutta and Lolli, 2011).
For maize CK2α-1 gene, an alternative splicing isoform (named CK2α-4) has
been described and reported that could act as a specific negative regulator of CK2
activity (Lebska, 2009). In addition, other plant databases, such as those of Arabi-
dopsis and maize (http://www.arabidopsis.org, http://maizesequence.org), predict
alternative splicing variants for both CK2α/β subunits suggesting that this regula-
tory mechanism could be involved in CK2 gene regulation in plants.
As in the case of animals, plant CK2β subunits present three main properties: they
are inactive by themselves but can stimulate CK2α catalytic activity, they confer
stability to the enzyme, and they provide specificity for the interaction with sub-
strates and inhibitors. However, as shown in Figure 9.2, the level of identity between
the plant and human CK2β regulatory subunits is not as high as in the case of CK2α.
Despite the elucidation of the human CK2β subunit, holoenzyme and maize
CK2α structure (Niefind et al., 1998, 2001; Chantalat et al., 1999), no data exist
about CK2β or holoenzyme structure in plants. The human CK2β subunit is a
compact globular homodimer organized in seven α-helices and three β-sheets
(Chantalat et al., 1999). The tertiary structure predicted for the central core of maize
CK2β1 (82–276) almost overlaps with the human CK2β structure (1–197), indicat-
ing that, as in the case of catalytic subunits, plant and human CK2β are structurally
related (Veléz-Bermudez et al., 2011). All plant CK2β subunits preserve in their
central core the characteristic CK2β feature, the zinc finger region that contains four
conserved Cysteine residues involved in CK2β dimerization. But, as for the catalytic
subunits, there are distinctive features in plant CK2β located in the N-terminal
K2 region, in the acidic loop, and in the C-terminal domain. The CK2β subunits present
K2
275
a specific N-terminal extension of about ninety amino acids that share no homology
with any previously characterized functional domain. Most of the animal CK2β
subunits are autophosphorylated only at two highly conserved residues, Ser2 and
Ser3 (Litchfield et al., 1991). The functional significance of this autophosphorylation
is still unknown, but it appears that it may enhance CK2β stability (Zhang
et al., 2002). The N-terminal region of plant CK2β subunits present additional puta-
tive autophosphorylation sites. For instance, maize CK2β1 has five additional Serine
residues in this domain that are highly phosphorylated by CK2α1 in vitro. It was
recently demonstrated that the presence of plant-specific N-terminal domain in plant
CK2β subunits affects their CK2 activity, since this region competes with the sub-
strate for phosphorylation and can be described as a downregulator of the CK2α
activity (Riera et al., 2011).
Another characteristic of plant CK2β subunits is that the acidic loop region is
poorly conserved in plant sequences (Figure 9.2). In human CK2β subunits, the
acidic loop region (residues 55–64) has been described as a regulatory region since
it contains the binding domain for polyamines (Meggio et al., 1994). In maize, for
example, the amino acid composition of CK2β1 acidic loop differs from that of
human CK2β (Vélez-Bermúdez et al., 2011). There are only 3 acidic residues of 10,
and 2 of them are in the same position (136 DVESSHGDML 145). The maize acidic
loop presents high heterogeneity since contains different types of residues: basic (as
His), nonpolar (as Val, Gly, Leu, and Met), and polar (Ser). In animals, it has been
shown that mutations in residues in the acidic loop region affect the CK2 activity
(Leroy et al., 1997); therefore, it is likely that the differences found in this region
could also affect plant enzyme regulation.
The C-terminal domain of animals CK2β is only partially present in plant CK2β
(see alignment in Figure 9.2). The crystal structure of human holoenzyme demon-
strated that this region is involved in interaction with the catalytic subunits (Niefind
et al., 2001). This may imply that in plants the interaction between CK2α/β subunits
is weaker than in the case of CK2 human holoenzyme, probably affecting the bio-
chemical properties of plant CK2, as demonstrated by comparative studies between
maize and human CK2 holoenzymes, in which maize holoenzyme is less stable than
the human counterpart (Riera et al., 2003). The C-terminal region of human CK2β
also mediates the association with other kinases such as A-Raf, c-Mos, or the check-
point kinase Chk1 (Boldyreff and Issinger, 1997; Chen et al., 1997; Guerra et al.,
2003) and also this C-terminal region is phosphorylated by p34cdcd2 (Litchfield et
al., 1991). However, in plants, no interaction among CK2β and other kinases neither
CK2 phosphorylation by other kinases has been described so far.
CK2 Holoenzyme
It is noteworthy that both plant CK2α/β subunits belong to multigenic families with
high variability of members (Table 9.1).
The multiplicity of CK2αβ genes can be explained in most cases by gene dupli-
cation common in plants (Blanc et al., 2000), and the presence of pseudogenes
K2 cannot be excluded. For instance, in Arabidopsis, the genes coding for CK2α sub-
units αA At5g67380 and αB At3g50000 and the four genes encoding for CK2β
subunits (β1 to β4) are located in duplicated regions of the genome, suggesting that
they were generated by duplication events (Salinas et al., 2006). There is a high
variability in the number of CK2 genes between the species, for instance, unicellular
algae species showed from 1 to 3 CK2α genes and a single CK2β gene, while land
plants commonly showed three to five CK2α/β genes. Thus, it could be a possibility
that evolutionary expansion of the CK2α/β gene family is related to the acquisition
of multicellularity. In the case of CK2β subunits, phylogenetic analysis demonstrates
the early diverging evolution of CK2β from plants and the exon/intron structure
analysis of genomic sequences encoding for the CK2β suggests that their plant-
specific N-terminal domain was acquired in plants, as a single exon, for regulatory
purposes, particularly in terms of regulation of holoenzyme activity and stabilization
(Riera et al., 2011).
It has been clearly demonstrated for the mammalian CK2 enzyme that the CK2
tetramer is not a stable complex but a dynamic, transient heterocomplex that can be
subject to disassembly and reassembly being possible to find both individual sub-
units alone as tetrameric forms in different cell compartment and probably with
specific functions (Niefind et al., 2001). Moreover, the identification of several
CK2β-specific interacting proteins supports the idea that both subunits might have
biological functions other than those attributed to the CK2 holoenzyme (Bibby and
Litchfield, 2005).
In plants, the presence of multiple CK2α/β isoforms is unlikely to be redundant,
since specific functions have been associated to each isoform. In maize, for instance,
we have demonstrated that maize CK2α/β subunits assemble into a structural tetra-
meric complex that has very similar properties to those described in other organisms
(Graham and Litchfield, 2000), thus, while CK2α subunits are unable to self-
associate, preferential interactions between CK2α/β and CK2β/β isoforms exist
(Riera et al., 2001a). Furthermore, experiments conducted in Arabidopsis also show
that specific CK2 holoenzymes (composed with different isoforms) present differ-
ential substrate specificity toward several plant initiation factors (Dennis and
Browning, 2009; Dennis et al., 2009).
Several authors have reported tissue-specific distribution of plant CK2 subunits.
In A. thaliana, all CK2α/β subunits were constitutively expressed in the tissues
examined (inflorescences, stems, rosette leaves, and roots from 5-week-old plants)
but with different expression levels of their transcripts and interestingly, among the
four CK2α subunits, the chloroplastic isoform (cpCK2α) present the highest expres-
sion in all examined tissues (Salinas et al., 2006). The gene expression of CK2
subunits has also been analyzed during maize embryo development, and our results
indicate that while the expression of the nuclear isoforms as CK2α1 or CK2α3
subunits is quite constitutive, CK2β subunits are expressed differentially during
embryo development (Riera et al., 2001a). In BY-2 tobacco cells, differences in the
transcripts levels of CK2α and CK2β encoding genes throughout the cell cycle has
been described and correlates with the cyclic changes in CK2 activity also described
by the same group (Espunya et al., 1999; Espunya et al., 2005). In addition, by using
in situ hybridization, it has been shown that the spatial and temporal pattern of
expression of CK2α/β subunits correlates with the appearance of the meristems,
and high levels of transcripts are also present in differentiated tissues with high K2
mitotic activity (Espunya and Martinez, 2003).
Differential subcellular localization for each CK2α/β isoform has been described
in maize (Riera et al., 2001a; Riera et al., 2011) and Arabidopsis (Salinas et al.,
2006).
As shown in Figure 9.3, maize CK2α1 and CK2α3 isoforms present nuclear
localization with high accumulation in nucleolus; whereas CK2α4, which contains
the cTP signal, is located in chloroplasts. However, we cannot discard the possibility
that small pools of CK2α, undetectable by microscopy, may coexist in the cytoplasm.
In human cells, CK2α subunits shuttle between nucleus and cytoplasm, but they do
not seem to be strongly accumulated in the nucleolus, as in the case of plants (Martel
et al., 2002; Filhol et al., 2003). Concerning the CK2β regulatory subunits, CK2β1,
Figure 9.3. Subcellular localization of maize CK2 individual subunits and CK2 holoen-
zyme in leaf epidemis of N. benthamiana plants and in maize embryo. (A) General views
(40X) of Nicotiana benthamiana leaves co-infiltrated with a mixture of Agrobacterium sus-
pensions harboring the indicated constructs: CK2α1-GFP located in nucleus/nucleolus
(upper), and CK2α4-GFP located in chloroplast (lower), together with gene silencing sup-
pressor HcPro. (B) General views (40X) of Nicotiana benthamiana leaves co-infiltrated with
Agrobacterium containing the gene silencing suppressor HcPro and CK2β1-GFP, located in
nuclear speckles (upper), and CK2β3-GFP, located in nucleus and cytoplasm (lower). In panel
A and B, left corresponds to bright-field images (merged with epiflourescence) and right to
epifluorescence images. Red arrow points out the chloroplasts, and chlorophyll is in red. (C)
General views (40X) of Bimolecular Fluorescence Complementation (BiFC) assays in agro-
infiltrated tobacco leaves (left) and maize immature embryos transformed by bombardment
(right). In both cases, bright-field images (merged with epiflourescence) are shown. (D) 20X
views of leaves from N. bentamiana plants transiently transformed by agroinfiltration with
K2 pCAMBIA 1302 vector with GFP alone as control and HcPro. Bar = 20 µm. For color detail,
see color plate.
CK2β2, and CK2β4 are mainly located in nuclear speckles, whereas CK2β3 can be
found in both nucleus and cytoplasm (Riera et al., 2004). In maize, it has been
recently reported that the presence of plant-specific N-terminal domain of CK2β
enhances the protein aggregation in nuclear speckles, where it is assumed to be
tightly complexed and less accessible to degradation machinery (Riera et al., 2011).
Little is known about CK2 holoenzyme localization in plants, but recent work per-
formed in our lab by using bimolecular fluorescence complementation (BiFC)
assays shows the nuclear and cytoplasmic location of the maize CK2 holoenzyme
composed by α1β1 subunits, in contrast to the individual CK2α/β subunits localiza-
tion, mainly observed in the nucleus (Figure 9.3). Thus, the differential localization
of plant CK2α/β isoforms in the cell suggests that both types of subunits could be
found independently in different cellular compartments, and they probably indepen-
dently move in the cell, as reported for animals (Faust and Montenarh 2000; Martel
et al., 2002; Filhol et al., 2003).
Another example of the specific role of plant CK2 isoforms is found in Arabi-
dopsis where only CK2B3 and CK2B4 isoforms have been described to play a role
in circadian-clock regulation (Sugano et al., 1999; Perales et al., 2006). In addition,
it has been shown that CKB4 isoform is ubiquitinated and subsequently degraded
by the proteasome pathway in a process controlled by the circadian clock (Perales
et al., 2006). In animals, it has been demonstrated that CK2β subunits are degraded
by a proteasome-dependent pathway and that phosphorylation enhances CK2β
protein stability (Zhang et al., 2002). In the case of Arabidopsis, the phosphorylated
isoforms of CKB4 are the preferred substrate for degradation. This is a clear
example of both the conserved similarities (phosphorylation, ubiquitination, and
degradation) and distinctive features (stability of isoforms) between CK2β subunits
in plants and mammals.
To sum up, it is likely that in plants, regulation of the CK2 isoforms expression,
degradation, and subcellular distribution could be a mechanism for regulating the
substrate specificity of CK2 through the formation of different CK2 holoenzyme
complexes.
Through the years, genetic approaches have been difficult in the case of plant CK2
as a result of the multiple genes coding for CK2αβ subunits and also because of
the evidence that yeast CK2 is essential for viability, since depletion of CK2α is
lethal for the organisms (Padmanabha et al., 1990). Several strategies have been
used to partially inactivate CK2 activity in plants. The Arabidopsis CK2α antisense
plants were the first CK2 transgenic lines described, and their phenotype confirmed
the role of CK2 in light-regulated gene expression and plant growth (Lee et al.,
1999). Moreover, a dominant-negative for CK2α has been described. In this case,
a CK2 kinase-inactive mutant has been generated by site-directed mutagenesis of
an essential Lysine residue of CK2α. Phenotypes associated with these plants affect
chloroplast development, cotyledon expansion, and root and shoot growth, as well K2
as different aspects of plant development as cell division, cell expansion, and auxin
also involved in SA signaling, has been identified as a new substrate for CK2 in
Arabidopsis (Tosoni et al., 2011). Moreover, it has been shown that activity of phy-
tochelatin synthase (PCS), a protein involved in biotic and heavy metal stress
responses in plants, is increased following phosphorylation by CK2 (Wang et al.,
2009).
CK2 also plays a prominent role phosphorylating proteins involved in many
DNA-dependent processes, such as DNA replication, transcription, translation,
recombination, repair, or ribosome biogenesis.
Arabidopsis and wheat translation initiation factors eIF2alpha, eIF2beta, eIF3c,
eIF4B and eIF5 are phosphorylated by CK2 (Dennis and Browning, 2009; Dennis
et al., 2009). In these works, it is postulated that, by differential phosphorylation of
initiation factor complexes, CK2 holoenzymes may regulate the translation of spe-
cific mRNAs or the stability of various initiation factors in response to abiotic or
biotic stress, development, or changes in the cell cycle. In maize, eukaryotic transla-
tion initiation factor 5A (ZmeIF5A) co-purifies with the catalytic subunit of protein
kinase CK2 and is phosphorylated by this enzyme. This phosphorylation plays a
role in the regulation of the nucleocytoplasmic shuttling of eIF5A in plant cells
(Lebska et al., 2010; Lewandowska-Gnatowska et al., 2011).
The acidic phosphoproteins (P-proteins) P0, P1, and P2 interact with elongation
factors, mRNA, and tRNA during translation, and CK2 phosphorylation of the
P-proteins caused dynamic changes in the P-protein complex (Hasler et al., 1991;
Bailey-Serres et al., 1997).
Among the nuclear proteins regulated by CK2 phosphorylation in plants, there
are the high mobility group (HMG) proteins that are described as chromosomal
proteins and seem to act primarily as architectural facilitators in the manipulation
of nucleoprotein complexes. Several maize and Arabidopsis HMGB proteins are
phosphorylated by CK2, and this phosphorylation increases their thermal stability
and affects their DNA binding activity (Stemmer et al., 2002; Stemmer et al., 2003;
Krohn et al., 2003).
In peas, enzymes involved in DNA transcription as DNA helicase I (PDH65) and
DNA topoisomerase I are modified by phosphorylation. In the case of PDH65, the
DNA and RNA unwinding activities were upregulated after phosphorylation of
PDH65 with CK2 and cdc2 protein kinases (Tuteja et al., 2008). For DNA topoi-
somerase I, its activity increased after phosphorylation with exogenous CK2 and
PKC (Tuteja et al., 2003).
In animals, the nuclear matrix (NM), which plays a major role in growth-related
activities, is a primary locus for CK2 signaling (Yu et al., 2001). In plants, several
NM associated proteins have been found to be phosphorylated by CK2: the pea
functional homologues of lamins (Li and Roux, 1992) and MFP1 from tomato and
Allium cepa (Meier et al., 1996; Samaniego et al., 2006), and their phosphorylation
seems to modulate their binding to NM. Also NopA64, a nucleolar protein that
shares immunological determinants with mammalian nucleolin, is phosphorylated
by CK2 (de Cárcer et al., 1997).
Finally, as shown in Table 9.2, other kinds of proteins have been described as
plant CK2 substrates, as calreticulin, which is specifically phosphorylated in plants.
K2 In addition, it seems that this protein is not a CK2 substrate in other animal systems
such as rat liver (Baldan et al., 1996) and storage proteins, proteaosome subunits,
References
Dennis MD, Browning KS. 2009. Differential phosphorylation of plant translation initiation
factors by Arabidopsis thaliana CK2 holoenzymes. J Biol Chem 284:20602–20614.
Dennis MD, Person MD, Browning KS. 2009. Phosphorylation of plant translation initiation
factors by CK2 enhances the in vitro interaction of multifactor complex components.
J Biol Chem 284:20615–20628.
Dobrowolska G, Boldyreff B, Issinger OG. 1991. Cloning and sequencing of the casein kinase
2 alpha subunit from Zea mays. Biochim Biophys Acta 1129:139–140.
Dobrowolska G, Meggio F, Marchiori F, Pinna LA. 1989. Specificity determinants of maize
casein kinase-IIB are related to but distinct from those of rat liver casein kinase-2. Biochim
Biophys Acta 1010:274–277.
Espunya MC, Combettes B, Dot J, Chaubet-Gigot N, Martínez MC. 1999. Cell-cycle modula-
tion of CK2 activity in tobacco BY-2 cells. Plant J 19:655–666.
Espunya MC, Lopez-Giraldez T, Hernan I, Carballo M, Martinez MC. 2005. Differential
expression of genes encoding protein kinase CK2 subunits in the plant cell cycle. J Exp
Bot 56:3183–3192.
Espunya MC, Martinez MC. 2003. In situ hybridization analysis of protein kinase CK2
expression during plant development. Physiol Plant 117:573–578.
Faust M, Montenarh M. 2000. Subcellular localization of protein kinase CK2. A key to its
function? Cell Tissue Res 301:329–340.
Filhol O, Nueda A, Martel V, Gerber-Scokaert D, Benitez MJ, Souchier C, Saoudi Y, Cochet
C. 2003. Live-Cell Fluorescence Imaging Reveals the Dynamics of Protein Kinase CK2
Individual Subunits. Mol Cell Biol 23:975–987.
Godoy J, Lunar R, Torres-Schumann S, Moreno J, Rodrigo R, Pintor-Toro J. 1994 Expression,
tissue distribution and subcellular localization of dehydrin TAS14 in salt-stressed tomato
plants. Plant Mol Biol 26:1921–1934.
Graham KC, Litchfield DW. 2000. The regulatory beta subunit of protein kinase CK2 medi-
ates formation of tetrameric CK2 complexes. J Biol Chem 275:5003–5010.
Guerra B, Issinger O-G, Wang JYJ. 2003. Modulation of human checkpoint kinase Chk1 by
the regulatory [beta]-subunit of protein kinase CK2. Oncogene 22:4933–4942.
Hardtke CS, Gohda K, Osterlund MT, Oyama T, Okada K, Deng XW. 2000. HY5 stability
and activity in Arabidopsis is regulated by phosphorylation in its COP1 binding domain.
EMBO J 19:4997–5006.
Hasler P, Brot N, Weissbach H, Parnassa AP, Elkon KB. 1991. Ribosomal proteins P0, P1,
and P2 are phosphorylated by casein kinase II at their conserved carboxyl termini. J Biol
Chem 266:13815–13820.
Hidalgo P, Garreton V, Berrios CG, Ojeda H, Jordana X, Holuigue L. 2001. A Nuclear Casein
Kinase 2 Activity Is Involved in Early Events of Transcriptional Activation Induced by
Salicylic Acid in Tobacco. Plant Physiol 125:396–405.
Hsieh HL, Song CJ, Roux SJ. 2000. Regulation of a recombinant pea nuclear apyrase by
calmodulin and casein kinase II. Biochim Biophys Acta 1494:248–255.
Kanekatsu M, Ezumi A, Nakamura T, Ohtsuki K. 1995. Chloroplast Ribonucleoproteins
(RNPs) as Phosphate Acceptors for Casein Kinase II: Purification by ssDNA-Cellulose
Column Chromatography. Plant Cell Physiol 36:1649–1656.
Kanekatsu M, Munakata H, Furuzono K, Ohtsuki K. 1993. Biochemical characterization of
a 34 kda ribonucleoprotein (p34) purified from the spinach chloroplast fraction as an
K2
effective phosphate acceptor for casein kinase II. FEBS Letters 335:176–180.
Kanekatsu M, Saito H, Motohashi K, Hisabori T. 1998 The beta subunit of chloroplast ATP
synthase (CF0CF1-ATPase) is phosphorylated by casein kinase II. Biochem Mol Biol Int
46:99–105.
Kang HG, Klessig DF. 2005. Salicylic acid-inducible Arabidopsis CK2-like activity phos-
phorylates TGA2. Plant Mol Biol 57:541–557.
Kanhonou R, Serrano R, Ros Palau R. 2001. A catalytic subunit of the sugar beet protein
kinase CK2 is induced by salt stress and increases NaCl tolerance in Saccharomyces
cerevisiae. Plant Mol Biol 47:571–579.
Klimczak L, Schindler U, Cashmore A. 1992. DNA binding activity of the Arabidopsis G-box
binding factor GBF1 is stimulated by phosphorylation by casein kinase II from broccoli.
Plant Cell 4:87–98.
Klimczak L, Collinge M, Farini D, Giuliano G, Walker J, Cashmore A. 1995. Reconstitution
of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of tran-
scription factor GBF1. Plant Cell 7:105–115.
Krohn NM, Stemmer C, Fojan P, Grimm R, Grasser KD. 2003. Protein kinase CK2 phos-
phorylates the high mobility group domain protein SSRP1, inducing the recognition of
UV-damaged DNA. J Biol Chem 278:12710–12715.
Lebska M, Ciesielski A, Szymona L, Godecka L, Lewandowska-Gnatowska E, Szczegielniak
J, Muszynska G. 2010. Phosphorylation of maize eukaryotic translation initiation factor
5A (eIF5A) by casein kinase 2: identification of phosphorylated residue and influence on
intracellular localization of eIF5A. J Biol Chem 285:6217–6226.
Lebska M, Szczegielniak J, Dobrowolska G, Cozza G, Moro S, Muszynska G. 2009. A novel
splicing variant encoding putative catalytic alpha subunit of maize protein kinase CK2.
Physiol Plant 136:251–263.
Lee Y, Lloyd AM, Roux SJ. 1999. Antisense Expression of the CK2 α Subunit Gene in Ara-
bidopsis. Effects on Light-Regulated Gene Expression and Plant Growth. Plant Physiol
119:989–1000.
Leroy D, Heriche JK, Filhol O, Chambaz EM, Cochet C. 1997. Binding of polyamines to an
autonomous domain of the regulatory subunit of protein kinase CK2 induces a conforma-
tional change in the holoenzyme. A proposed role for the kinase stimulation. J Biol Chem
272:20820–20827.
Lewandowska-Gnatowska E, Szymona L, Lebska M, Szczegielniak J, Muszynska G. 2011.
Phosphorylation of maize eukaryotic translation initiation factor on Ser2 by catalytic
subunit CK2. Mol Cell Biochem 356:241–244.
Li H, Roux SJ. 1992. Casein kinase II protein kinase is bound to lamina-matrix and phos-
phorylates lamin-like protein in isolated pea nuclei. Proc Natl Acad Sci USA
89:8434–8438.
Lisitsky I, Schuster G. 1995. Phosphorylation of a chloroplast RNA-binding protein changes
its affinity to RNA. Nucleic Acids Res 23.
Litchfield DW. 2003. Protein kinase CK2: structure, regulation and role in cellular decisions
of life and death. Biochem J 369:1–15.
Litchfield DW, Lozeman FJ, Cicirelli MF, Harrylock M, Ericsson LH, Piening CJ, Krebs EG.
1991. Phosphorylation of the beta subunit of casein kinase II in human A431 cells. Iden-
tification of the autophosphorylation site and a site phosphorylated by p34cdc2. J Biol
Chem 266:20380–20389.
Loschelder H, Homann A, Ogrzewalla K, Link G. 2004. Proteomics-based sequence analysis
of plant gene expression—the chloroplast transcription apparatus. Phytochemistry K2
65:1785–1793.
Lu SX, Liu H, Knowles SM, Li J, Ma L, Tobin EM, Lin C. 2011. A role for protein kinase
CK2 alpha subunits in the Arabidopsis circadian clock. Plant Physiol 157:1537–1545.
Marquès-Bueno MM, Moreno-Romero J, Abas L, De Michele R, Martínez MC. 2011. A
dominant negative mutant of protein kinase CK2 exhibits altered auxin responses in Ara-
bidopsis. Plant J 67:169–180.
Martel V, Filhol O, Nueda A, Cochet C. 2002. Dynamic localization/association of protein
kinase CK2 subunits in living cells: a role in its cellular regulation? Ann N Y Acad Sci
973:272–277.
Meier I, Phelan T, Gruissem W, Spiker S, Schneider D. 1996. MFP1, a novel plant filament-
like protein with affinity for matrix attachment region DNA. Plant Cell 8:2105–2115.
Meggio F, Boldyreff B, Issinger O-G, Pinna LA. 1994. Casein Kinase 2 Down-Regulation
and Activation by Polybasic Peptides Are Mediated by Acidic Residues in the 55–64
Region of the β Subunit. A Study with Calmodulin As Phosphorylatable Substrate. Bio-
chemistry 33:4336–4342.
Meggio F, Pinna LA. 2003. One-thousand-and-one substrates of protein kinase CK2? FASEB
J 17:349–368.
Mehra A, Shi M, Baker CL, Colot HV, Loros JJ, Dunlap JC. 2009. A Role for Casein Kinase
2 in the Mechanism Underlying Circadian Temperature Compensation. Cell 137:
749–760.
Mizoguchi T, Putterill J, Ohkoshi Y. 2006. Kinase and Phosphatase: The Cog and Spring of
the Circadian Clock, In: Kwang WJ (Ed.), Int Rev Cytol. Academic Press, pp. 47–72.
Moreno-Romero J, Armengot L, Marquès-Bueno M, Cadavid-Ordóñez M, Martínez M. 2011.
About the role of CK2 in plant signal transduction. Mol Cell Biochem 356:233–240.
Moreno-Romero J, Espunya M, Platara M, Ariño J, Martínez M. 2008. A role for protein
kinase CK2 in plant development: evidence obtained using a dominant-negative mutant.
Plant J 55:118–130.
Mulekar JJ, Bu Q, Chen F, Huq E. 2012. Casein kinase II alpha subunits affect multiple
developmental and stress-responsive pathways in Arabidopsis. Plant J 69:343–354.
Niefind K, Guerra B, Ermakowa I, Issinger O-G. 2001. Crystal structure of human protein
kinase CK2: insights into basic properties of the CK2 holoenzyme. EMBO J
20:5320–5331.
Niefind K, Guerra B, Pinna LA, Issinger O-G, Schomburg D. 1998. Crystal structure of the
catalytic subunit of protein kinase CK2 from Zea mays at 2.1 A resolution. EMBO J
17:2451–2462.
Niefind K, Raaf J, Issinger OG. 2009. Protein kinase CK2 in health and disease: Protein
kinase CK2: from structures to insights. Cell Mol Life Sci 66:1800–1816.
Nieva C, Busk PK, Dominguez-Puigjaner E, Lumbreras V, Testillano PS, Risueno MC, Pages
M. 2005. Isolation and functional characterisation of two new bZIP maize regulators of
the ABA responsive gene rab28. Plant Mol Biol 58:899–914.
Ogiso E, Takahashi Y, Sasaki T, Yano M, Izawa T. 2010. The role of casein kinase II in flower-
ing time regulation has diversified during evolution. Plant Physiol 152:808–820.
Ogrzewalla K, Piotrowski M, Reinbothe S, Link G. 2002. The plastid transcription kinase
from mustard (Sinapis alba L.). A nuclear-encoded CK2-type chloroplast enzyme with
redox-sensitive function. Eur J Biochem 269:3329–3337.
Yan TF, Tao M. 1982. Purification and characterization of a wheat germ protein kinase. J Biol
Chem 257:7037–7043.
Yu S, Wang H, Davis A, Ahmed K. 2001. Consequences of CK2 signaling to the nuclear
matrix. Mol Cell Biochem 227:67–71.
Zhang C, Vilk G, Canton DA, Litchfield DW. 2002. Phosphorylation regulates the stability
of the regulatory CK2 subunit. Oncogene 21:3754–3764.
K2