4.38 Rating by ClearWebStats
basantplanners.com is 6 years 1 month 4 days old. This website has a #3,825,193 rank in global traffic. It has a com as an domain extension. The DNS for Basantplanners is hosted at 162.241.148.33. While no active threats were reported recently by users, basantplanners.com is SAFE to browse.
Get Custom Widget

Traffic Report of Basantplanners

Daily Unique Visitors: 126
Daily Pageviews: 252

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 3,825,193
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View basantplanners.com site advisor rating Not Applicable

Where is basantplanners.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with basantplanners.com

Hosted Country:

basantplanners.com hosted country US basantplanners.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View basantplanners.com HTML resources

Homepage Links Analysis

Basant planners – Basant Plannners & Contracters

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • basantplanners.co
  • basantplanners.cm
  • basantplanners.con
  • basantplanners.net
  • basantplanners.org
  • bbasantplanners.com
  • baasantplanners.com
  • bassantplanners.com
  • basaantplanners.com
  • basanntplanners.com
  • basanttplanners.com
  • basantpplanners.com
  • basantpllanners.com
  • basantplaanners.com
  • basantplannners.com

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 5
H3 Headings: 1 H4 Headings: 3
H5 Headings: 1 H6 Headings: 9
Total IFRAMEs: Not Applicable Total Images: 32
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

basantplanners.com favicon - jenniferchemsales.com

View basantplanners.com Pagerank   basantplanners.com alexa rank Not Applicable   basantplanners.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

basantplanners.com favicon - shrivishwakarmasafetytraininginstitute.com

View basantplanners.com Pagerank   basantplanners.com alexa rank Not Applicable   basantplanners.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

basantplanners.com favicon - theshineenglishacademy.com

View basantplanners.com Pagerank   basantplanners.com alexa rank Not Applicable   basantplanners.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

basantplanners.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View basantplanners.com Pagerank   basantplanners.com alexa rank Not Applicable   basantplanners.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

basantplanners.com favicon - 247bestpillpharma.com

View basantplanners.com Pagerank   basantplanners.com alexa rank Not Applicable   basantplanners.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 26 Jan 2020 23:47:30 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Link: <https://basantplanners.com/index.php?rest_route=/>; rel="https://api.w.org/", <https://basantplanners.com/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for basantplanners.com

Domain Registrar: BigRock Solutions Ltd basantplanners.com registrar info
Registration Date: 2020-01-20 6 years 1 month 4 days ago
Last Modified: 2020-01-20 6 years 1 month 4 days ago
Domain Status: clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net basantplanners.com name server information 162.241.148.33 basantplanners.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net basantplanners.com name server information 162.241.148.33 basantplanners.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
basantplanners.com A 10799 IP:162.241.148.33
basantplanners.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
basantplanners.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
basantplanners.com SOA 10800 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2020012005
Refresh:86400
Retry:7200
Expire:3600000
Minimum TTL:86400
basantplanners.com MX 14400 Target:mail.basantplanners.com
basantplanners.com TXT 14400 TXT:v=spf1 a mx include:webhostbox.net ~all

Similarly Ranked Websites to Basantplanners

Electronic Enclosure Cooling, Enclosure Air Conditioners, Hazardous Duty AC Units

basantplanners.com favicon - iceqube.com

We manufacture Enclosure Cooling for NEMA type Electronic Enclosures. Keep your enclosure cool with Air Conditioners, Heat Exchangers, and Filtered Fans from Ice Qube Enclosure Cooling Systems.

View basantplanners.com Pagerank   Alexa rank for basantplanners.com 3,825,200   website value of basantplanners.com $ 240.00

Home | H2 Wellness

basantplanners.com favicon - h2wellness.com

View basantplanners.com Pagerank   Alexa rank for basantplanners.com 3,825,202   website value of basantplanners.com $ 240.00

Comprar patinetes eléctricos - Todo Patinetes Eléctricos

basantplanners.com favicon - todopatinetes.com

Descubre toda la información que necesitas sobre patinetes eléctricos. Si estas pensando en comprar un patinete eléctrico, ¡date una vuelta por nuestra web!

View basantplanners.com Pagerank   Alexa rank for basantplanners.com 3,825,202   website value of basantplanners.com $ 240.00

Nantucket Hotels, Resorts - Accommodation | The Nantucket Hotel

basantplanners.com favicon - thenantuckethotel.com

Right in the heart of Nantucket, The Nantucket Hotel & Resort brings back the Island's only premier, all-season destination Nantucket Hotel.

View basantplanners.com Pagerank   Alexa rank for basantplanners.com 3,825,203   website value of basantplanners.com $ 240.00

The Message Box

basantplanners.com favicon - themsgbox.com

View basantplanners.com Pagerank   Alexa rank for basantplanners.com 3,825,205   website value of basantplanners.com $ 240.00

Full WHOIS Lookup for basantplanners.com

Domain Name: BASANTPLANNERS.COM
Registry Domain ID: 2482417751_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: http://www.bigrock.com
Updated Date: 2020-01-20T12:45:06Z
Creation Date: 2020-01-20T12:28:22Z
Registry Expiry Date: 2021-01-20T12:28:22Z
Registrar: BigRock Solutions Ltd
Registrar IANA ID: 1495
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-01-26T23:46:39Z