Web stats for Azenx - azenx.com

1.67 Rating by ClearWebStats
azenx.com is 9 years 4 months 1 week old. It has a com as an domain extension. The DNS for Azenx is hosted at 92.48.78.51. While no active threats were reported recently by users, azenx.com is SAFE to browse.
Get Custom Widget

Traffic Report of Azenx

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for azenx.com Good
WOT Privacy: WOT privacy rank for azenx.com Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 70on 100
Siteadvisor Rating
View azenx.com site advisor rating Not Applicable

Where is azenx.com server located?

Hosted IP Address:

92.48.78.51 View other site hosted with azenx.com

Hosted Country:

azenx.com hosted country GB azenx.com hosted country

Location Latitude:

51.5228

Location Longitude:

-0.71986

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View azenx.com HTML resources

Homepage Links Analysis

View azenx.com homepage link analysis

Azenx – Hi-Gear Inspiration

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • azenx.co
  • azenx.cm
  • azenx.con
  • azenx.net
  • azenx.org
  • aazenx.com
  • azzenx.com
  • azeenx.com
  • azennx.com
  • azenxx.com
  • zenx.com
  • aenx.com
  • aznx.com
  • azex.com
  • azen.com

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 3
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 92.48.78.51)

Nothing found for 406 Shtml

azenx.com favicon - i-doo.org

View azenx.com Pagerank   azenx.com alexa rank 3,656,703   azenx.com website value $ 240.00

The Prestige

azenx.com favicon - dianafigueroapa.com

View azenx.com Pagerank   azenx.com alexa rank 922,219   azenx.com website value $ 720.00

A Glass of Blessings -

azenx.com favicon - helmetcamfirefighter.com

View azenx.com Pagerank   azenx.com alexa rank 418,357   azenx.com website value $ 5,760.00

Chalet of the Smokies | Vacation blog

azenx.com favicon - chaletsofthesmokies.com

View azenx.com Pagerank   azenx.com alexa rank Not Applicable   azenx.com website value $ 8.95

蛻台ｺ倶ｺ倶ｻｶ縺ｮ隗｣豎ｺ繧貞ｼ∬ｭｷ螢ｫ縺ｫ萓晞

azenx.com favicon - newarkdelawarecriminaldefenselawyer.com

View azenx.com Pagerank   azenx.com alexa rank Not Applicable   azenx.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 406
Status: 406 Not Acceptable
Date: Wed, 19 Oct 2016 04:06:10 GMT
Server: Apache
X-Powered-By: PHP/5.4.30
Link: ; rel="https://api.w.org/", ; rel=shortlink
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for azenx.com

Domain Registrar: INTERNET DOMAIN SERVICE BS CORP azenx.com registrar info
Registration Date: 2016-10-11 9 years 4 months 1 week ago
Last Modified: 2016-10-12 9 years 4 months 1 week ago
Expiration Date: 2017-10-11 8 years 4 months 2 weeks ago
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.seafooddomains.com azenx.com name server information 213.229.101.106 azenx.com server is located in United Kingdom United Kingdom
ns2.seafooddomains.com azenx.com name server information 213.229.101.106 azenx.com server is located in United Kingdom United Kingdom

DNS Record Analysis

Host Type TTL Extra
azenx.com A 14400 IP:92.48.78.51
azenx.com NS 86400 Target:a.gtld-servers.net
azenx.com NS 86400 Target:c.gtld-servers.net
azenx.com NS 86400 Target:b.gtld-servers.net
azenx.com NS 86400 Target:d.gtld-servers.net
azenx.com SOA 86400 MNAME:a.gtld-servers.net
RNAME:postmaster.nocmonitoring.org
Serial:2016101400
Refresh:3600
Retry:7200
Expire:1209600
Minimum TTL:86400
azenx.com MX 14400 Target:azenx.com
azenx.com TXT 14400 TXT:v=spf1 ip4:92.48.96.23 a mx
include:relay.mailchannels.net ?all

Similarly Ranked Websites to Azenx

Just a moment...

azenx.com favicon - absolutefiction.com

View azenx.com Pagerank   Alexa rank for azenx.com Not Applicable   website value of azenx.com $ 15.95

SCOP agyRem Conseil - La SCOP agyRem Conseil

azenx.com favicon - agyrem.com

La SCOP agyRem Conseil est un cabinet coopératif engagé dans la professionnalisation de l'économie sociale et la promotion de la RSE en entreprise

View azenx.com Pagerank   Alexa rank for azenx.com Not Applicable   website value of azenx.com $ 8.95

Wyvern Jubilee Morris - Welcome One And All

azenx.com favicon - wjm.org.uk

Wyvern Jubilee Morris

View azenx.com Pagerank   Alexa rank for azenx.com Not Applicable   website value of azenx.com $ 8.95

Leaders Only - Keys of Spinal Cord Injuries

azenx.com favicon - leadersonly.info

Exploring the options of treatment and supplies of the disabled and those with brain and traumatic spinal cord injury.

View azenx.com Pagerank   Alexa rank for azenx.com Not Applicable   website value of azenx.com $ 8.95

eBuy Bangladesh: Bangladesh largest free online Real Estate Site|Largest Online Realestate Agent and Buy/Sell in Bangladesh|Real Estate Market in Bangladesh|Realestate Project and Ready Apartment...

azenx.com favicon - ebuybd.info

Real Estate Market in Bangladesh, Real Estate Market in Bangladesh, Realestate Project and Ready Apartment Listing in Bangladesh, Online Shopping in Bangladesh, Buy/Sell in Bangladesh, buy flat and apartment in bangladesh, apartment price,land price

View azenx.com Pagerank   Alexa rank for azenx.com Not Applicable   website value of azenx.com $ 8.95

Full WHOIS Lookup for azenx.com

Domain Name: AZENX.COM
Registry Domain ID: 2065266840_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.internet.bs
Registrar URL: http://www.internetbs.net
Updated Date: 2016-10-12T08:07:26Z
Creation Date: 2016-10-11T15:41:29Z
Registrar Registration Expiration Date: 2017-10-11T15:41:29Z
Registrar: Internet Domain Service BS Corp.
Registrar IANA ID: 2487
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.5167401179
Reseller:
Domain Status: clientTransferProhibited - http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Clive Pullen
Registrant Organization:
Registrant Street: 2 Whitehaven Road
Registrant City: LIVERPOOL
Registrant State/Province:
Registrant Postal Code: L5 0BB
Registrant Country: GB
Registrant Phone: +44.1516783324
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: [email protected]
Registry Admin ID:
Admin Name: Clive Pullen
Admin Organization:
Admin Street: 2 Whitehaven Road
Admin City: LIVERPOOL
Admin State/Province:
Admin Postal Code: L5 0BB
Admin Country: GB
Admin Phone: +44.1516783324
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: [email protected]
Registry Tech ID:
Tech Name: Clive Pullen
Tech Organization:
Tech Street: 2 Whitehaven Road
Tech City: LIVERPOOL
Tech State/Province:
Tech Postal Code: L5 0BB
Tech Country: GB
Tech Phone: +44.1516783324
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: [email protected]
Name Server: ns1.seafooddomains.com
Name Server: ns2.seafooddomains.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-10-19T04:05:58Z
Copyright © 2026 ClearWebStats.com, All Rights Reserved.
All brand names, logos, and trademarks appearing on this site are the property of their respective owners. ClearWebStats is an independent service that provides publicly available website statistics and is not affiliated with, endorsed by, or sponsored by any brand or website featured on this platform.