1.67 Rating by ClearWebStats
avmodels.us is 9 years 10 months 1 week old. This website has a #9,118,177 rank in global traffic. It has a us as an domain extension. The DNS for Avmodels is hosted at 173.237.137.16. While no active threats were reported recently by users, avmodels.us is SAFE to browse.
Get Custom Widget

Traffic Report of Avmodels

Daily Unique Visitors: 53
Daily Pageviews: 106

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 9,118,177
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 54on 100
Siteadvisor Rating
View avmodels.us site advisor rating Not Applicable

Where is avmodels.us server located?

Hosted IP Address:

173.237.137.16 View other site hosted with avmodels.us

Hosted Country:

avmodels.us hosted country US avmodels.us hosted country

Location Latitude:

30.3423

Location Longitude:

-97.6673

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View avmodels.us HTML resources

Homepage Links Analysis

Awesome Variety of Models | Update with Most Standard-able Fashion Style

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • aavmodels.us
  • avvmodels.us
  • avmmodels.us
  • avmoodels.us
  • avmoddels.us
  • avmodeels.us
  • avmodells.us
  • avmodelss.us
  • vmodels.us
  • amodels.us
  • avodels.us
  • avmdels.us
  • avmoels.us
  • avmodls.us
  • avmodes.us

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 31 H4 Headings: 6
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 39
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 173.237.137.16)

Add website, add your company, free listing

avmodels.us favicon - alplist.com

View avmodels.us Pagerank   avmodels.us alexa rank 16,662   avmodels.us website value $ 498,960.00


No Nonsense Fat Melting System Review - Does It Work? PDF Download!

avmodels.us favicon - nononsensefatmeltingsystemreviews.com

Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.

View avmodels.us Pagerank   avmodels.us alexa rank Not Applicable   avmodels.us website value $ 8.95

Finetest Functional ATE and Power Supply Testers

avmodels.us favicon - finetest2.com

Power Supply Testers, Functional ATE, Military and Aerospace Systems, Functional ATE Systems, Power Supply Test Systems, Hi-Pot Test Systems, ESS Monitoring Systems, Burnin Monitoring Systems, Vibration Monitoring Systems, Manual Test Systems, Test Fixtures and ITAs, Box Builds and Sub-Assemblies, Switching Cards, IO Cards, Custom Cabinets, Custom Cabinet Accessories, Fixtures, Test Programs, UPS Testers, Burn-In, Hipot, Military Power...

View avmodels.us Pagerank   avmodels.us alexa rank Not Applicable   avmodels.us website value $ 8.95

Websites Directory Network

avmodels.us favicon - websitedirectorynetwork.com

View avmodels.us Pagerank   avmodels.us alexa rank 769,618   avmodels.us website value $ 960.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 06 Jul 2017 07:58:59 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Vary: Accept-Encoding
Link: ; rel="https://api.w.org/", ; rel=shortlink
ngpass_ngall: 1
Content-Encoding: gzip

Domain Information for avmodels.us

Domain Registrar: NEUSTAR INC. avmodels.us registrar info
Registration Date: 2016-04-10 9 years 10 months 1 week ago
Last Modified: 2017-05-17 8 years 9 months 1 week ago
Expiration Date: 2018-04-09 7 years 10 months 2 weeks ago
Domain Status: clientTransferProhibited
Owner's E-Mail: [email protected] avmodels.us owner email

Domain Nameserver Information

Host IP Address Country
ns2.speedydns.net avmodels.us name server information 162.214.129.84 avmodels.us server is located in United States United States
ns1.speedydns.net avmodels.us name server information 162.214.130.229 avmodels.us server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
avmodels.us A 86400 IP:173.237.137.16
avmodels.us NS 7200 Target:ns2.speedydns.net
avmodels.us NS 7200 Target:ns1.speedydns.net
avmodels.us SOA 86400 MNAME:ns1.speedydns.net
RNAME:none.none.com
Serial:2017051704
Refresh:3600
Retry:7200
Expire:1209600
Minimum TTL:86400
avmodels.us MX 86400 Target:avmodels.us
avmodels.us TXT 86400 TXT:v=spf1 +a +mx +ip4:65.99.237.24
+include:relay.mailchannels.net ~all

Similarly Ranked Websites to Avmodels

Home - Chalk Farm

avmodels.us favicon - chalkfarmhome.com

View avmodels.us Pagerank   Alexa rank for avmodels.us 9,118,196   website value of avmodels.us $ 8.95

Cherokee Trace in Jacksonville, Texas, Wild Animal Park

avmodels.us favicon - cherokeetrace.com

Nestled in the lush piney woods of East Texas, Cherokee Trace Drive-thru Safari is a wildlife park that is home to an amazing variety of wildlife. See over two dozen exotic and endangered species that thrive in an open habitat

View avmodels.us Pagerank   Alexa rank for avmodels.us 9,118,211   website value of avmodels.us $ 8.95

Jeneth | Online Entrepreneur Business Coach and Mentor

avmodels.us favicon - masteringyourdragons.com

View avmodels.us Pagerank   Alexa rank for avmodels.us 9,118,215   website value of avmodels.us $ 8.95

Surfing Games - Play Free Online Surfing Games

avmodels.us favicon - surfing-games.com

Feel the thrill by playing our Surfing Games for free. Ride your surfboard on crazy waves and enjoy our online surfing games.

View avmodels.us Pagerank   Alexa rank for avmodels.us 9,118,222   website value of avmodels.us $ 8.95

Home | UNG

avmodels.us favicon - uralnonproliferationgroup.com

View avmodels.us Pagerank   Alexa rank for avmodels.us 9,118,240   website value of avmodels.us $ 8.95

Full WHOIS Lookup for avmodels.us

Domain Name: AVMODELS.US
Domain ID: D52707387-US
Sponsoring Registrar: NAMESILO, LLC
Sponsoring Registrar IANA ID: 1479
Registrar URL (registration services): www.namesilo.com
Domain Status: clientTransferProhibited
Registrant ID: NS-2C77873CC3BB1
Registrant Name: Content Concord
Registrant Organization: Content Concord
Registrant Address1: 281 Gaylord Ct.
Registrant City: Multan
Registrant State/Province: Punjab
Registrant Postal Code: 60000
Registrant Country: Pakistan
Registrant Country Code: PK
Registrant Phone Number: +92.3367199988
Registrant Email: [email protected]
Registrant Application Purpose: P3
Registrant Nexus Category: C11
Administrative Contact ID: NS-2C77873CC3BB1
Administrative Contact Name: Content Concord
Administrative Contact Organization: Content Concord
Administrative Contact Address1: 281 Gaylord Ct.
Administrative Contact City: Multan
Administrative Contact State/Province: Punjab
Administrative Contact Postal Code: 60000
Administrative Contact Country: Pakistan
Administrative Contact Country Code: PK
Administrative Contact Phone Number: +92.3367199988
Administrative Contact Email: [email protected]
Administrative Application Purpose: P3
Administrative Nexus Category: C11
Billing Contact ID: NS-2C77873CC3BB1
Billing Contact Name: Content Concord
Billing Contact Organization: Content Concord
Billing Contact Address1: 281 Gaylord Ct.
Billing Contact City: Multan
Billing Contact State/Province: Punjab
Billing Contact Postal Code: 60000
Billing Contact Country: Pakistan
Billing Contact Country Code: PK
Billing Contact Phone Number: +92.3367199988
Billing Contact Email: [email protected]
Billing Application Purpose: P3
Billing Nexus Category: C11
Technical Contact ID: NS-2C77873CC3BB1
Technical Contact Name: Content Concord
Technical Contact Organization: Content Concord
Technical Contact Address1: 281 Gaylord Ct.
Technical Contact City: Multan
Technical Contact State/Province: Punjab
Technical Contact Postal Code: 60000
Technical Contact Country: Pakistan
Technical Contact Country Code: PK
Technical Contact Phone Number: +92.3367199988
Technical Contact Email: [email protected]
Technical Application Purpose: P3
Technical Nexus Category: C11
Name Server: NS2.SPEEDYDNS.NET
Name Server: NS1.SPEEDYDNS.NET
Created by Registrar: NAMESILO, LLC
Last Updated by Registrar: NAMESILO, LLC
Domain Registration Date: Sun Apr 10 07:10:19 GMT 2016
Domain Expiration Date: Mon Apr 09 23:59:59 GMT 2018
Domain Last Updated Date: Wed May 17 23:30:52 GMT 2017
DNSSEC: false

>>>> Whois database was last updated on: Thu Jul 06 07:57:35 GMT 2017