Web stats for Adsdetection - adsdetection.com

Advanced Detection Systems manufactures metal detectors for food processing, aggregate, mining and industrial recycling. Contact us to arrange FREE product testing!

4.67 Rating by ClearWebStats
adsdetection.com is 2 decades 6 years 2 months old. This website has a #2,889,388 rank in global traffic. It has a com as an domain extension. The DNS for Adsdetection is hosted at 160.153.55.232. While no active threats were reported recently by users, adsdetection.com is SAFE to browse.
Get Custom Widget

Traffic Report of Adsdetection

Daily Unique Visitors: 167
Daily Pageviews: 334

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 2,889,388
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
Score: 0on 100
Siteadvisor Rating
View adsdetection.com site advisor rating No Risk Issues

Where is adsdetection.com server located?

Hosted IP Address:

160.153.55.232 View other site hosted with adsdetection.com

Hosted Country:

adsdetection.com hosted country US adsdetection.com hosted country

Location Latitude:

33.6013

Location Longitude:

-111.8867

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable

Page Resources Breakdown

View adsdetection.com HTML resources

Homepage Links Analysis

View adsdetection.com homepage link analysis

Similar Domain Names

These are similar domain names that may be used for typosquatting or phishing attacks. Always verify the URL before entering any sensitive information.

  • adsdetection.co
  • adsdetection.cm
  • adsdetection.con
  • adsdetection.net
  • adsdetection.org
  • aadsdetection.com
  • addsdetection.com
  • adssdetection.com
  • adsddetection.com
  • adsdeetection.com
  • adsdettection.com
  • adsdeteection.com
  • adsdetecction.com
  • adsdetecttion.com
  • adsdetectiion.com

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 11
H3 Headings: 24 H4 Headings: 6
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 30
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 160.153.55.232)

233 Broadway

adsdetection.com favicon - 233broadway.com

View adsdetection.com Pagerank   adsdetection.com alexa rank Not Applicable   adsdetection.com website value $ 8.95

Betty Lou Paints

adsdetection.com favicon - bettyloupaints.com

Betty Lou Paints

View adsdetection.com Pagerank   adsdetection.com alexa rank Not Applicable   adsdetection.com website value $ 8.95

Split Stream

adsdetection.com favicon - splitstreamapp.com

Enjoy your favorite broadcasts from Twitch.tv and/or Mixer.com at the same time and on the same tab.

View adsdetection.com Pagerank   adsdetection.com alexa rank Not Applicable   adsdetection.com website value $ 8.95

Los Pensamientos de Dios – ID POR TODO EL MUNDO Y PREDICAD EL EVANGELIO

adsdetection.com favicon - lospensamientosdedios.com

View adsdetection.com Pagerank   adsdetection.com alexa rank Not Applicable   adsdetection.com website value $ 8.95

Glo Logistics

adsdetection.com favicon - glologistic.com

View adsdetection.com Pagerank   adsdetection.com alexa rank Not Applicable   adsdetection.com website value $ 8.95

HTTP Header Analysis

HTTP/2 200
date: Fri, 19 Feb 2021 16:04:32 GMT
server: Apache
last-modified: Tue, 26 Jan 2021 19:59:47 GMT
etag: "a640aa8-d447-5b9d318b0697f-gzip"
accept-ranges: bytes
vary: Accept-Encoding,User-Agent
content-encoding: gzip
content-length: 10523
content-type: text/html

Domain Information for adsdetection.com

Domain Registrar: NAMESILO, LLC adsdetection.com registrar info
Registration Date: 1999-12-16 2 decades 6 years 2 months ago
Last Modified: 2020-11-25 5 years 2 months 4 weeks ago
Domain Status: clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.dnsowl.com adsdetection.com name server information 162.159.26.136 adsdetection.com server is located in Unknown or Invalid Region Unknown or Invalid Region
ns2.dnsowl.com adsdetection.com name server information 162.159.26.49 adsdetection.com server is located in Unknown or Invalid Region Unknown or Invalid Region
ns3.dnsowl.com adsdetection.com name server information 162.159.26.234 adsdetection.com server is located in Unknown or Invalid Region Unknown or Invalid Region

DNS Record Analysis

Host Type TTL Extra
adsdetection.com A 7206 IP:160.153.55.232
adsdetection.com NS 172800 Target:ns1.dnsowl.com
adsdetection.com NS 172800 Target:ns2.dnsowl.com
adsdetection.com NS 172800 Target:ns3.dnsowl.com
adsdetection.com SOA 172800 MNAME:ns1.dnsowl.com
RNAME:hostmaster.dnsowl.com
Serial:1613750437
Refresh:7200
Retry:1800
Expire:1209600
Minimum TTL:600
adsdetection.com MX 7207 Priority:5
Target:mail.adsdetection.com
adsdetection.com TXT 7207 TXT:v=spf1 mx a:mail.adsdetection.com -all
adsdetection.com TXT 3600 TXT:cchj6o6o668lnd5ljkl24198ls
adsdetection.com TXT 3600 TXT:I1U85QEU24U4BAFEIC049Q7DKN

Similarly Ranked Websites to Adsdetection

Protech Group, leading flats and real estate developer in Guwahati

adsdetection.com favicon - protechgroup.in

Protech Group leading real estate developers in Guwahati, Assam. Flats all over Guwahati city.

View adsdetection.com Pagerank   Alexa rank for adsdetection.com 2,889,403   website value of adsdetection.com $ 240.00

ALTERNATIVEREMEDEES.COM - Home

adsdetection.com favicon - alternativeremedees.com

Overall Health and Spiritual Wellness. Holistic Wellness

View adsdetection.com Pagerank   Alexa rank for adsdetection.com 2,889,407   website value of adsdetection.com $ 240.00

Cleveland Furniture Store - Sedlak Interiors

adsdetection.com favicon - sedlakinteriors.com

Sedlak Interiors Cleveland Furniture Store servicing Solon, Cleveland, Canton, Medina, Akron, Youngstown, Ohio furniture stores has a great selection of living room, bedroom, dining room, home office, entertainment, accent tables, mattresses and more.

View adsdetection.com Pagerank   Alexa rank for adsdetection.com 2,889,415   website value of adsdetection.com $ 240.00

PDF Software | thefreepdfreader.com

adsdetection.com favicon - thefreepdfreader.com

Download PDF Software free from thefreepdfreader. Safe, recommended, editor-reviewed software files for your PC computer.

View adsdetection.com Pagerank   Alexa rank for adsdetection.com 2,889,420   website value of adsdetection.com $ 240.00

99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business

adsdetection.com favicon - 99jeeveswaydigitalmarketingservices.com

View adsdetection.com Pagerank   Alexa rank for adsdetection.com 2,889,426   website value of adsdetection.com $ 240.00

Full WHOIS Lookup for adsdetection.com

Domain Name: ADSDETECTION.COM
Registry Domain ID: 15411227_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: http://www.namesilo.com
Updated Date: 2020-11-25T20:55:42Z
Creation Date: 1999-12-16T17:43:50Z
Registry Expiry Date: 2022-12-16T17:43:50Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.DNSOWL.COM
Name Server: NS2.DNSOWL.COM
Name Server: NS3.DNSOWL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-02-19T16:04:23Z
Copyright © 2026 ClearWebStats.com, All Rights Reserved.
All brand names, logos, and trademarks appearing on this site are the property of their respective owners. ClearWebStats is an independent service that provides publicly available website statistics and is not affiliated with, endorsed by, or sponsored by any brand or website featured on this platform.